F400108

General Info

Members Datasets Scaffolds Average Seq Length
309 182 309 91

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101432276|Ga0070696_1014322762
Length 95
Sequence MTTAVVLIEAERDALQTLGGRLADLDGVAEAYSVTGEWDFVAIIRVPRHEMLADVVTGELVKLPGVSRTQTMVAFEVFSQHDLEAMFSVGFDNEG

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
115 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
116 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
117 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
131 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 7.44
Rhizosphere 89.32
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000100 3300003373 Bacteria 11811
2 JGI25407J50210_10045285 3300003373 Bacteria 1122
3 Ga0070683_102028967 3300005329 Bacteria 553
4 Ga0068869_100890962 3300005334 Bacteria 769
5 Ga0068869_101267140 3300005334 Bacteria 649
6 Ga0070682_101499387 3300005337 Unclassified 580
7 Ga0068868_100663473 3300005338 Bacteria 930
8 Ga0070660_100391060 3300005339 Bacteria 1149
9 Ga0070691_10446298 3300005341 Bacteria 738
10 Ga0070661_101230629 3300005344 Unclassified 627
11 Ga0070692_10343790 3300005345 Bacteria 925
12 Ga0070668_100451875 3300005347 Bacteria 1105
13 Ga0070671_100962222 3300005355 Bacteria 747
14 Ga0070674_100142239 3300005356 Bacteria 1801
15 Ga0070674_100851549 3300005356 Bacteria 791
16 Ga0070659_100529401 3300005366 Bacteria 1007
17 Ga0070659_100876004 3300005366 Bacteria 784
18 Ga0070667_101234546 3300005367 Bacteria 700
19 Ga0070701_10270947 3300005438 Bacteria 1033
20 Ga0070700_100572401 3300005441 Bacteria 881
21 Ga0070700_101535966 3300005441 Bacteria 567
22 Ga0070681_10993850 3300005458 Bacteria 759
23 Ga0070679_101148246 3300005530 Bacteria 722
24 Ga0070684_100077228 3300005535 Bacteria 2941
25 Ga0070684_100585737 3300005535 Bacteria 1037
26 Ga0068853_102330267 3300005539 Bacteria 519
27 Ga0070672_100525016 3300005543 Bacteria 1026
28 Ga0070686_100328968 3300005544 Bacteria 1142
29 Ga0070686_100637080 3300005544 Bacteria 844
30 Ga0070696_101432276 3300005546 Bacteria 590
31 Ga0070693_100631462 3300005547 Bacteria 777
32 Ga0070665_100588145 3300005548 Bacteria 1126
33 Ga0068855_101339007 3300005563 Bacteria 740
34 Ga0070664_101257029 3300005564 Bacteria 699
35 Ga0070664_101590848 3300005564 Bacteria 619
36 Ga0068857_100480970 3300005577 Bacteria 1164
37 Ga0068854_101323551 3300005578 Bacteria 649
38 Ga0068854_101629168 3300005578 Bacteria 589
39 Ga0070702_100826316 3300005615 Bacteria 719
40 Ga0068852_101031594 3300005616 Bacteria 842
41 Ga0068852_102187479 3300005616 Bacteria 575
42 Ga0068864_100792405 3300005618 Bacteria 931
43 Ga0068866_10117261 3300005718 Bacteria 1495
44 Ga0068861_102117981 3300005719 Bacteria 563
45 Ga0068851_10386685 3300005834 Bacteria 821
46 Ga0068860_101391087 3300005843 Bacteria 723
47 Ga0081455_10088330 3300005937 Bacteria 2519
48 Ga0081455_10225797 3300005937 Bacteria 1385
49 Ga0081455_10290291 3300005937 Bacteria 1178
50 Ga0081538_10000379 3300005981 Bacteria 50693
51 Ga0081538_10002078 3300005981 Bacteria 19943
52 Ga0081538_10006489 3300005981 Bacteria 10292
53 Ga0081538_10013299 3300005981 Bacteria 6525
54 Ga0081540_1031247 3300005983 Bacteria 2932
55 Ga0081539_10040170 3300005985 Bacteria 2750
56 Ga0075365_11211576 3300006038 Bacteria 531
57 Ga0075428_100434416 3300006844 Bacteria 1407
58 Ga0075428_102207170 3300006844 Bacteria 568
59 Ga0075434_101177246 3300006871 Bacteria 779
60 Ga0068865_100674634 3300006881 Bacteria 881
61 Ga0105240_11681378 3300009093 Bacteria 663
62 Ga0111539_10009763 3300009094 Bacteria 12114
63 Ga0111539_10987354 3300009094 Bacteria 979
64 Ga0111539_11890566 3300009094 Bacteria 692
65 Ga0111539_12322422 3300009094 Bacteria 622
66 Ga0105245_10654331 3300009098 Bacteria 1081
67 Ga0105245_10703712 3300009098 Bacteria 1044
68 Ga0105247_11407450 3300009101 Bacteria 565
69 Ga0105243_12723991 3300009148 Bacteria 535
70 Ga0105243_13014045 3300009148 Bacteria 511
71 Ga0105242_11520507 3300009176 Bacteria 701
72 Ga0105248_13021094 3300009177 Bacteria 536
73 Ga0105238_11002309 3300009551 Bacteria 856
74 Ga0105249_10487216 3300009553 Bacteria 1277
75 Ga0105249_10887985 3300009553 Bacteria 958
76 Ga0105249_11198053 3300009553 Bacteria 830
77 Ga0105249_12182935 3300009553 Bacteria 627
78 Ga0105239_12358425 3300010375 Bacteria 619
79 Ga0105239_13149735 3300010375 Bacteria 537
80 Ga0105246_10815072 3300011119 Bacteria 829
81 Ga0105246_11470272 3300011119 Bacteria 639
82 Ga0157374_10250413 3300013296 Bacteria 1743
83 Ga0157374_11652075 3300013296 Bacteria 665
84 Ga0157372_12695165 3300013307 Bacteria 570
85 Ga0157375_10485320 3300013308 Bacteria 1400
86 Ga0157375_11984682 3300013308 Bacteria 691
87 Ga0157375_12602612 3300013308 Bacteria 605
88 Ga0163163_10016911 3300014325 Bacteria 6790
89 Ga0163163_10121669 3300014325 Bacteria 2644
90 Ga0163163_11155111 3300014325 Bacteria 837
91 Ga0157380_10132987 3300014326 Bacteria 2125
92 Ga0157380_10761584 3300014326 Bacteria 981
93 Ga0157377_10141119 3300014745 Bacteria 1481
94 Ga0157379_10240144 3300014968 Bacteria 1643
95 Ga0157379_11827370 3300014968 Bacteria 597
96 Ga0163161_10617592 3300017792 Bacteria 895
97 Ga0163161_11160568 3300017792 Bacteria 666
98 Ga0207656_10595819 3300025321 Bacteria 564
99 Ga0207642_10190627 3300025899 Bacteria 1125
100 Ga0207642_10380448 3300025899 Bacteria 840
101 Ga0207688_10382260 3300025901 Bacteria 871
102 Ga0207688_10388606 3300025901 Bacteria 864
103 Ga0207688_10599700 3300025901 Bacteria 694
104 Ga0207643_10795288 3300025908 Bacteria 613
105 Ga0207705_11323972 3300025909 Bacteria 549
106 Ga0207660_10276108 3300025917 Bacteria 1332
107 Ga0207660_10717861 3300025917 Bacteria 815
108 Ga0207649_10519460 3300025920 Bacteria 908
109 Ga0207694_10829459 3300025924 Bacteria 781
110 Ga0207694_11859619 3300025924 Bacteria 505
111 Ga0207687_10535217 3300025927 Bacteria 981
112 Ga0207687_11382564 3300025927 Bacteria 605
113 Ga0207644_11292744 3300025931 Bacteria 613
114 Ga0207690_10223313 3300025932 Bacteria 1442
115 Ga0207690_10481528 3300025932 Bacteria 1002
116 Ga0207706_10540356 3300025933 Bacteria 1004
117 Ga0207686_11341700 3300025934 Bacteria 588
118 Ga0207670_10681507 3300025936 Bacteria 850
119 Ga0207669_10075225 3300025937 Bacteria 2139
120 Ga0207669_10853261 3300025937 Bacteria 758
121 Ga0207704_10428229 3300025938 Bacteria 1051
122 Ga0207704_11977958 3300025938 Bacteria 502
123 Ga0207665_10719267 3300025939 Bacteria 786
124 Ga0207711_11660072 3300025941 Bacteria 582
125 Ga0207689_10254696 3300025942 Bacteria 1452
126 Ga0207712_10129428 3300025961 Bacteria 1921
127 Ga0207712_11299741 3300025961 Bacteria 650
128 Ga0207668_11893680 3300025972 Bacteria 538
129 Ga0207640_10645186 3300025981 Bacteria 901
130 Ga0207640_10698118 3300025981 Bacteria 870
131 Ga0207658_11431838 3300025986 Bacteria 632
132 Ga0207703_10584719 3300026035 Bacteria 1055
133 Ga0207703_11132774 3300026035 Unclassified 752
134 Ga0207703_11863104 3300026035 Bacteria 578
135 Ga0207639_11037504 3300026041 Bacteria 768
136 Ga0207708_10221280 3300026075 Bacteria 1517
137 Ga0207674_10467680 3300026116 Bacteria 1219
138 Ga0207675_100083347 3300026118 Bacteria 2999
139 Ga0207675_100344558 3300026118 Bacteria 1459
140 Ga0207675_100509271 3300026118 Bacteria 1199
141 Ga0207675_100592174 3300026118 Bacteria 1111
142 Ga0207683_10296144 3300026121 Bacteria 1480
143 Ga0207683_10440813 3300026121 Bacteria 1200
144 Ga0207683_10697392 3300026121 Bacteria 941
145 Ga0207698_10615744 3300026142 Bacteria 1072
146 Ga0207698_11172783 3300026142 Bacteria 782
147 Ga0207698_12330378 3300026142 Bacteria 547
148 Ga0207428_10460366 3300027907 Bacteria 927
149 Ga0268264_11501630 3300028381 Bacteria 684
150 Ga0307408_101283962 3300031548 Bacteria 686
151 Ga0307405_10162240 3300031731 Bacteria 1585
152 Ga0307405_11008025 3300031731 Bacteria 711
153 Ga0307413_10100096 3300031824 Bacteria 1913
154 Ga0307413_11287278 3300031824 Bacteria 639
155 Ga0307413_12149606 3300031824 Bacteria 505
156 Ga0307410_10819576 3300031852 Bacteria 793
157 Ga0307410_10895576 3300031852 Bacteria 760
158 Ga0307410_11163917 3300031852 Bacteria 671
159 Ga0307410_11414945 3300031852 Unclassified 611
160 Ga0307406_10055749 3300031901 Bacteria 2528
161 Ga0307406_10163125 3300031901 Bacteria 1605
162 Ga0307406_10180294 3300031901 Bacteria 1537
163 Ga0307406_10528949 3300031901 Bacteria 961
164 Ga0307406_11695216 3300031901 Bacteria 560
165 Ga0307406_11930266 3300031901 Bacteria 527
166 Ga0307407_10182992 3300031903 Bacteria 1390
167 Ga0307409_100194826 3300031995 Bacteria 1807
168 Ga0307409_100230956 3300031995 Bacteria 1677
169 Ga0307409_100420503 3300031995 Bacteria 1282
170 Ga0307409_100700473 3300031995 Bacteria 1012
171 Ga0307416_100175816 3300032002 Bacteria 2000
172 Ga0307416_100430333 3300032002 Bacteria 1367
173 Ga0307414_10167518 3300032004 Bacteria 1753
174 Ga0307415_100556124 3300032126 Bacteria 1013
175 Ga0307415_100973686 3300032126 Bacteria 787
176 Ga0307415_101744974 3300032126 Bacteria 601
177 Ga0395899_0423206 3300037312 Bacteria 877
178 Ga0395900_0185304 3300037418 Bacteria 2113
179 Ga0395900_0883817 3300037418 Bacteria 818
180 Ga0395900_1135550 3300037418 Bacteria 698
181 Ga0395900_1321206 3300037418 Bacteria 635
182 Ga0395898_0043483 3300037466 Bacteria 4426
183 Ga0395898_0471049 3300037466 Bacteria 1195
184 Ga0395898_1282012 3300037466 Bacteria 662
185 Ga0395898_1713773 3300037466 Bacteria 551
186 Ga0395898_1811550 3300037466 Bacteria 531
187 Ga0395905_0187046 3300037471 Bacteria 1944
188 Ga0395905_1793869 3300037471 Bacteria 519
189 Ga0395901_0058102 3300038443 Bacteria 4023
190 Ga0395901_0094297 3300038443 Bacteria 3135
191 Ga0395901_0209213 3300038443 Bacteria 2042
192 Ga0395901_0255066 3300038443 Bacteria 1827
193 Ga0395901_0483154 3300038443 Bacteria 1263
194 Ga0395901_0652238 3300038443 Bacteria 1056
195 Ga0395901_0657971 3300038443 Bacteria 1050
196 Ga0395901_1123590 3300038443 Bacteria 755
197 Ga0395901_1160923 3300038443 Bacteria 740
198 Ga0395901_1591839 3300038443 Bacteria 607
199 Ga0395901_1778106 3300038443 Bacteria 566
200 Ga0436365_0183512 3300039437 Bacteria 640
201 Ga0436362_0188162 3300039453 Unclassified 908
202 Ga0451791_0342824 3300041451 Bacteria 962
203 Ga0451802_0959986 3300041460 Bacteria 996
204 Ga0451835_0794111 3300041492 Bacteria 3275
205 Ga0451835_1123110 3300041492 Bacteria 622
206 Ga0451839_0116399 3300041496 Bacteria 1004
207 Ga0451849_1511486 3300041505 Bacteria 588
208 Ga0451853_0538563 3300041512 Bacteria 664
209 Ga0466972_0107321 3300044658 Bacteria 1320
210 Ga0466965_0463206 3300044683 Unclassified 707
211 Ga0466965_0578882 3300044683 Bacteria 636
212 Ga0466963_0310135 3300044694 Bacteria 1110
213 Ga0466963_0617808 3300044694 Bacteria 765
214 Ga0466971_0026762 3300044719 Bacteria 2580
215 Ga0466971_0135515 3300044719 Bacteria 1145
216 Ga0466971_0472308 3300044719 Bacteria 617
217 Ga0466968_0575328 3300044735 Unclassified 567
218 Ga0466968_0738070 3300044735 Bacteria 505
219 Ga0466970_0465590 3300044765 Bacteria 726
220 Ga0466957_0107346 3300044842 Bacteria 1767
221 Ga0466960_0000167 3300044901 Bacteria 22359
222 Ga0466960_0107978 3300044901 Bacteria 1442
223 Ga0466960_0290135 3300044901 Bacteria 919
224 Ga0466960_0520308 3300044901 Bacteria 699
225 Ga0466960_0520373 3300044901 Bacteria 699
226 Ga0466960_0643685 3300044901 Unclassified 632
227 Ga0466958_0025784 3300045836 Bacteria 3469
228 Ga0466967_0037321 3300045976 Bacteria 4157
229 Ga0466967_0089375 3300045976 Bacteria 2797
230 Ga0466967_0175319 3300045976 Bacteria 2020
231 Ga0466967_0251624 3300045976 Bacteria 1688
232 Ga0466967_0858629 3300045976 Bacteria 902
233 Ga0466967_1266891 3300045976 Bacteria 734
234 Ga0466967_1729405 3300045976 Unclassified 623
235 Ga0495650_0000012 3300046471 Bacteria 613144
236 Ga0495584_0322963 3300046491 Bacteria 784
237 Ga0495608_0814102 3300046511 Bacteria 551
238 Ga0495663_0220403 3300046525 Bacteria 667
239 Ga0495652_0502348 3300046529 Unclassified 841
240 Ga0495667_0706971 3300046559 Bacteria 624
241 Ga0495656_0554605 3300046615 Bacteria 613
242 Ga0495668_0792957 3300046616 Bacteria 525
243 Ga0496100_0366725 3300048903 Bacteria 1091
244 Ga0496100_1505209 3300048903 Bacteria 532
245 Ga0496101_0054990 3300048904 Bacteria 2874
246 Ga0496101_0143362 3300048904 Bacteria 1823
247 Ga0496102_0502534 3300048905 Bacteria 1135
248 Ga0496103_0321764 3300048906 Bacteria 995
249 Ga0496104_0066787 3300048907 Bacteria 3415
250 Ga0496104_0847921 3300048907 Bacteria 819
251 Ga0496105_0064819 3300048908 Bacteria 3015
252 Ga0496105_0237127 3300048908 Bacteria 1481
253 Ga0496106_0297224 3300048909 Bacteria 1295
254 Ga0496107_0336840 3300048910 Bacteria 1122
255 Ga0496107_0644770 3300048910 Bacteria 781
256 Ga0496109_0467295 3300048912 Bacteria 1191
257 Ga0496109_0920989 3300048912 Bacteria 812
258 Ga0496109_1999342 3300048912 Bacteria 512
259 Ga0496112_0006227 3300048915 Bacteria 10452
260 Ga0496112_0007246 3300048915 Bacteria 9829
261 Ga0496112_0293510 3300048915 Bacteria 1572
262 Ga0496113_0126385 3300048916 Bacteria 2003
263 Ga0496115_1366837 3300048918 Bacteria 524
264 Ga0496121_0022346 3300048924 Bacteria 6144
265 Ga0496124_0548919 3300048927 Bacteria 763
266 Ga0501031_0129685 3300049568 Bacteria 1647
267 Ga0501034_0065492 3300049571 Bacteria 3646
268 Ga0501036_0164485 3300049572 Bacteria 1870
269 Ga0501036_0846436 3300049572 Bacteria 752
270 Ga0501038_0294307 3300049574 Bacteria 1275
271 Ga0501039_0370305 3300049575 Bacteria 1125
272 Ga0501040_0051375 3300049576 Bacteria 2820
273 Ga0501041_0263076 3300049577 Bacteria 1085
274 Ga0501042_0068897 3300049578 Bacteria 2530
275 Ga0501042_0200285 3300049578 Bacteria 1440
276 Ga0501042_0687391 3300049578 Bacteria 744
277 Ga0501043_1298474 3300049579 Archaea 508
278 Ga0501046_0378913 3300049580 Bacteria 1024
279 Ga0501048_0238163 3300049582 Bacteria 1291
280 Ga0501048_0707820 3300049582 Bacteria 723
281 Ga0501070_1159668 3300049586 Bacteria 594
282 Ga0501070_1164071 3300049586 Bacteria 593
283 Ga0501071_0187779 3300049587 Bacteria 1549
284 Ga0501072_0036478 3300049588 Bacteria 3854
285 Ga0501072_0320363 3300049588 Bacteria 1232
286 Ga0501072_0543518 3300049588 Bacteria 918
287 Ga0501074_0057793 3300049590 Bacteria 2795
288 Ga0501077_0285603 3300049593 Bacteria 1050
289 Ga0501245_142765 3300049708 Bacteria 523
290 Ga0501079_0054139 3300049741 Bacteria 3095
291 Ga0501080_1444011 3300049742 Unclassified 586
292 Ga0501080_1853341 3300049742 Unclassified 506
293 Ga0501081_0577842 3300049743 Unclassified 840
294 Ga0501035_0526597 3300049822 Bacteria 970
295 Ga0501045_0244238 3300049824 Bacteria 1336
296 nmdc:mga0qj67_1504110_c1 3300050509 Bacteria 518
297 nmdc:mga06r32_288621_c1 3300050510 Bacteria 1627
298 nmdc:mga08y16_1369307_c1 3300050511 Bacteria 672
299 nmdc:mga08y16_27826_c1 3300050511 Bacteria 5958
300 nmdc:mga0n895_327803_c1 3300050512 Bacteria 1551
301 nmdc:mga0n895_973018_c1 3300050512 Bacteria 831
302 Ga0500616_0007342 3300053153 Bacteria 7024
303 Ga0501084_0590609 3300054114 Bacteria 938
304 Ga0587067_189621 3300059640 Bacteria 540
305 Ga0501082_0459576 3300060353 Bacteria 1112
306 Ga0466962_0032874 3300061719 Bacteria 2482
307 Ga0466962_0143923 3300061719 Bacteria 1155
308 Ga0466962_0548992 3300061719 Unclassified 587
309 Ga0530510_0113908 3300061734 Bacteria 1982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0322963 Ga0495584_0322963_397_672 78
2 3300046525 Ga0495663_0220403 Ga0495663_0220403_136_411 78
3 3300046615 Ga0495656_0554605 Ga0495656_0554605_274_549 78
4 3300048927 Ga0496124_0548919 Ga0496124_0548919_322_597 78
5 3300041505 Ga0451849_1511486 Ga0451849_1511486_206_571 86
6 3300003373 JGI25407J50210_10000100 JGI25407J50210_1000010014 91
7 3300003373 JGI25407J50210_10045285 JGI25407J50210_100452852 91
8 3300005329 Ga0070683_102028967 Ga0070683_1020289672 91
9 3300005334 Ga0068869_100890962 Ga0068869_1008909621 91
10 3300005334 Ga0068869_101267140 Ga0068869_1012671402 91
11 3300005337 Ga0070682_101499387 Ga0070682_1014993872 91
12 3300005338 Ga0068868_100663473 Ga0068868_1006634732 91
13 3300005339 Ga0070660_100391060 Ga0070660_1003910602 91
14 3300005341 Ga0070691_10446298 Ga0070691_104462982 91
15 3300005344 Ga0070661_101230629 Ga0070661_1012306292 91
16 3300005345 Ga0070692_10343790 Ga0070692_103437902 91
17 3300005347 Ga0070668_100451875 Ga0070668_1004518752 91
18 3300005355 Ga0070671_100962222 Ga0070671_1009622221 91
19 3300005356 Ga0070674_100142239 Ga0070674_1001422394 91
20 3300005356 Ga0070674_100851549 Ga0070674_1008515492 91
21 3300005366 Ga0070659_100529401 Ga0070659_1005294011 91
22 3300005366 Ga0070659_100876004 Ga0070659_1008760042 91
23 3300005367 Ga0070667_101234546 Ga0070667_1012345462 91
24 3300005438 Ga0070701_10270947 Ga0070701_102709472 91
25 3300005441 Ga0070700_100572401 Ga0070700_1005724013 91
26 3300005441 Ga0070700_101535966 Ga0070700_1015359661 91
27 3300005458 Ga0070681_10993850 Ga0070681_109938502 91
28 3300005530 Ga0070679_101148246 Ga0070679_1011482461 91
29 3300005535 Ga0070684_100077228 Ga0070684_1000772281 91
30 3300005535 Ga0070684_100585737 Ga0070684_1005857372 91
31 3300005539 Ga0068853_102330267 Ga0068853_1023302671 91
32 3300005543 Ga0070672_100525016 Ga0070672_1005250163 91
33 3300005544 Ga0070686_100328968 Ga0070686_1003289681 91
34 3300005544 Ga0070686_100637080 Ga0070686_1006370802 91
35 3300005546 Ga0070696_101432276 Ga0070696_1014322762 91
36 3300005547 Ga0070693_100631462 Ga0070693_1006314622 91
37 3300005548 Ga0070665_100588145 Ga0070665_1005881452 91
38 3300005563 Ga0068855_101339007 Ga0068855_1013390072 91
39 3300005564 Ga0070664_101257029 Ga0070664_1012570291 91
40 3300005564 Ga0070664_101590848 Ga0070664_1015908482 91
41 3300005577 Ga0068857_100480970 Ga0068857_1004809703 91
42 3300005578 Ga0068854_101323551 Ga0068854_1013235512 91
43 3300005578 Ga0068854_101629168 Ga0068854_1016291681 91
44 3300005615 Ga0070702_100826316 Ga0070702_1008263161 91
45 3300005616 Ga0068852_101031594 Ga0068852_1010315942 91
46 3300005616 Ga0068852_102187479 Ga0068852_1021874792 91
47 3300005618 Ga0068864_100792405 Ga0068864_1007924053 91
48 3300005718 Ga0068866_10117261 Ga0068866_101172613 91
49 3300005719 Ga0068861_102117981 Ga0068861_1021179812 91
50 3300005834 Ga0068851_10386685 Ga0068851_103866852 91
51 3300005843 Ga0068860_101391087 Ga0068860_1013910872 91
52 3300005937 Ga0081455_10088330 Ga0081455_100883302 91
53 3300005937 Ga0081455_10225797 Ga0081455_102257973 91
54 3300005937 Ga0081455_10290291 Ga0081455_102902913 91
55 3300005981 Ga0081538_10000379 Ga0081538_1000037918 91
56 3300005981 Ga0081538_10002078 Ga0081538_1000207816 91
57 3300005981 Ga0081538_10006489 Ga0081538_1000648910 91
58 3300005981 Ga0081538_10013299 Ga0081538_100132996 91
59 3300005983 Ga0081540_1031247 Ga0081540_10312476 91
60 3300005985 Ga0081539_10040170 Ga0081539_100401702 91
61 3300006038 Ga0075365_11211576 Ga0075365_112115762 91
62 3300006844 Ga0075428_100434416 Ga0075428_1004344162 91
63 3300006844 Ga0075428_102207170 Ga0075428_1022071701 91
64 3300006871 Ga0075434_101177246 Ga0075434_1011772462 91
65 3300006881 Ga0068865_100674634 Ga0068865_1006746342 91
66 3300009093 Ga0105240_11681378 Ga0105240_116813782 91
67 3300009094 Ga0111539_10009763 Ga0111539_1000976312 91
68 3300009094 Ga0111539_10987354 Ga0111539_109873542 91
69 3300009094 Ga0111539_11890566 Ga0111539_118905661 91
70 3300009094 Ga0111539_12322422 Ga0111539_123224222 91
71 3300009098 Ga0105245_10654331 Ga0105245_106543312 91
72 3300009098 Ga0105245_10703712 Ga0105245_107037122 91
73 3300009101 Ga0105247_11407450 Ga0105247_114074502 91
74 3300009148 Ga0105243_12723991 Ga0105243_127239911 91
75 3300009148 Ga0105243_13014045 Ga0105243_130140452 91
76 3300009176 Ga0105242_11520507 Ga0105242_115205072 91
77 3300009177 Ga0105248_13021094 Ga0105248_130210942 91
78 3300009551 Ga0105238_11002309 Ga0105238_110023092 91
79 3300009553 Ga0105249_10487216 Ga0105249_104872162 91
80 3300009553 Ga0105249_10887985 Ga0105249_108879852 91
81 3300009553 Ga0105249_11198053 Ga0105249_111980532 91
82 3300009553 Ga0105249_12182935 Ga0105249_121829352 91
83 3300010375 Ga0105239_12358425 Ga0105239_123584252 91
84 3300010375 Ga0105239_13149735 Ga0105239_131497352 91
85 3300011119 Ga0105246_10815072 Ga0105246_108150722 91
86 3300011119 Ga0105246_11470272 Ga0105246_114702722 91
87 3300013296 Ga0157374_10250413 Ga0157374_102504132 91
88 3300013296 Ga0157374_11652075 Ga0157374_116520752 91
89 3300013307 Ga0157372_12695165 Ga0157372_126951651 91
90 3300013308 Ga0157375_10485320 Ga0157375_104853203 91
91 3300013308 Ga0157375_11984682 Ga0157375_119846821 91
92 3300013308 Ga0157375_12602612 Ga0157375_126026121 91
93 3300014325 Ga0163163_10016911 Ga0163163_100169112 91
94 3300014325 Ga0163163_10121669 Ga0163163_101216694 91
95 3300014325 Ga0163163_11155111 Ga0163163_111551112 91
96 3300014326 Ga0157380_10132987 Ga0157380_101329873 91
97 3300014326 Ga0157380_10761584 Ga0157380_107615842 91
98 3300014745 Ga0157377_10141119 Ga0157377_101411194 91
99 3300014968 Ga0157379_10240144 Ga0157379_102401442 91
100 3300014968 Ga0157379_11827370 Ga0157379_118273702 91
101 3300017792 Ga0163161_10617592 Ga0163161_106175923 91
102 3300017792 Ga0163161_11160568 Ga0163161_111605682 91
103 3300025321 Ga0207656_10595819 Ga0207656_105958191 91
104 3300025899 Ga0207642_10190627 Ga0207642_101906272 91
105 3300025899 Ga0207642_10380448 Ga0207642_103804482 91
106 3300025901 Ga0207688_10382260 Ga0207688_103822602 91
107 3300025901 Ga0207688_10388606 Ga0207688_103886062 91
108 3300025901 Ga0207688_10599700 Ga0207688_105997002 91
109 3300025908 Ga0207643_10795288 Ga0207643_107952882 91
110 3300025909 Ga0207705_11323972 Ga0207705_113239722 91
111 3300025917 Ga0207660_10276108 Ga0207660_102761082 91
112 3300025917 Ga0207660_10717861 Ga0207660_107178612 91
113 3300025920 Ga0207649_10519460 Ga0207649_105194602 91
114 3300025924 Ga0207694_10829459 Ga0207694_108294592 91
115 3300025924 Ga0207694_11859619 Ga0207694_118596192 91
116 3300025927 Ga0207687_10535217 Ga0207687_105352172 91
117 3300025927 Ga0207687_11382564 Ga0207687_113825642 91
118 3300025931 Ga0207644_11292744 Ga0207644_112927442 91
119 3300025932 Ga0207690_10223313 Ga0207690_102233132 91
120 3300025932 Ga0207690_10481528 Ga0207690_104815283 91
121 3300025933 Ga0207706_10540356 Ga0207706_105403563 91
122 3300025934 Ga0207686_11341700 Ga0207686_113417002 91
123 3300025936 Ga0207670_10681507 Ga0207670_106815072 91
124 3300025937 Ga0207669_10075225 Ga0207669_100752254 91
125 3300025937 Ga0207669_10853261 Ga0207669_108532612 91
126 3300025938 Ga0207704_10428229 Ga0207704_104282292 91
127 3300025938 Ga0207704_11977958 Ga0207704_119779581 91
128 3300025939 Ga0207665_10719267 Ga0207665_107192672 91
129 3300025941 Ga0207711_11660072 Ga0207711_116600722 91
130 3300025942 Ga0207689_10254696 Ga0207689_102546963 91
131 3300025961 Ga0207712_10129428 Ga0207712_101294283 91
132 3300025961 Ga0207712_11299741 Ga0207712_112997412 91
133 3300025972 Ga0207668_11893680 Ga0207668_118936802 91
134 3300025981 Ga0207640_10645186 Ga0207640_106451863 91
135 3300025981 Ga0207640_10698118 Ga0207640_106981182 91
136 3300025986 Ga0207658_11431838 Ga0207658_114318382 91
137 3300026035 Ga0207703_10584719 Ga0207703_105847192 91
138 3300026035 Ga0207703_11132774 Ga0207703_111327742 91
139 3300026035 Ga0207703_11863104 Ga0207703_118631042 91
140 3300026041 Ga0207639_11037504 Ga0207639_110375042 91
141 3300026075 Ga0207708_10221280 Ga0207708_102212802 91
142 3300026116 Ga0207674_10467680 Ga0207674_104676803 91
143 3300026118 Ga0207675_100083347 Ga0207675_1000833474 91
144 3300026118 Ga0207675_100344558 Ga0207675_1003445581 91
145 3300026118 Ga0207675_100509271 Ga0207675_1005092713 91
146 3300026118 Ga0207675_100592174 Ga0207675_1005921742 91
147 3300026121 Ga0207683_10296144 Ga0207683_102961443 91
148 3300026121 Ga0207683_10440813 Ga0207683_104408132 91
149 3300026121 Ga0207683_10697392 Ga0207683_106973921 91
150 3300026142 Ga0207698_10615744 Ga0207698_106157442 91
151 3300026142 Ga0207698_11172783 Ga0207698_111727831 91
152 3300026142 Ga0207698_12330378 Ga0207698_123303782 91
153 3300027907 Ga0207428_10460366 Ga0207428_104603661 91
154 3300028381 Ga0268264_11501630 Ga0268264_115016302 91
155 3300031548 Ga0307408_101283962 Ga0307408_1012839622 91
156 3300031731 Ga0307405_10162240 Ga0307405_101622404 91
157 3300031731 Ga0307405_11008025 Ga0307405_110080253 91
158 3300031824 Ga0307413_10100096 Ga0307413_101000962 91
159 3300031824 Ga0307413_11287278 Ga0307413_112872782 91
160 3300031824 Ga0307413_12149606 Ga0307413_121496062 91
161 3300031852 Ga0307410_10819576 Ga0307410_108195762 91
162 3300031852 Ga0307410_10895576 Ga0307410_108955762 91
163 3300031852 Ga0307410_11163917 Ga0307410_111639172 91
164 3300031852 Ga0307410_11414945 Ga0307410_114149452 91
165 3300031901 Ga0307406_10055749 Ga0307406_100557494 91
166 3300031901 Ga0307406_10163125 Ga0307406_101631252 91
167 3300031901 Ga0307406_10180294 Ga0307406_101802943 91
168 3300031901 Ga0307406_10528949 Ga0307406_105289492 91
169 3300031901 Ga0307406_11695216 Ga0307406_116952162 91
170 3300031901 Ga0307406_11930266 Ga0307406_119302661 91
171 3300031903 Ga0307407_10182992 Ga0307407_101829922 91
172 3300031995 Ga0307409_100194826 Ga0307409_1001948261 91
173 3300031995 Ga0307409_100230956 Ga0307409_1002309562 91
174 3300031995 Ga0307409_100420503 Ga0307409_1004205033 91
175 3300031995 Ga0307409_100700473 Ga0307409_1007004732 91
176 3300032002 Ga0307416_100175816 Ga0307416_1001758162 91
177 3300032002 Ga0307416_100430333 Ga0307416_1004303332 91
178 3300032004 Ga0307414_10167518 Ga0307414_101675182 91
179 3300032126 Ga0307415_100556124 Ga0307415_1005561243 91
180 3300032126 Ga0307415_100973686 Ga0307415_1009736861 91
181 3300032126 Ga0307415_101744974 Ga0307415_1017449742 91
182 3300037312 Ga0395899_0423206 Ga0395899_0423206_366_641 91
183 3300037418 Ga0395900_0185304 Ga0395900_0185304_832_1107 91
184 3300037418 Ga0395900_0883817 Ga0395900_0883817_87_362 91
185 3300037418 Ga0395900_1135550 Ga0395900_1135550_181_456 91
186 3300037418 Ga0395900_1321206 Ga0395900_1321206_337_612 91
187 3300037466 Ga0395898_0043483 Ga0395898_0043483_1197_1472 91
188 3300037466 Ga0395898_0471049 Ga0395898_0471049_893_1168 91
189 3300037466 Ga0395898_1282012 Ga0395898_1282012_363_638 91
190 3300037466 Ga0395898_1713773 Ga0395898_1713773_222_497 91
191 3300037466 Ga0395898_1811550 Ga0395898_1811550_231_506 91
192 3300037471 Ga0395905_0187046 Ga0395905_0187046_318_593 91
193 3300037471 Ga0395905_1793869 Ga0395905_1793869_198_473 91
194 3300038443 Ga0395901_0058102 Ga0395901_0058102_2937_3212 91
195 3300038443 Ga0395901_0094297 Ga0395901_0094297_2011_2286 91
196 3300038443 Ga0395901_0209213 Ga0395901_0209213_606_881 91
197 3300038443 Ga0395901_0255066 Ga0395901_0255066_1101_1376 91
198 3300038443 Ga0395901_0483154 Ga0395901_0483154_504_779 91
199 3300038443 Ga0395901_0652238 Ga0395901_0652238_37_312 91
200 3300038443 Ga0395901_0657971 Ga0395901_0657971_17_295 91
201 3300038443 Ga0395901_1123590 Ga0395901_1123590_173_448 91
202 3300038443 Ga0395901_1160923 Ga0395901_1160923_440_721 91
203 3300038443 Ga0395901_1591839 Ga0395901_1591839_144_419 91
204 3300038443 Ga0395901_1778106 Ga0395901_1778106_252_527 91
205 3300039437 Ga0436365_0183512 Ga0436365_0183512_81_356 91
206 3300039453 Ga0436362_0188162 Ga0436362_0188162_606_881 91
207 3300041451 Ga0451791_0342824 Ga0451791_0342824_149_424 91
208 3300041460 Ga0451802_0959986 Ga0451802_0959986_450_725 91
209 3300041492 Ga0451835_0794111 Ga0451835_0794111_211_486 91
210 3300041492 Ga0451835_1123110 Ga0451835_1123110_66_341 91
211 3300041496 Ga0451839_0116399 Ga0451839_0116399_252_527 91
212 3300041512 Ga0451853_0538563 Ga0451853_0538563_75_350 91
213 3300044658 Ga0466972_0107321 Ga0466972_0107321_339_614 91
214 3300044683 Ga0466965_0463206 Ga0466965_0463206_99_374 91
215 3300044683 Ga0466965_0578882 Ga0466965_0578882_31_306 91
216 3300044694 Ga0466963_0310135 Ga0466963_0310135_209_484 91
217 3300044694 Ga0466963_0617808 Ga0466963_0617808_290_565 91
218 3300044719 Ga0466971_0026762 Ga0466971_0026762_1620_1895 91
219 3300044719 Ga0466971_0135515 Ga0466971_0135515_127_402 91
220 3300044719 Ga0466971_0472308 Ga0466971_0472308_221_496 91
221 3300044735 Ga0466968_0575328 Ga0466968_0575328_216_491 91
222 3300044735 Ga0466968_0738070 Ga0466968_0738070_173_448 91
223 3300044765 Ga0466970_0465590 Ga0466970_0465590_379_654 91
224 3300044842 Ga0466957_0107346 Ga0466957_0107346_869_1144 91
225 3300044901 Ga0466960_0000167 Ga0466960_0000167_16071_16346 91
226 3300044901 Ga0466960_0107978 Ga0466960_0107978_455_730 91
227 3300044901 Ga0466960_0290135 Ga0466960_0290135_234_509 91
228 3300044901 Ga0466960_0520308 Ga0466960_0520308_16_291 91
229 3300044901 Ga0466960_0520373 Ga0466960_0520373_161_436 91
230 3300044901 Ga0466960_0643685 Ga0466960_0643685_292_567 91
231 3300045836 Ga0466958_0025784 Ga0466958_0025784_2385_2660 91
232 3300045976 Ga0466967_0037321 Ga0466967_0037321_3713_3988 91
233 3300045976 Ga0466967_0089375 Ga0466967_0089375_884_1159 91
234 3300045976 Ga0466967_0175319 Ga0466967_0175319_1047_1322 91
235 3300045976 Ga0466967_0251624 Ga0466967_0251624_892_1167 91
236 3300045976 Ga0466967_0858629 Ga0466967_0858629_210_485 91
237 3300045976 Ga0466967_1266891 Ga0466967_1266891_192_467 91
238 3300045976 Ga0466967_1729405 Ga0466967_1729405_242_517 91
239 3300046471 Ga0495650_0000012 Ga0495650_0000012_136687_136962 91
240 3300046511 Ga0495608_0814102 Ga0495608_0814102_242_517 91
241 3300046529 Ga0495652_0502348 Ga0495652_0502348_41_316 91
242 3300046559 Ga0495667_0706971 Ga0495667_0706971_116_391 91
243 3300046616 Ga0495668_0792957 Ga0495668_0792957_149_424 91
244 3300048903 Ga0496100_0366725 Ga0496100_0366725_136_411 91
245 3300048903 Ga0496100_1505209 Ga0496100_1505209_60_335 91
246 3300048904 Ga0496101_0054990 Ga0496101_0054990_1888_2163 91
247 3300048904 Ga0496101_0143362 Ga0496101_0143362_74_349 91
248 3300048905 Ga0496102_0502534 Ga0496102_0502534_220_495 91
249 3300048906 Ga0496103_0321764 Ga0496103_0321764_190_465 91
250 3300048907 Ga0496104_0066787 Ga0496104_0066787_71_346 91
251 3300048907 Ga0496104_0847921 Ga0496104_0847921_152_427 91
252 3300048908 Ga0496105_0064819 Ga0496105_0064819_2592_2867 91
253 3300048908 Ga0496105_0237127 Ga0496105_0237127_568_843 91
254 3300048909 Ga0496106_0297224 Ga0496106_0297224_829_1104 91
255 3300048910 Ga0496107_0336840 Ga0496107_0336840_100_375 91
256 3300048910 Ga0496107_0644770 Ga0496107_0644770_431_706 91
257 3300048912 Ga0496109_0467295 Ga0496109_0467295_546_821 91
258 3300048912 Ga0496109_0920989 Ga0496109_0920989_408_683 91
259 3300048912 Ga0496109_1999342 Ga0496109_1999342_135_410 91
260 3300048915 Ga0496112_0006227 Ga0496112_0006227_5131_5406 91
261 3300048915 Ga0496112_0007246 Ga0496112_0007246_6505_6780 91
262 3300048915 Ga0496112_0293510 Ga0496112_0293510_934_1209 91
263 3300048916 Ga0496113_0126385 Ga0496113_0126385_1142_1417 91
264 3300048918 Ga0496115_1366837 Ga0496115_1366837_49_324 91
265 3300048924 Ga0496121_0022346 Ga0496121_0022346_3997_4272 91
266 3300049568 Ga0501031_0129685 Ga0501031_0129685_1086_1361 91
267 3300049571 Ga0501034_0065492 Ga0501034_0065492_1113_1388 91
268 3300049572 Ga0501036_0164485 Ga0501036_0164485_885_1160 91
269 3300049572 Ga0501036_0846436 Ga0501036_0846436_100_378 91
270 3300049574 Ga0501038_0294307 Ga0501038_0294307_396_671 91
271 3300049575 Ga0501039_0370305 Ga0501039_0370305_448_723 91
272 3300049576 Ga0501040_0051375 Ga0501040_0051375_1274_1549 91
273 3300049577 Ga0501041_0263076 Ga0501041_0263076_615_890 91
274 3300049578 Ga0501042_0068897 Ga0501042_0068897_1832_2107 91
275 3300049578 Ga0501042_0200285 Ga0501042_0200285_976_1251 91
276 3300049578 Ga0501042_0687391 Ga0501042_0687391_187_462 91
277 3300049579 Ga0501043_1298474 Ga0501043_1298474_96_371 91
278 3300049580 Ga0501046_0378913 Ga0501046_0378913_328_603 91
279 3300049582 Ga0501048_0238163 Ga0501048_0238163_422_697 91
280 3300049582 Ga0501048_0707820 Ga0501048_0707820_146_421 91
281 3300049586 Ga0501070_1159668 Ga0501070_1159668_183_458 91
282 3300049586 Ga0501070_1164071 Ga0501070_1164071_82_357 91
283 3300049587 Ga0501071_0187779 Ga0501071_0187779_952_1227 91
284 3300049588 Ga0501072_0036478 Ga0501072_0036478_2161_2436 91
285 3300049588 Ga0501072_0320363 Ga0501072_0320363_743_1018 91
286 3300049588 Ga0501072_0543518 Ga0501072_0543518_616_891 91
287 3300049590 Ga0501074_0057793 Ga0501074_0057793_759_1034 91
288 3300049593 Ga0501077_0285603 Ga0501077_0285603_507_782 91
289 3300049708 Ga0501245_142765 Ga0501245_142765_153_428 91
290 3300049741 Ga0501079_0054139 Ga0501079_0054139_1778_2053 91
291 3300049742 Ga0501080_1444011 Ga0501080_1444011_117_392 91
292 3300049742 Ga0501080_1853341 Ga0501080_1853341_61_336 91
293 3300049743 Ga0501081_0577842 Ga0501081_0577842_430_705 91
294 3300049822 Ga0501035_0526597 Ga0501035_0526597_443_718 91
295 3300049824 Ga0501045_0244238 Ga0501045_0244238_783_1058 91
296 3300050509 nmdc:mga0qj67_1504110_c1 nmdc:mga0qj67_1504110_c1_148_423 91
297 3300050510 nmdc:mga06r32_288621_c1 nmdc:mga06r32_288621_c1_808_1083 91
298 3300050511 nmdc:mga08y16_1369307_c1 nmdc:mga08y16_1369307_c1_73_348 91
299 3300050511 nmdc:mga08y16_27826_c1 nmdc:mga08y16_27826_c1_5620_5895 91
300 3300050512 nmdc:mga0n895_327803_c1 nmdc:mga0n895_327803_c1_1087_1362 91
301 3300050512 nmdc:mga0n895_973018_c1 nmdc:mga0n895_973018_c1_209_484 91
302 3300053153 Ga0500616_0007342 Ga0500616_0007342_656_931 91
303 3300054114 Ga0501084_0590609 Ga0501084_0590609_535_810 91
304 3300059640 Ga0587067_189621 Ga0587067_189621_156_431 91
305 3300060353 Ga0501082_0459576 Ga0501082_0459576_432_707 91
306 3300061719 Ga0466962_0032874 Ga0466962_0032874_509_784 91
307 3300061719 Ga0466962_0143923 Ga0466962_0143923_862_1137 91
308 3300061719 Ga0466962_0548992 Ga0466962_0548992_144_419 91
309 3300061734 Ga0530510_0113908 Ga0530510_0113908_1274_1549 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

6

77

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.92 1 75
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9087 1 75
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8914 1 79
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8709 1 79
7fby-assembly1.cif.gz_A crystal structure of ph0140 from pyrococcus horikosii ot3 0.8693 2 79
ID Description Score Start End Superfamily
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9316 1 75 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9275 3 73 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9266 1 72 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.92 1 75 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.903 3 73 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A536E5W3-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9979 1 70
AF-A0A536E5W3-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9702 1 70
AF-A0A842SQG5-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9659 1 71
AF-A0A350DAX2-F1-model_v4 AsnC family transcriptional regulator 0.9612 1 71
AF-A0A2R6ACG9-F1-model_v4 AsnC family transcriptional regulator 0.9557 1 72

Feature Viewer

pLDDT pTM Quality
93.66 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map