F400154

General Info

Members Datasets Scaffolds Average Seq Length
309 172 620 195

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100501943|Ga0075431_1005019432
Length 192
Sequence MLEKLRAYFERKIPITDEQFEFLKTVFIPRIVKKHEFVIRAGEVAKHGIFVVSGCLRTYTIDDKGKEHILQFSVEDWWTGDHNSYMTGTPTSQFIEALEDSEVLLFDDPSMQRLIAHIPAMAKQWIEGVQRHSAAESKRIASSLSATAEERYEDFLKKYPTMTQRVPQHMIASYLGITPETLSRIRKQRSRK

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
117 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
120 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
121 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
122 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
123 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
146 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
147 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
155 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
158 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
159 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
160 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
161 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
164 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
165 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
166 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
167 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
172 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.62
Nodule 0
Rhizoplane 1.29
Rhizosphere 75.4
Stem 0
Stem Tuber 0
Unclassified 11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100501943 3300006847 Bacteria 1204
2 JGI24737J22298_10002469 3300001990 Bacteria 6590
3 JGI24735J21928_10000010 3300002067 Bacteria 237152
4 JGI24735J21928_10087160 3300002067 Unclassified 895
5 JGI24744J21845_10003782 3300002077 Bacteria 3124
6 JGI25154J39366_1008766 3300002738 Bacteria 1284
7 rootH1_10001009 3300003316 Bacteria 29528
8 rootH2_10024913 3300003320 Bacteria 12176
9 rootH2_10032267 3300003320 Bacteria 7107
10 rootH2_10153958 3300003320 Bacteria 2837
11 rootH2_10187385 3300003320 Unclassified 1214
12 rootL2_10000188 3300003322 Bacteria 10550
13 rootH1_10008215 3300003323 Bacteria 11575
14 rootH1_10061802 3300003316 Bacteria 3080
15 rootH1_10061802 3300003323 Bacteria 2799
16 rootH1_10070420 3300003316 Bacteria 6631
17 rootH1_10070420 3300003323 Unclassified 3457
18 rootH1_10088246 3300003323 Bacteria 3904
19 rootH1_10089992 3300003323 Bacteria 2926
20 Ga0055542_1006687 3300003762 Bacteria 2433
21 Ga0055531_10000696 3300003794 Bacteria 28673
22 Ga0065714_10092887 3300005288 Bacteria 1847
23 Ga0070658_10354389 3300005327 Bacteria 1256
24 Ga0070676_10036526 3300005328 Bacteria 2831
25 Ga0070683_100001053 3300005329 Bacteria 20720
26 Ga0070670_100027052 3300005331 Bacteria 4934
27 Ga0068869_101165297 3300005334 Bacteria 676
28 Ga0070666_10000146 3300005335 Bacteria 48247
29 Ga0068868_100092625 3300005338 Bacteria 2436
30 Ga0068868_100218593 3300005338 Bacteria 1594
31 Ga0068868_100276343 3300005338 Unclassified 1420
32 Ga0070660_100049132 3300005339 Bacteria 3242
33 Ga0070660_100051537 3300005339 Bacteria 3170
34 Ga0070668_100182543 3300005347 Bacteria 1715
35 Ga0070671_100036761 3300005355 Bacteria 4061
36 Ga0070659_100000844 3300005366 Bacteria 22367
37 Ga0070659_100072355 3300005366 Bacteria 2743
38 Ga0070667_100003381 3300005367 Bacteria 13606
39 Ga0070662_100000020 3300005457 Bacteria 99425
40 Ga0068867_100000495 3300005459 Bacteria 26352
41 Ga0068867_100016808 3300005459 Bacteria 5199
42 Ga0068867_100283732 3300005459 Bacteria 1359
43 Ga0070698_100141399 3300005471 Bacteria 2358
44 Ga0070684_100000997 3300005535 Bacteria 20187
45 Ga0068853_100137895 3300005539 Bacteria 2188
46 Ga0070665_100000006 3300005548 Bacteria 718034
47 Ga0068855_100000302 3300005563 Bacteria 61501
48 Ga0068855_100019329 3300005563 Bacteria 8185
49 Ga0068855_100025220 3300005563 Bacteria 7118
50 Ga0068855_100188889 3300005563 Bacteria 2325
51 Ga0068855_100385134 3300005563 Bacteria 1539
52 Ga0068855_101391354 3300005563 Bacteria 723
53 Ga0068857_100020432 3300005577 Bacteria 5823
54 Ga0068857_100246429 3300005577 Bacteria 1637
55 Ga0068856_100043338 3300005614 Unclassified 4427
56 Ga0068856_100098570 3300005614 Bacteria 2913
57 Ga0068856_100159570 3300005614 Bacteria 2265
58 Ga0068856_100219698 3300005614 Unclassified 1916
59 Ga0068856_100432563 3300005614 Bacteria 1336
60 Ga0068852_100304992 3300005616 Bacteria 1542
61 Ga0068859_100003931 3300005617 Bacteria 15178
62 Ga0068859_100014563 3300005617 Bacteria 7899
63 Ga0068851_10147365 3300005834 Bacteria 1284
64 Ga0068851_10489276 3300005834 Bacteria 736
65 Ga0068863_100017218 3300005841 Bacteria 6930
66 Ga0068863_100099214 3300005841 Bacteria 2767
67 Ga0068858_100265054 3300005842 Unclassified 1634
68 Ga0068858_100633715 3300005842 Bacteria 1038
69 Ga0068860_100000034 3300005843 Bacteria 243128
70 Ga0068860_100010052 3300005843 Bacteria 9375
71 Ga0068860_100010563 3300005843 Bacteria 9123
72 Ga0068860_100086390 3300005843 Bacteria 2985
73 Ga0068860_100104383 3300005843 Bacteria 2706
74 Ga0068860_100449026 3300005843 Bacteria 1282
75 Ga0075366_10000235 3300006195 Bacteria 24550
76 Ga0075366_10014742 3300006195 Bacteria 4470
77 Ga0075366_10245773 3300006195 Bacteria 1091
78 Ga0097621_100002757 3300006237 Bacteria 12014
79 Ga0097621_100253292 3300006237 Bacteria 1542
80 Ga0097621_100463185 3300006237 Unclassified 1144
81 Ga0068871_100020296 3300006358 Bacteria 5089
82 Ga0068871_100155729 3300006358 Bacteria 1951
83 Ga0068871_100252210 3300006358 Bacteria 1537
84 Ga0075428_101087741 3300006844 Bacteria 845
85 Ga0068865_100000874 3300006881 Bacteria 17075
86 Ga0068865_100020515 3300006881 Unclassified 4286
87 Ga0097620_100003931 3300006931 Bacteria 15178
88 Ga0097620_100014564 3300006931 Bacteria 7899
89 Ga0105240_10000954 3300009093 Bacteria 51582
90 Ga0105240_10021095 3300009093 Bacteria 8672
91 Ga0105240_10049178 3300009093 Bacteria 5323
92 Ga0105240_10510307 3300009093 Unclassified 1336
93 Ga0105240_11032226 3300009093 Unclassified 878
94 Ga0111539_10500411 3300009094 Bacteria 1415
95 Ga0105245_10613278 3300009098 Bacteria 1116
96 Ga0114129_10004115 3300009147 Bacteria 20550
97 Ga0105241_10020110 3300009174 Unclassified 4931
98 Ga0105241_10077759 3300009174 Unclassified 2591
99 Ga0105241_10167052 3300009174 Bacteria 1814
100 Ga0105241_10228664 3300009174 Bacteria 1567
101 Ga0105241_11105127 3300009174 Bacteria 747
102 Ga0105242_10072172 3300009176 Bacteria 2866
103 Ga0105242_10240064 3300009176 Bacteria 1628
104 Ga0105237_10000056 3300009545 Bacteria 151313
105 Ga0105237_10000171 3300009545 Bacteria 90778
106 Ga0105237_10005233 3300009545 Bacteria 14677
107 Ga0105237_10023468 3300009545 Bacteria 6320
108 Ga0105237_10027897 3300009545 Bacteria 5754
109 Ga0105237_10029846 3300009545 Bacteria 5538
110 Ga0105237_10120868 3300009545 Bacteria 2614
111 Ga0105238_10005189 3300009551 Bacteria 12873
112 Ga0105238_10042541 3300009551 Unclassified 4600
113 Ga0105238_10226638 3300009551 Bacteria 1845
114 Ga0105239_10000047 3300010375 Bacteria 179834
115 Ga0105239_10000064 3300010375 Bacteria 151674
116 Ga0105239_10000609 3300010375 Bacteria 50949
117 Ga0105239_10002280 3300010375 Bacteria 24494
118 Ga0105239_10022305 3300010375 Bacteria 6980
119 Ga0105239_10070516 3300010375 Bacteria 3839
120 Ga0105239_10102058 3300010375 Unclassified 3175
121 Ga0105239_10405366 3300010375 Bacteria 1543
122 Ga0105246_10425096 3300011119 Unclassified 1110
123 Ga0157373_10018735 3300013100 Bacteria 5038
124 Ga0157371_10013314 3300013102 Bacteria 6254
125 Ga0157369_10055395 3300013105 Bacteria 4281
126 Ga0157374_10010710 3300013296 Bacteria 7898
127 Ga0157374_10119626 3300013296 Bacteria 2540
128 Ga0157374_10503496 3300013296 Unclassified 1216
129 Ga0157374_10816777 3300013296 Bacteria 948
130 Ga0157378_10008248 3300013297 Bacteria 9083
131 Ga0157378_10037931 3300013297 Bacteria 4270
132 Ga0157378_10047748 3300013297 Bacteria 3806
133 Ga0157378_10064300 3300013297 Bacteria 3281
134 Ga0163162_10001344 3300013306 Bacteria 22904
135 Ga0163162_10005952 3300013306 Bacteria 11807
136 Ga0157372_10017858 3300013307 Bacteria 7621
137 Ga0157372_10242163 3300013307 Unclassified 2093
138 Ga0157380_10025347 3300014326 Bacteria 4497
139 Ga0157377_10013291 3300014745 Bacteria 4165
140 Ga0157376_10018856 3300014969 Bacteria 5304
141 Ga0157376_10025489 3300014969 Bacteria 4658
142 Ga0157376_10067671 3300014969 Bacteria 3021
143 Ga0157376_10569016 3300014969 Bacteria 1124
144 Ga0163161_10003462 3300017792 Bacteria 11058
145 Ga0163161_10059542 3300017792 Bacteria 2777
146 Ga0163161_10382040 3300017792 Bacteria 1126
147 Ga0209258_100278 3300025242 Bacteria 86316
148 Ga0209646_1002118 3300025246 Bacteria 4621
149 Ga0209646_1007324 3300025246 Unclassified 1805
150 Ga0209026_1002815 3300025250 Bacteria 6161
151 Ga0209148_1000248 3300025254 Bacteria 86083
152 Ga0209257_1000005 3300025304 Bacteria 1592528
153 Ga0207656_10318823 3300025321 Bacteria 772
154 Ga0207655_1000038 3300025728 Bacteria 348340
155 Ga0207680_10002328 3300025903 Bacteria 8840
156 Ga0207647_10000117 3300025904 Bacteria 61849
157 Ga0207647_10084502 3300025904 Bacteria 1899
158 Ga0207645_10045356 3300025907 Bacteria 2810
159 Ga0207705_10289016 3300025909 Bacteria 1256
160 Ga0207654_10000524 3300025911 Bacteria 21970
161 Ga0207654_10021395 3300025911 Unclassified 3439
162 Ga0207654_10108994 3300025911 Unclassified 1719
163 Ga0207695_10000567 3300025913 Bacteria 75760
164 Ga0207695_10062908 3300025913 Bacteria 3828
165 Ga0207695_10118517 3300025913 Bacteria 2618
166 Ga0207671_10001166 3300025914 Bacteria 31300
167 Ga0207671_10008588 3300025914 Bacteria 8636
168 Ga0207671_10009264 3300025914 Bacteria 8246
169 Ga0207671_10010161 3300025914 Bacteria 7795
170 Ga0207671_10013322 3300025914 Bacteria 6555
171 Ga0207671_10046076 3300025914 Unclassified 3226
172 Ga0207671_10294208 3300025914 Bacteria 1282
173 Ga0207657_10057833 3300025919 Bacteria 3340
174 Ga0207657_10062736 3300025919 Bacteria 3180
175 Ga0207694_10100425 3300025924 Bacteria 2292
176 Ga0207650_10010140 3300025925 Bacteria 6457
177 Ga0207644_10127823 3300025931 Bacteria 1942
178 Ga0207690_10000988 3300025932 Bacteria 18219
179 Ga0207690_10124791 3300025932 Bacteria 1876
180 Ga0207706_10000044 3300025933 Bacteria 123576
181 Ga0207686_10063111 3300025934 Bacteria 2355
182 Ga0207704_10000011 3300025938 Bacteria 180140
183 Ga0207704_10230381 3300025938 Bacteria 1377
184 Ga0207689_10135836 3300025942 Bacteria 2025
185 Ga0207689_10758795 3300025942 Unclassified 819
186 Ga0207661_10004794 3300025944 Bacteria 9471
187 Ga0207667_10003734 3300025949 Bacteria 18783
188 Ga0207667_10046661 3300025949 Unclassified 4588
189 Ga0207667_10242581 3300025949 Bacteria 1844
190 Ga0207667_10454771 3300025949 Bacteria 1301
191 Ga0207667_11396369 3300025949 Bacteria 674
192 Ga0207668_10540155 3300025972 Bacteria 1008
193 Ga0207658_10003573 3300025986 Bacteria 10976
194 Ga0207677_10065918 3300026023 Bacteria 2529
195 Ga0207677_10252551 3300026023 Unclassified 1433
196 Ga0207639_10277359 3300026041 Bacteria 1473
197 Ga0207639_10616180 3300026041 Unclassified 1002
198 Ga0207702_10385539 3300026078 Bacteria 1348
199 Ga0207702_10466674 3300026078 Bacteria 1227
200 Ga0207641_10023162 3300026088 Bacteria 5117
201 Ga0207641_10083756 3300026088 Bacteria 2774
202 Ga0207641_10109086 3300026088 Unclassified 2451
203 Ga0207641_10658764 3300026088 Bacteria 1029
204 Ga0207648_10000588 3300026089 Bacteria 40775
205 Ga0207648_10016182 3300026089 Bacteria 6825
206 Ga0207648_10095309 3300026089 Bacteria 2603
207 Ga0207648_10372833 3300026089 Bacteria 1289
208 Ga0207674_10053417 3300026116 Bacteria 4118
209 Ga0207674_10274855 3300026116 Unclassified 1632
210 Ga0207698_10284966 3300026142 Bacteria 1530
211 Ga0207698_11032670 3300026142 Bacteria 833
212 Ga0268266_10000010 3300028379 Bacteria 1030233
213 Ga0268264_10000052 3300028381 Bacteria 321218
214 Ga0268264_10012681 3300028381 Bacteria 6938
215 Ga0268264_10021596 3300028381 Bacteria 5256
216 Ga0268264_10086456 3300028381 Bacteria 2694
217 Ga0268264_10239883 3300028381 Bacteria 1679
218 Ga0307517_10005359 3300028786 Bacteria 19372
219 Ga0307515_10000010 3300028794 Bacteria 651586
220 Ga0307515_10001436 3300028794 Bacteria 53821
221 Ga0307515_10002625 3300028794 Bacteria 38659
222 Ga0307515_10014841 3300028794 Bacteria 14401
223 Ga0307515_10016588 3300028794 Bacteria 13477
224 Ga0307515_10229215 3300028794 Bacteria 1655
225 Ga0307515_10248334 3300028794 Bacteria 1537
226 Ga0307515_10303278 3300028794 Bacteria 1280
227 Ga0307511_10009116 3300030521 Bacteria 9892
228 Ga0307513_10269757 3300031456 Bacteria 1486
229 Ga0307513_10556234 3300031456 Bacteria 859
230 Ga0307509_10061940 3300031507 Bacteria 3947
231 Ga0307509_10153579 3300031507 Bacteria 2213
232 Ga0307413_10615034 3300031824 Bacteria 891
233 Ga0307414_10008615 3300032004 Bacteria 5799
234 Ga0307414_10022041 3300032004 Bacteria 4009
235 Ga0307411_10000012 3300032005 Bacteria 161467
236 Ga0373945_0045551 3300035116 Bacteria 1598
237 Ga0373943_0213361 3300035170 Bacteria 1073
238 Ga0373937_0456888 3300036401 Bacteria 1213
239 Ga0373925_0265457 3300037068 Bacteria 1380
240 Ga0395899_0000011 3300037312 Bacteria 521331
241 Ga0439447_004198 3300041407 Bacteria 5001
242 Ga0451787_836015 3300041441 Bacteria 613
243 Ga0451791_0010001 3300041451 Bacteria 1327
244 Ga0451797_1365461 3300041453 Unclassified 951
245 Ga0451798_0718327 3300041458 Bacteria 739
246 Ga0451841_0329245 3300041498 Unclassified 1946
247 Ga0451851_0297233 3300041507 Bacteria 1758
248 Ga0451855_0528312 3300041511 Bacteria 633
249 Ga0495627_040267 3300046453 Bacteria 1439
250 Ga0495651_0192993 3300046462 Bacteria 1432
251 Ga0495606_0003840 3300046507 Bacteria 15525
252 Ga0495606_0164065 3300046507 Bacteria 1294
253 Ga0495610_0087063 3300046512 Bacteria 1422
254 Ga0495618_0267710 3300046514 Bacteria 1069
255 Ga0495632_0046338 3300046519 Bacteria 2161
256 Ga0495652_0360094 3300046529 Bacteria 1040
257 Ga0495652_0391396 3300046529 Bacteria 986
258 Ga0495654_0046337 3300046530 Bacteria 2142
259 Ga0495640_0246513 3300046533 Unclassified 1120
260 Ga0495586_0073150 3300046535 Bacteria 1875
261 Ga0495622_0088445 3300046557 Bacteria 1424
262 Ga0495633_0000263 3300046558 Bacteria 62381
263 Ga0495668_0000054 3300046616 Bacteria 203960
264 Ga0495668_0002622 3300046616 Bacteria 14470
265 Ga0495634_0242560 3300046642 Bacteria 1105
266 Ga0495625_0000663 3300046660 Bacteria 49012
267 Ga0495625_0073848 3300046660 Bacteria 2390
268 Ga0495658_0092359 3300046683 Bacteria 1794
269 Ga0495674_0220700 3300047319 Bacteria 1567
270 Ga0495687_000541 3300047443 Bacteria 45129
271 Ga0495681_0054353 3300047470 Bacteria 1871
272 Ga0495593_0217829 3300047673 Bacteria 958
273 Ga0496124_0141530 3300048927 Bacteria 1897
274 Ga0501297_012840 3300049520 Bacteria 978
275 Ga0501223_001322 3300049663 Bacteria 5735
276 Ga0501238_045557 3300049671 Bacteria 651
277 Ga0501249_000001 3300049679 Bacteria 268580
278 Ga0501257_015285 3300049686 Bacteria 1771
279 Ga0501241_038317 3300049758 Bacteria 923
280 nmdc:mga0k408_122291_c1 3300050493 Bacteria 1542
281 nmdc:mga0k408_126310_c1 3300050493 Bacteria 1517
282 nmdc:mga0k408_31_c1 3300050493 Bacteria 85612
283 nmdc:mga05p37_3826_c1 3300050507 Bacteria 17602
284 Ga0500644_0027000 3300053088 Bacteria 1782
285 Ga0500646_0023982 3300053090 Bacteria 1640
286 Ga0500646_0028226 3300053090 Bacteria 1531
287 Ga0500583_0001003 3300053092 Bacteria 8013
288 Ga0500583_0006792 3300053092 Bacteria 3969
289 Ga0500651_0275878 3300053093 Bacteria 971
290 Ga0500641_0000009 3300053096 Bacteria 173260
291 Ga0500641_0000311 3300053096 Bacteria 17965
292 Ga0500562_020723 3300053108 Bacteria 1707
293 Ga0500562_033238 3300053108 Bacteria 1363
294 Ga0500569_001326 3300053109 Bacteria 4632
295 Ga0500594_0058773 3300053118 Unclassified 1103
296 Ga0500608_000479 3300053122 Bacteria 14975
297 Ga0500608_060979 3300053122 Bacteria 1803
298 Ga0500618_000015 3300053125 Bacteria 175864
299 Ga0500618_009732 3300053125 Bacteria 2613
300 Ga0500564_068238 3300053138 Unclassified 1607
301 Ga0500577_0052205 3300053142 Bacteria 1540
302 Ga0500589_039144 3300053147 Bacteria 2213
303 Ga0500603_054096 3300053150 Bacteria 1107
304 Ga0500604_0003431 3300053151 Unclassified 4269
305 Ga0500604_0005236 3300053151 Bacteria 3428
306 Ga0500616_0006688 3300053153 Bacteria 7486
307 Ga0500622_0000004 3300053156 Bacteria 557587
308 Ga0500624_000332 3300053157 Bacteria 15932
309 Ga0500624_001089 3300053157 Bacteria 5170
310 Ga0500633_0002007 3300053160 Bacteria 4061
311 Ga0500637_0198391 3300053178 Bacteria 1144
312 Ga0075431_100501943
313 JGI24737J22298_10002469
314 JGI24735J21928_10000010
315 JGI24735J21928_10087160
316 JGI24744J21845_10003782
317 JGI25154J39366_1008766
318 rootH1_10001009
319 rootH2_10024913
320 rootH2_10032267
321 rootH2_10153958
322 rootH2_10187385
323 rootL2_10000188
324 rootH1_10008215
325 rootH1_10061802
326 rootH1_10070420
327 rootH1_10088246
328 rootH1_10089992
329 Ga0055542_1006687
330 Ga0055531_10000696
331 Ga0065714_10092887
332 Ga0070658_10354389
333 Ga0070676_10036526
334 Ga0070683_100001053
335 Ga0070670_100027052
336 Ga0068869_101165297
337 Ga0070666_10000146
338 Ga0068868_100092625
339 Ga0068868_100218593
340 Ga0068868_100276343
341 Ga0070660_100049132
342 Ga0070660_100051537
343 Ga0070668_100182543
344 Ga0070671_100036761
345 Ga0070659_100000844
346 Ga0070659_100072355
347 Ga0070667_100003381
348 Ga0070662_100000020
349 Ga0068867_100000495
350 Ga0068867_100016808
351 Ga0068867_100283732
352 Ga0070698_100141399
353 Ga0070684_100000997
354 Ga0068853_100137895
355 Ga0070665_100000006
356 Ga0068855_100000302
357 Ga0068855_100019329
358 Ga0068855_100025220
359 Ga0068855_100188889
360 Ga0068855_100385134
361 Ga0068855_101391354
362 Ga0068857_100020432
363 Ga0068857_100246429
364 Ga0068856_100043338
365 Ga0068856_100098570
366 Ga0068856_100159570
367 Ga0068856_100219698
368 Ga0068856_100432563
369 Ga0068852_100304992
370 Ga0068859_100003931
371 Ga0068859_100014563
372 Ga0068851_10147365
373 Ga0068851_10489276
374 Ga0068863_100017218
375 Ga0068863_100099214
376 Ga0068858_100265054
377 Ga0068858_100633715
378 Ga0068860_100000034
379 Ga0068860_100010052
380 Ga0068860_100010563
381 Ga0068860_100086390
382 Ga0068860_100104383
383 Ga0068860_100449026
384 Ga0075366_10000235
385 Ga0075366_10014742
386 Ga0075366_10245773
387 Ga0097621_100002757
388 Ga0097621_100253292
389 Ga0097621_100463185
390 Ga0068871_100020296
391 Ga0068871_100155729
392 Ga0068871_100252210
393 Ga0075428_101087741
394 Ga0068865_100000874
395 Ga0068865_100020515
396 Ga0097620_100003931
397 Ga0097620_100014564
398 Ga0105240_10000954
399 Ga0105240_10021095
400 Ga0105240_10049178
401 Ga0105240_10510307
402 Ga0105240_11032226
403 Ga0111539_10500411
404 Ga0105245_10613278
405 Ga0114129_10004115
406 Ga0105241_10020110
407 Ga0105241_10077759
408 Ga0105241_10167052
409 Ga0105241_10228664
410 Ga0105241_11105127
411 Ga0105242_10072172
412 Ga0105242_10240064
413 Ga0105237_10000056
414 Ga0105237_10000171
415 Ga0105237_10005233
416 Ga0105237_10023468
417 Ga0105237_10027897
418 Ga0105237_10029846
419 Ga0105237_10120868
420 Ga0105238_10005189
421 Ga0105238_10042541
422 Ga0105238_10226638
423 Ga0105239_10000047
424 Ga0105239_10000064
425 Ga0105239_10000609
426 Ga0105239_10002280
427 Ga0105239_10022305
428 Ga0105239_10070516
429 Ga0105239_10102058
430 Ga0105239_10405366
431 Ga0105246_10425096
432 Ga0157373_10018735
433 Ga0157371_10013314
434 Ga0157369_10055395
435 Ga0157374_10010710
436 Ga0157374_10119626
437 Ga0157374_10503496
438 Ga0157374_10816777
439 Ga0157378_10008248
440 Ga0157378_10037931
441 Ga0157378_10047748
442 Ga0157378_10064300
443 Ga0163162_10001344
444 Ga0163162_10005952
445 Ga0157372_10017858
446 Ga0157372_10242163
447 Ga0157380_10025347
448 Ga0157377_10013291
449 Ga0157376_10018856
450 Ga0157376_10025489
451 Ga0157376_10067671
452 Ga0157376_10569016
453 Ga0163161_10003462
454 Ga0163161_10059542
455 Ga0163161_10382040
456 Ga0209258_100278
457 Ga0209646_1002118
458 Ga0209646_1007324
459 Ga0209026_1002815
460 Ga0209148_1000248
461 Ga0209257_1000005
462 Ga0207656_10318823
463 Ga0207655_1000038
464 Ga0207680_10002328
465 Ga0207647_10000117
466 Ga0207647_10084502
467 Ga0207645_10045356
468 Ga0207705_10289016
469 Ga0207654_10000524
470 Ga0207654_10021395
471 Ga0207654_10108994
472 Ga0207695_10000567
473 Ga0207695_10062908
474 Ga0207695_10118517
475 Ga0207671_10001166
476 Ga0207671_10008588
477 Ga0207671_10009264
478 Ga0207671_10010161
479 Ga0207671_10013322
480 Ga0207671_10046076
481 Ga0207671_10294208
482 Ga0207657_10057833
483 Ga0207657_10062736
484 Ga0207694_10100425
485 Ga0207650_10010140
486 Ga0207644_10127823
487 Ga0207690_10000988
488 Ga0207690_10124791
489 Ga0207706_10000044
490 Ga0207686_10063111
491 Ga0207704_10000011
492 Ga0207704_10230381
493 Ga0207689_10135836
494 Ga0207689_10758795
495 Ga0207661_10004794
496 Ga0207667_10003734
497 Ga0207667_10046661
498 Ga0207667_10242581
499 Ga0207667_10454771
500 Ga0207667_11396369
501 Ga0207668_10540155
502 Ga0207658_10003573
503 Ga0207677_10065918
504 Ga0207677_10252551
505 Ga0207639_10277359
506 Ga0207639_10616180
507 Ga0207702_10385539
508 Ga0207702_10466674
509 Ga0207641_10023162
510 Ga0207641_10083756
511 Ga0207641_10109086
512 Ga0207641_10658764
513 Ga0207648_10000588
514 Ga0207648_10016182
515 Ga0207648_10095309
516 Ga0207648_10372833
517 Ga0207674_10053417
518 Ga0207674_10274855
519 Ga0207698_10284966
520 Ga0207698_11032670
521 Ga0268266_10000010
522 Ga0268264_10000052
523 Ga0268264_10012681
524 Ga0268264_10021596
525 Ga0268264_10086456
526 Ga0268264_10239883
527 Ga0307517_10005359
528 Ga0307515_10000010
529 Ga0307515_10001436
530 Ga0307515_10002625
531 Ga0307515_10014841
532 Ga0307515_10016588
533 Ga0307515_10229215
534 Ga0307515_10248334
535 Ga0307515_10303278
536 Ga0307511_10009116
537 Ga0307513_10269757
538 Ga0307513_10556234
539 Ga0307509_10061940
540 Ga0307509_10153579
541 Ga0307413_10615034
542 Ga0307414_10008615
543 Ga0307414_10022041
544 Ga0307411_10000012
545 Ga0373945_0045551
546 Ga0373943_0213361
547 Ga0373937_0456888
548 Ga0373925_0265457
549 Ga0395899_0000011
550 Ga0439447_004198
551 Ga0451787_836015
552 Ga0451791_0010001
553 Ga0451797_1365461
554 Ga0451798_0718327
555 Ga0451841_0329245
556 Ga0451851_0297233
557 Ga0451855_0528312
558 Ga0495627_040267
559 Ga0495651_0192993
560 Ga0495606_0003840
561 Ga0495606_0164065
562 Ga0495610_0087063
563 Ga0495618_0267710
564 Ga0495632_0046338
565 Ga0495652_0360094
566 Ga0495652_0391396
567 Ga0495654_0046337
568 Ga0495640_0246513
569 Ga0495586_0073150
570 Ga0495622_0088445
571 Ga0495633_0000263
572 Ga0495668_0000054
573 Ga0495668_0002622
574 Ga0495634_0242560
575 Ga0495625_0000663
576 Ga0495625_0073848
577 Ga0495658_0092359
578 Ga0495674_0220700
579 Ga0495687_000541
580 Ga0495681_0054353
581 Ga0495593_0217829
582 Ga0496124_0141530
583 Ga0501297_012840
584 Ga0501223_001322
585 Ga0501238_045557
586 Ga0501249_000001
587 Ga0501257_015285
588 Ga0501241_038317
589 nmdc:mga0k408_122291_c1
590 nmdc:mga0k408_126310_c1
591 nmdc:mga0k408_31_c1
592 nmdc:mga05p37_3826_c1
593 Ga0500644_0027000
594 Ga0500646_0023982
595 Ga0500646_0028226
596 Ga0500583_0001003
597 Ga0500583_0006792
598 Ga0500651_0275878
599 Ga0500641_0000009
600 Ga0500641_0000311
601 Ga0500562_020723
602 Ga0500562_033238
603 Ga0500569_001326
604 Ga0500594_0058773
605 Ga0500608_000479
606 Ga0500608_060979
607 Ga0500618_000015
608 Ga0500618_009732
609 Ga0500564_068238
610 Ga0500577_0052205
611 Ga0500589_039144
612 Ga0500603_054096
613 Ga0500604_0003431
614 Ga0500604_0005236
615 Ga0500616_0006688
616 Ga0500622_0000004
617 Ga0500624_000332
618 Ga0500624_001089
619 Ga0500633_0002007
620 Ga0500637_0198391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

29

117

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.949 1 140
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.9055 1 140
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.8974 20 192
1o3s-assembly1.cif.gz_A-2 protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes 0.8835 20 192
2xko-assembly1.cif.gz_A crystal structure of the complex of ntca with its transcriptional co- activator pipx 0.8736 27 192
ID Description Score Start End Superfamily
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9508 3 140 2.60.120.10
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9064 3 140 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8975 28 147 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8571 28 147 2.60.120.10
af_Q21534_436_544_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8511 21 131 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7K0B6D3-F1-model_v4 deleted 0.9871 3 189
AF-A0A4V6KR65-F1-model_v4 DNA-binding transcriptional activator YeiL 0.9829 2 189 GO:0003677
AF-A0A7G8V940-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9825 1 190
AF-W6TLE1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9818 2 191
AF-A0A0M9DUT3-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9808 1 193

Map