F400070

General Info

Members Datasets Scaffolds Average Seq Length
309 191 309 166

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100048551|Ga0070659_1000485513
Length 199
Sequence VARLKRPASSPRPPSNPSSLDRVARPFAGDASRLVVMGRIAGSFGVKGWVKVKPFSEKEDALAGHDTWVVRTRDGWREMDLEDFEVHAKGPVAKLAGSDAREVSDALRGADVAVAREALGEAEEGSLYQVDLIGLDVVEEDGSLLGRVDGFFDAGETSVMVVAGADGRERLVPFVADFVKSVDREAKRVTVDWKAEYDA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 1.29
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10087029 3300005290 Bacteria 2602
2 Ga0065715_10305865 3300005293 Bacteria 1031
3 Ga0065707_10081966 3300005295 Bacteria 26944
4 Ga0070658_10034866 3300005327 Bacteria 4050
5 Ga0070658_10125903 3300005327 Bacteria 2133
6 Ga0070676_10388159 3300005328 Bacteria 968
7 Ga0070683_100274466 3300005329 Bacteria 1604
8 Ga0070690_100103876 3300005330 Bacteria 1887
9 Ga0070690_100229452 3300005330 Bacteria 1305
10 Ga0070690_101081895 3300005330 Unclassified 635
11 Ga0070677_10143289 3300005333 Bacteria 1104
12 Ga0068869_100076173 3300005334 Bacteria 2493
13 Ga0068869_100162596 3300005334 Bacteria 1739
14 Ga0070680_100293661 3300005336 Bacteria 1378
15 Ga0070682_100153348 3300005337 Bacteria 1583
16 Ga0070689_100072468 3300005340 Bacteria 2692
17 Ga0070689_100139675 3300005340 Bacteria 1948
18 Ga0070687_100081613 3300005343 Bacteria 1766
19 Ga0070661_100267697 3300005344 Bacteria 1322
20 Ga0070692_10145958 3300005345 Bacteria 1343
21 Ga0070669_100087263 3300005353 Bacteria 2332
22 Ga0070675_100009662 3300005354 Bacteria 7508
23 Ga0070675_100025029 3300005354 Bacteria 4784
24 Ga0070675_100111441 3300005354 Bacteria 2316
25 Ga0070671_100339576 3300005355 Bacteria 1281
26 Ga0070674_101117493 3300005356 Bacteria 696
27 Ga0070673_100043585 3300005364 Bacteria 3468
28 Ga0070673_100097728 3300005364 Bacteria 2412
29 Ga0070673_100485447 3300005364 Unclassified 1116
30 Ga0070673_101352756 3300005364 Bacteria 669
31 Ga0070688_100036289 3300005365 Bacteria 2997
32 Ga0070688_101086103 3300005365 Unclassified 639
33 Ga0070659_100048551 3300005366 Bacteria 3335
34 Ga0070714_100107247 3300005435 Bacteria 2468
35 Ga0070714_100207915 3300005435 Bacteria 1793
36 Ga0070713_100506504 3300005436 Bacteria 1140
37 Ga0070701_10006208 3300005438 Bacteria 5012
38 Ga0070701_10096928 3300005438 Bacteria 1626
39 Ga0070701_10307315 3300005438 Bacteria 977
40 Ga0070711_100833710 3300005439 Bacteria 784
41 Ga0070705_100211968 3300005440 Bacteria 1336
42 Ga0070705_100703303 3300005440 Bacteria 794
43 Ga0070700_100101524 3300005441 Bacteria 1896
44 Ga0070663_100410664 3300005455 Bacteria 1109
45 Ga0070678_100736845 3300005456 Bacteria 890
46 Ga0070681_10007545 3300005458 Bacteria 10628
47 Ga0070681_10012364 3300005458 Bacteria 8464
48 Ga0070681_10380919 3300005458 Bacteria 1321
49 Ga0068867_100392422 3300005459 Bacteria 1168
50 Ga0068867_100664870 3300005459 Bacteria 915
51 Ga0068867_100706173 3300005459 Bacteria 890
52 Ga0070699_100514869 3300005518 Bacteria 1087
53 Ga0070699_100568278 3300005518 Bacteria 1033
54 Ga0070679_100019541 3300005530 Bacteria 6591
55 Ga0070679_100553736 3300005530 Bacteria 1094
56 Ga0070679_100717600 3300005530 Bacteria 942
57 Ga0070679_100899850 3300005530 Bacteria 828
58 Ga0070684_100354106 3300005535 Bacteria 1350
59 Ga0070697_101077270 3300005536 Unclassified 715
60 Ga0068853_100024287 3300005539 Bacteria 5081
61 Ga0068853_100029946 3300005539 Bacteria 4593
62 Ga0068853_101032702 3300005539 Bacteria 792
63 Ga0070672_100222223 3300005543 Bacteria 1584
64 Ga0070696_100153404 3300005546 Bacteria 1692
65 Ga0070693_100000865 3300005547 Bacteria 13507
66 Ga0070693_100080520 3300005547 Bacteria 1940
67 Ga0070693_100122692 3300005547 Bacteria 1613
68 Ga0070665_100353032 3300005548 Bacteria 1476
69 Ga0068855_100017780 3300005563 Bacteria 8547
70 Ga0068855_100090735 3300005563 Bacteria 3525
71 Ga0068855_100120702 3300005563 Bacteria 3000
72 Ga0068855_100145068 3300005563 Bacteria 2703
73 Ga0068855_101026066 3300005563 Bacteria 865
74 Ga0070664_101033240 3300005564 Bacteria 773
75 Ga0068854_100381360 3300005578 Bacteria 1162
76 Ga0068856_100025504 3300005614 Bacteria 5765
77 Ga0068856_100269408 3300005614 Bacteria 1719
78 Ga0070702_100166065 3300005615 Bacteria 1431
79 Ga0070702_100221660 3300005615 Bacteria 1265
80 Ga0068852_100001932 3300005616 Bacteria 14116
81 Ga0068852_100030794 3300005616 Bacteria 4421
82 Ga0068859_100020233 3300005617 Bacteria 6681
83 Ga0068859_100108748 3300005617 Bacteria 2833
84 Ga0068861_100065962 3300005719 Bacteria 2790
85 Ga0068861_100170109 3300005719 Bacteria 1805
86 Ga0068861_100533216 3300005719 Bacteria 1067
87 Ga0068851_10381603 3300005834 Bacteria 826
88 Ga0068870_10167808 3300005840 Bacteria 1307
89 Ga0068858_100001245 3300005842 Bacteria 26312
90 Ga0068860_100306951 3300005843 Bacteria 1556
91 Ga0068860_100371533 3300005843 Bacteria 1410
92 Ga0081539_10173373 3300005985 Bacteria 1017
93 Ga0075367_10163269 3300006178 Bacteria 1385
94 Ga0075366_10007389 3300006195 Bacteria 6066
95 Ga0075366_10117459 3300006195 Bacteria 1602
96 Ga0097621_100041056 3300006237 Bacteria 3722
97 Ga0097621_100067031 3300006237 Bacteria 2958
98 Ga0097621_100721742 3300006237 Bacteria 919
99 Ga0075370_10071686 3300006353 Bacteria 1982
100 Ga0068871_100031636 3300006358 Bacteria 4174
101 Ga0068871_100097175 3300006358 Bacteria 2461
102 Ga0068865_100197152 3300006881 Bacteria 1561
103 Ga0068865_100661726 3300006881 Bacteria 889
104 Ga0075436_100848747 3300006914 Bacteria 682
105 Ga0097620_100020233 3300006931 Bacteria 6681
106 Ga0097620_100108746 3300006931 Bacteria 2833
107 Ga0105240_10213958 3300009093 Bacteria 2250
108 Ga0105240_10352932 3300009093 Bacteria 1668
109 Ga0105240_10375460 3300009093 Bacteria 1607
110 Ga0105240_11006117 3300009093 Bacteria 891
111 Ga0111539_10000774 3300009094 Bacteria 41587
112 Ga0105245_10183781 3300009098 Bacteria 1999
113 Ga0105245_10438308 3300009098 Bacteria 1313
114 Ga0105245_10685688 3300009098 Bacteria 1057
115 Ga0105245_10842797 3300009098 Bacteria 956
116 Ga0105243_11046145 3300009148 Bacteria 822
117 Ga0105241_10117561 3300009174 Bacteria 2137
118 Ga0105241_10128079 3300009174 Bacteria 2052
119 Ga0105241_10141099 3300009174 Bacteria 1962
120 Ga0105241_10623960 3300009174 Bacteria 976
121 Ga0105242_10003935 3300009176 Bacteria 11546
122 Ga0105242_10008702 3300009176 Bacteria 7787
123 Ga0105242_10295194 3300009176 Bacteria 1477
124 Ga0105248_10019213 3300009177 Bacteria 7559
125 Ga0105248_10144939 3300009177 Bacteria 2680
126 Ga0105237_10038124 3300009545 Bacteria 4855
127 Ga0105238_10121633 3300009551 Bacteria 2590
128 Ga0105238_10315167 3300009551 Bacteria 1549
129 Ga0105238_10640332 3300009551 Bacteria 1073
130 Ga0105249_10110697 3300009553 Bacteria 2595
131 Ga0105249_11025511 3300009553 Bacteria 894
132 Ga0105239_10014722 3300010375 Bacteria 8674
133 Ga0157371_10322834 3300013102 Bacteria 1121
134 Ga0157370_10003796 3300013104 Bacteria 17624
135 Ga0157370_10558479 3300013104 Bacteria 1049
136 Ga0157369_10002433 3300013105 Bacteria 22368
137 Ga0157369_10521720 3300013105 Bacteria 1229
138 Ga0157378_10041432 3300013297 Bacteria 4084
139 Ga0157378_10222259 3300013297 Bacteria 1796
140 Ga0163162_10014658 3300013306 Bacteria 7660
141 Ga0163162_10484188 3300013306 Bacteria 1369
142 Ga0157372_10007773 3300013307 Bacteria 11387
143 Ga0157372_10045690 3300013307 Bacteria 4859
144 Ga0157372_10396243 3300013307 Bacteria 1609
145 Ga0157372_10922843 3300013307 Bacteria 1012
146 Ga0157372_11295391 3300013307 Bacteria 841
147 Ga0163163_11052229 3300014325 Bacteria 877
148 Ga0157380_10001358 3300014326 Bacteria 15941
149 Ga0157380_10064327 3300014326 Bacteria 2944
150 Ga0157380_10165538 3300014326 Bacteria 1926
151 Ga0157380_10187176 3300014326 Bacteria 1824
152 Ga0157380_10329629 3300014326 Bacteria 1419
153 Ga0157377_10048944 3300014745 Bacteria 2374
154 Ga0157377_10111103 3300014745 Bacteria 1647
155 Ga0157379_10052682 3300014968 Bacteria 3635
156 Ga0157379_10340139 3300014968 Bacteria 1372
157 Ga0157379_10892330 3300014968 Bacteria 843
158 Ga0163161_10413637 3300017792 Bacteria 1083
159 Ga0207656_10196242 3300025321 Bacteria 974
160 Ga0207682_10032817 3300025893 Bacteria 2087
161 Ga0207692_10277001 3300025898 Bacteria 1014
162 Ga0207643_10026396 3300025908 Bacteria 3215
163 Ga0207705_10198760 3300025909 Bacteria 1519
164 Ga0207654_10039013 3300025911 Bacteria 2668
165 Ga0207654_10234177 3300025911 Bacteria 1224
166 Ga0207654_10528593 3300025911 Bacteria 836
167 Ga0207695_10010633 3300025913 Bacteria 11243
168 Ga0207671_10056936 3300025914 Bacteria 2897
169 Ga0207663_10199028 3300025916 Bacteria 1444
170 Ga0207663_10726255 3300025916 Bacteria 788
171 Ga0207662_10020061 3300025918 Bacteria 3812
172 Ga0207657_10162461 3300025919 Bacteria 1814
173 Ga0207652_10020780 3300025921 Bacteria 5410
174 Ga0207652_10020872 3300025921 Bacteria 5400
175 Ga0207652_10023249 3300025921 Bacteria 5133
176 Ga0207652_10780605 3300025921 Bacteria 849
177 Ga0207681_10241955 3300025923 Bacteria 1405
178 Ga0207694_10091477 3300025924 Bacteria 2401
179 Ga0207694_10226755 3300025924 Bacteria 1525
180 Ga0207659_10055239 3300025926 Bacteria 2839
181 Ga0207659_10234981 3300025926 Bacteria 1480
182 Ga0207700_10211929 3300025928 Bacteria 1638
183 Ga0207664_10043246 3300025929 Bacteria 3522
184 Ga0207664_10111926 3300025929 Bacteria 2272
185 Ga0207686_10011878 3300025934 Bacteria 4780
186 Ga0207686_10013937 3300025934 Bacteria 4461
187 Ga0207709_10413442 3300025935 Bacteria 1034
188 Ga0207670_10079239 3300025936 Bacteria 2293
189 Ga0207670_10137368 3300025936 Bacteria 1799
190 Ga0207691_10007747 3300025940 Bacteria 10338
191 Ga0207689_10076475 3300025942 Bacteria 2752
192 Ga0207689_10098902 3300025942 Bacteria 2397
193 Ga0207661_10766865 3300025944 Bacteria 888
194 Ga0207667_10006138 3300025949 Bacteria 14599
195 Ga0207667_10048883 3300025949 Bacteria 4471
196 Ga0207667_10108258 3300025949 Bacteria 2868
197 Ga0207667_10117745 3300025949 Bacteria 2738
198 Ga0207667_10199796 3300025949 Bacteria 2051
199 Ga0207667_10295258 3300025949 Bacteria 1656
200 Ga0207651_10059756 3300025960 Bacteria 2643
201 Ga0207712_10752995 3300025961 Bacteria 853
202 Ga0207668_10756367 3300025972 Bacteria 858
203 Ga0207640_10263708 3300025981 Bacteria 1344
204 Ga0207677_10736485 3300026023 Bacteria 877
205 Ga0207703_10007533 3300026035 Bacteria 8636
206 Ga0207703_10386722 3300026035 Bacteria 1295
207 Ga0207639_10009851 3300026041 Bacteria 6600
208 Ga0207639_10013242 3300026041 Bacteria 5766
209 Ga0207639_10501399 3300026041 Bacteria 1109
210 Ga0207678_10735976 3300026067 Bacteria 869
211 Ga0207708_10432736 3300026075 Bacteria 1093
212 Ga0207702_10022743 3300026078 Bacteria 5200
213 Ga0207702_10856353 3300026078 Bacteria 900
214 Ga0207648_10450512 3300026089 Bacteria 1172
215 Ga0207648_10679335 3300026089 Bacteria 953
216 Ga0207676_10311896 3300026095 Bacteria 1441
217 Ga0207674_10022838 3300026116 Bacteria 6712
218 Ga0207675_100004064 3300026118 Bacteria 14163
219 Ga0207675_100403418 3300026118 Bacteria 1347
220 Ga0207683_10037803 3300026121 Bacteria 4205
221 Ga0207698_10002880 3300026142 Bacteria 10291
222 Ga0207698_10333471 3300026142 Bacteria 1426
223 Ga0209995_1028536 3300027471 Bacteria 932
224 Ga0207428_10031730 3300027907 Bacteria 4354
225 Ga0268266_10382299 3300028379 Bacteria 1328
226 Ga0268266_11230916 3300028379 Unclassified 724
227 Ga0268265_10417611 3300028380 Bacteria 1245
228 Ga0268264_10290744 3300028381 Bacteria 1535
229 Ga0265330_10132480 3300031235 Bacteria 1061
230 Ga0307408_100166328 3300031548 Bacteria 1757
231 Ga0307408_100500922 3300031548 Bacteria 1063
232 Ga0265314_10173024 3300031711 Bacteria 1301
233 Ga0307405_10201185 3300031731 Bacteria 1447
234 Ga0307405_10373332 3300031731 Bacteria 1108
235 Ga0307405_10565445 3300031731 Bacteria 922
236 Ga0307405_10623282 3300031731 Bacteria 883
237 Ga0307413_10405581 3300031824 Bacteria 1069
238 Ga0307410_10019022 3300031852 Bacteria 4167
239 Ga0307406_10009272 3300031901 Bacteria 5516
240 Ga0307407_10375176 3300031903 Bacteria 1014
241 Ga0307412_10029557 3300031911 Bacteria 3441
242 Ga0307409_100004693 3300031995 Bacteria 7735
243 Ga0307409_100009430 3300031995 Bacteria 5995
244 Ga0307416_100062469 3300032002 Bacteria 3046
245 Ga0307416_100062665 3300032002 Bacteria 3042
246 Ga0307416_100078505 3300032002 Bacteria 2778
247 Ga0307416_100204324 3300032002 Bacteria 1878
248 Ga0307416_100332727 3300032002 Bacteria 1527
249 Ga0307416_100554033 3300032002 Bacteria 1223
250 Ga0307416_103453854 3300032002 Unclassified 529
251 Ga0373928_0023987 3300035084 Bacteria 1305
252 Ga0373929_0032315 3300035085 Bacteria 1125
253 Ga0373931_0020315 3300035691 Bacteria 3322
254 Ga0373935_0247797 3300035692 Bacteria 1246
255 Ga0373933_0419777 3300035724 Bacteria 874
256 Ga0373947_0393009 3300035725 Bacteria 935
257 Ga0373925_0165351 3300037068 Bacteria 1744
258 Ga0395905_0014552 3300037471 Bacteria 7506
259 Ga0436365_0216233 3300039437 Bacteria 883
260 Ga0451800_1480898 3300041459 Bacteria 595
261 Ga0439441_004084 3300042001 Bacteria 2192
262 Ga0450888_023439 3300042126 Unclassified 797
263 Ga0451577_0203621 3300042876 Bacteria 1787
264 Ga0451577_0538410 3300042876 Unclassified 1060
265 Ga0466961_0165715 3300044693 Bacteria 1376
266 Ga0466957_0035519 3300044842 Bacteria 2991
267 Ga0451576_0293850 3300045051 Bacteria 1699
268 Ga0451576_0743300 3300045051 Bacteria 1030
269 Ga0466958_0021170 3300045836 Bacteria 3797
270 Ga0495638_0024258 3300046460 Bacteria 3957
271 Ga0495664_0165966 3300046477 Bacteria 1340
272 Ga0495598_0016777 3300046537 Bacteria 1876
273 Ga0495598_0145235 3300046537 Bacteria 824
274 Ga0495621_0010410 3300046539 Bacteria 2844
275 Ga0495645_0522947 3300046543 Bacteria 739
276 Ga0495625_0001706 3300046660 Bacteria 25551
277 Ga0495647_0153108 3300046681 Bacteria 990
278 Ga0495658_0200388 3300046683 Bacteria 1244
279 Ga0495672_0121016 3300047320 Bacteria 1391
280 Ga0496101_0570592 3300048904 Bacteria 895
281 Ga0496110_0098468 3300048913 Bacteria 2621
282 Ga0496114_0390208 3300048917 Bacteria 1233
283 Ga0496118_0157558 3300048921 Bacteria 1410
284 Ga0496121_0349423 3300048924 Bacteria 985
285 Ga0501034_0134246 3300049571 Bacteria 2457
286 Ga0501034_0590941 3300049571 Bacteria 1016
287 Ga0501037_0438549 3300049573 Bacteria 892
288 Ga0501047_0955315 3300049581 Unclassified 670
289 Ga0501067_0111774 3300049583 Bacteria 1519
290 Ga0501068_0023728 3300049584 Bacteria 3597
291 Ga0501069_0000753 3300049585 Bacteria 15120
292 Ga0501069_0074070 3300049585 Bacteria 1910
293 Ga0501070_0007363 3300049586 Bacteria 9344
294 Ga0501073_0037060 3300049589 Bacteria 3464
295 Ga0501073_0603407 3300049589 Bacteria 758
296 Ga0501079_0216371 3300049741 Bacteria 1496
297 Ga0501080_0159520 3300049742 Bacteria 2083
298 Ga0501083_0000417 3300049744 Bacteria 27243
299 Ga0501035_0332630 3300049822 Bacteria 1274
300 nmdc:mga0k408_87996_c1 3300050493 Bacteria 1824
301 nmdc:mga07m45_110685_c1 3300050496 Bacteria 969
302 nmdc:mga0qj67_548916_c1 3300050509 Bacteria 927
303 nmdc:mga08y16_147_c1 3300050511 Bacteria 61021
304 nmdc:mga0rr50_26825_c1 3300050513 Bacteria 4027
305 nmdc:mga0rr50_487437_c1 3300050513 Bacteria 1047
306 nmdc:mga08x19_617537_c1 3300050514 Bacteria 768
307 nmdc:mga08x19_98727_c1 3300050514 Bacteria 1935
308 Ga0501084_0630158 3300054114 Bacteria 905
309 Ga0501082_0072057 3300060353 Bacteria 2976

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0200388 Ga0495658_0200388_321_770 149
2 3300026023 Ga0207677_10736485 Ga0207677_107364852 152
3 3300005343 Ga0070687_100081613 Ga0070687_1000816132 153
4 3300005355 Ga0070671_100339576 Ga0070671_1003395763 153
5 3300005364 Ga0070673_100097728 Ga0070673_1000977283 153
6 3300006237 Ga0097621_100721742 Ga0097621_1007217422 153
7 3300025918 Ga0207662_10020061 Ga0207662_100200614 153
8 3300025981 Ga0207640_10263708 Ga0207640_102637083 153
9 3300026095 Ga0207676_10311896 Ga0207676_103118962 153
10 3300035084 Ga0373928_0023987 Ga0373928_0023987_93_554 153
11 3300044693 Ga0466961_0165715 Ga0466961_0165715_306_899 153
12 3300044842 Ga0466957_0035519 Ga0466957_0035519_1536_2129 153
13 3300046539 Ga0495621_0010410 Ga0495621_0010410_1600_2061 153
14 3300025916 Ga0207663_10726255 Ga0207663_107262552 155
15 3300045836 Ga0466958_0021170 Ga0466958_0021170_3023_3616 155
16 3300005435 Ga0070714_100107247 Ga0070714_1001072473 156
17 3300005439 Ga0070711_100833710 Ga0070711_1008337102 156
18 3300005518 Ga0070699_100568278 Ga0070699_1005682782 156
19 3300005563 Ga0068855_100145068 Ga0068855_1001450682 156
20 3300009093 Ga0105240_10375460 Ga0105240_103754603 156
21 3300013104 Ga0157370_10003796 Ga0157370_100037962 156
22 3300025929 Ga0207664_10111926 Ga0207664_101119263 156
23 3300025949 Ga0207667_10108258 Ga0207667_101082584 156
24 3300005563 Ga0068855_100120702 Ga0068855_1001207022 158
25 3300013307 Ga0157372_11295391 Ga0157372_112953912 158
26 3300025949 Ga0207667_10048883 Ga0207667_100488832 158
27 3300005293 Ga0065715_10305865 Ga0065715_103058652 159
28 3300005295 Ga0065707_10081966 Ga0065707_100819663 159
29 3300005327 Ga0070658_10125903 Ga0070658_101259033 159
30 3300005337 Ga0070682_100153348 Ga0070682_1001533483 159
31 3300005353 Ga0070669_100087263 Ga0070669_1000872631 159
32 3300005354 Ga0070675_100009662 Ga0070675_1000096625 159
33 3300005364 Ga0070673_100485447 Ga0070673_1004854472 159
34 3300005455 Ga0070663_100410664 Ga0070663_1004106641 159
35 3300005458 Ga0070681_10007545 Ga0070681_1000754512 159
36 3300005459 Ga0068867_100706173 Ga0068867_1007061731 159
37 3300005539 Ga0068853_100024287 Ga0068853_1000242875 159
38 3300005719 Ga0068861_100170109 Ga0068861_1001701092 159
39 3300005840 Ga0068870_10167808 Ga0068870_101678082 159
40 3300005843 Ga0068860_100371533 Ga0068860_1003715333 159
41 3300006881 Ga0068865_100197152 Ga0068865_1001971523 159
42 3300009098 Ga0105245_10438308 Ga0105245_104383082 159
43 3300009174 Ga0105241_10128079 Ga0105241_101280793 159
44 3300009176 Ga0105242_10295194 Ga0105242_102951943 159
45 3300009545 Ga0105237_10038124 Ga0105237_100381244 159
46 3300010375 Ga0105239_10014722 Ga0105239_100147222 159
47 3300013307 Ga0157372_10922843 Ga0157372_109228432 159
48 3300014326 Ga0157380_10001358 Ga0157380_1000135813 159
49 3300014745 Ga0157377_10048944 Ga0157377_100489444 159
50 3300014968 Ga0157379_10340139 Ga0157379_103401393 159
51 3300025911 Ga0207654_10039013 Ga0207654_100390133 159
52 3300025914 Ga0207671_10056936 Ga0207671_100569364 159
53 3300025921 Ga0207652_10020872 Ga0207652_100208724 159
54 3300025926 Ga0207659_10055239 Ga0207659_100552393 159
55 3300025949 Ga0207667_10295258 Ga0207667_102952582 159
56 3300025960 Ga0207651_10059756 Ga0207651_100597562 159
57 3300026041 Ga0207639_10009851 Ga0207639_100098515 159
58 3300026067 Ga0207678_10735976 Ga0207678_107359761 159
59 3300026116 Ga0207674_10022838 Ga0207674_100228386 159
60 3300026118 Ga0207675_100004064 Ga0207675_1000040649 159
61 3300028379 Ga0268266_11230916 Ga0268266_112309161 159
62 3300028380 Ga0268265_10417611 Ga0268265_104176112 159
63 3300031824 Ga0307413_10405581 Ga0307413_104055812 159
64 3300035724 Ga0373933_0419777 Ga0373933_0419777_84_602 159
65 3300046460 Ga0495638_0024258 Ga0495638_0024258_1360_1911 159
66 3300046660 Ga0495625_0001706 Ga0495625_0001706_22596_23147 159
67 3300047320 Ga0495672_0121016 Ga0495672_0121016_811_1311 159
68 3300048904 Ga0496101_0570592 Ga0496101_0570592_55_573 159
69 3300048913 Ga0496110_0098468 Ga0496110_0098468_300_881 159
70 3300048917 Ga0496114_0390208 Ga0496114_0390208_262_843 159
71 3300048921 Ga0496118_0157558 Ga0496118_0157558_339_890 159
72 3300048924 Ga0496121_0349423 Ga0496121_0349423_45_596 159
73 3300049571 Ga0501034_0590941 Ga0501034_0590941_446_931 159
74 3300049585 Ga0501069_0074070 Ga0501069_0074070_1265_1744 159
75 3300050509 nmdc:mga0qj67_548916_c1 nmdc:mga0qj67_548916_c1_393_914 159
76 3300005985 Ga0081539_10173373 Ga0081539_101733732 160
77 3300050513 nmdc:mga0rr50_26825_c1 nmdc:mga0rr50_26825_c1_122_604 160
78 3300050514 nmdc:mga08x19_98727_c1 nmdc:mga08x19_98727_c1_411_893 160
79 3300005328 Ga0070676_10388159 Ga0070676_103881592 161
80 3300005329 Ga0070683_100274466 Ga0070683_1002744662 161
81 3300005330 Ga0070690_100103876 Ga0070690_1001038763 161
82 3300005330 Ga0070690_101081895 Ga0070690_1010818951 161
83 3300005333 Ga0070677_10143289 Ga0070677_101432892 161
84 3300005334 Ga0068869_100076173 Ga0068869_1000761732 161
85 3300005334 Ga0068869_100162596 Ga0068869_1001625962 161
86 3300005336 Ga0070680_100293661 Ga0070680_1002936611 161
87 3300005340 Ga0070689_100072468 Ga0070689_1000724684 161
88 3300005344 Ga0070661_100267697 Ga0070661_1002676973 161
89 3300005345 Ga0070692_10145958 Ga0070692_101459582 161
90 3300005354 Ga0070675_100025029 Ga0070675_1000250292 161
91 3300005356 Ga0070674_101117493 Ga0070674_1011174931 161
92 3300005364 Ga0070673_100043585 Ga0070673_1000435853 161
93 3300005364 Ga0070673_101352756 Ga0070673_1013527561 161
94 3300005365 Ga0070688_100036289 Ga0070688_1000362891 161
95 3300005438 Ga0070701_10006208 Ga0070701_100062087 161
96 3300005438 Ga0070701_10096928 Ga0070701_100969283 161
97 3300005440 Ga0070705_100211968 Ga0070705_1002119682 161
98 3300005456 Ga0070678_100736845 Ga0070678_1007368452 161
99 3300005458 Ga0070681_10012364 Ga0070681_100123648 161
100 3300005458 Ga0070681_10380919 Ga0070681_103809193 161
101 3300005459 Ga0068867_100392422 Ga0068867_1003924221 161
102 3300005459 Ga0068867_100664870 Ga0068867_1006648702 161
103 3300005518 Ga0070699_100514869 Ga0070699_1005148692 161
104 3300005530 Ga0070679_100717600 Ga0070679_1007176002 161
105 3300005530 Ga0070679_100899850 Ga0070679_1008998502 161
106 3300005535 Ga0070684_100354106 Ga0070684_1003541061 161
107 3300005536 Ga0070697_101077270 Ga0070697_1010772701 161
108 3300005539 Ga0068853_100029946 Ga0068853_1000299464 161
109 3300005543 Ga0070672_100222223 Ga0070672_1002222232 161
110 3300005546 Ga0070696_100153404 Ga0070696_1001534043 161
111 3300005547 Ga0070693_100000865 Ga0070693_10000086516 161
112 3300005547 Ga0070693_100080520 Ga0070693_1000805202 161
113 3300005547 Ga0070693_100122692 Ga0070693_1001226922 161
114 3300005548 Ga0070665_100353032 Ga0070665_1003530322 161
115 3300005563 Ga0068855_100017780 Ga0068855_1000177805 161
116 3300005563 Ga0068855_101026066 Ga0068855_1010260662 161
117 3300005614 Ga0068856_100025504 Ga0068856_1000255044 161
118 3300005615 Ga0070702_100166065 Ga0070702_1001660653 161
119 3300005617 Ga0068859_100020233 Ga0068859_1000202333 161
120 3300005617 Ga0068859_100108748 Ga0068859_1001087481 161
121 3300005719 Ga0068861_100065962 Ga0068861_1000659623 161
122 3300005834 Ga0068851_10381603 Ga0068851_103816031 161
123 3300006178 Ga0075367_10163269 Ga0075367_101632693 161
124 3300006195 Ga0075366_10007389 Ga0075366_100073896 161
125 3300006195 Ga0075366_10117459 Ga0075366_101174592 161
126 3300006237 Ga0097621_100041056 Ga0097621_1000410562 161
127 3300006353 Ga0075370_10071686 Ga0075370_100716863 161
128 3300006358 Ga0068871_100031636 Ga0068871_1000316362 161
129 3300006358 Ga0068871_100097175 Ga0068871_1000971754 161
130 3300006881 Ga0068865_100661726 Ga0068865_1006617262 161
131 3300006914 Ga0075436_100848747 Ga0075436_1008487471 161
132 3300006931 Ga0097620_100020233 Ga0097620_1000202333 161
133 3300006931 Ga0097620_100108746 Ga0097620_1001087464 161
134 3300009093 Ga0105240_10213958 Ga0105240_102139583 161
135 3300009094 Ga0111539_10000774 Ga0111539_1000077421 161
136 3300009098 Ga0105245_10183781 Ga0105245_101837813 161
137 3300009098 Ga0105245_10685688 Ga0105245_106856882 161
138 3300009098 Ga0105245_10842797 Ga0105245_108427972 161
139 3300009148 Ga0105243_11046145 Ga0105243_110461452 161
140 3300009174 Ga0105241_10117561 Ga0105241_101175613 161
141 3300009174 Ga0105241_10141099 Ga0105241_101410992 161
142 3300009174 Ga0105241_10623960 Ga0105241_106239602 161
143 3300009177 Ga0105248_10019213 Ga0105248_100192134 161
144 3300009551 Ga0105238_10315167 Ga0105238_103151672 161
145 3300009553 Ga0105249_10110697 Ga0105249_101106972 161
146 3300009553 Ga0105249_11025511 Ga0105249_110255112 161
147 3300013104 Ga0157370_10558479 Ga0157370_105584792 161
148 3300013297 Ga0157378_10041432 Ga0157378_100414325 161
149 3300013306 Ga0163162_10484188 Ga0163162_104841883 161
150 3300013307 Ga0157372_10045690 Ga0157372_100456902 161
151 3300014325 Ga0163163_11052229 Ga0163163_110522292 161
152 3300014326 Ga0157380_10064327 Ga0157380_100643273 161
153 3300014326 Ga0157380_10165538 Ga0157380_101655383 161
154 3300014326 Ga0157380_10187176 Ga0157380_101871763 161
155 3300014745 Ga0157377_10111103 Ga0157377_101111033 161
156 3300025321 Ga0207656_10196242 Ga0207656_101962422 161
157 3300025893 Ga0207682_10032817 Ga0207682_100328173 161
158 3300025908 Ga0207643_10026396 Ga0207643_100263964 161
159 3300025911 Ga0207654_10234177 Ga0207654_102341772 161
160 3300025911 Ga0207654_10528593 Ga0207654_105285932 161
161 3300025913 Ga0207695_10010633 Ga0207695_1001063315 161
162 3300025921 Ga0207652_10020780 Ga0207652_100207801 161
163 3300025921 Ga0207652_10780605 Ga0207652_107806052 161
164 3300025923 Ga0207681_10241955 Ga0207681_102419553 161
165 3300025924 Ga0207694_10091477 Ga0207694_100914771 161
166 3300025926 Ga0207659_10234981 Ga0207659_102349812 161
167 3300025929 Ga0207664_10043246 Ga0207664_100432464 161
168 3300025936 Ga0207670_10079239 Ga0207670_100792392 161
169 3300025940 Ga0207691_10007747 Ga0207691_100077477 161
170 3300025942 Ga0207689_10076475 Ga0207689_100764754 161
171 3300025942 Ga0207689_10098902 Ga0207689_100989022 161
172 3300025944 Ga0207661_10766865 Ga0207661_107668652 161
173 3300025949 Ga0207667_10006138 Ga0207667_1000613814 161
174 3300025961 Ga0207712_10752995 Ga0207712_107529952 161
175 3300025972 Ga0207668_10756367 Ga0207668_107563672 161
176 3300026035 Ga0207703_10386722 Ga0207703_103867222 161
177 3300026041 Ga0207639_10501399 Ga0207639_105013992 161
178 3300026075 Ga0207708_10432736 Ga0207708_104327362 161
179 3300026078 Ga0207702_10022743 Ga0207702_100227432 161
180 3300026089 Ga0207648_10450512 Ga0207648_104505122 161
181 3300026089 Ga0207648_10679335 Ga0207648_106793352 161
182 3300026121 Ga0207683_10037803 Ga0207683_100378035 161
183 3300026142 Ga0207698_10333471 Ga0207698_103334712 161
184 3300027907 Ga0207428_10031730 Ga0207428_100317304 161
185 3300028379 Ga0268266_10382299 Ga0268266_103822992 161
186 3300028381 Ga0268264_10290744 Ga0268264_102907443 161
187 3300031235 Ga0265330_10132480 Ga0265330_101324802 161
188 3300031548 Ga0307408_100500922 Ga0307408_1005009222 161
189 3300031711 Ga0265314_10173024 Ga0265314_101730242 161
190 3300031731 Ga0307405_10373332 Ga0307405_103733321 161
191 3300031731 Ga0307405_10565445 Ga0307405_105654452 161
192 3300031731 Ga0307405_10623282 Ga0307405_106232822 161
193 3300031903 Ga0307407_10375176 Ga0307407_103751762 161
194 3300032002 Ga0307416_100062469 Ga0307416_1000624694 161
195 3300032002 Ga0307416_100062665 Ga0307416_1000626654 161
196 3300032002 Ga0307416_100078505 Ga0307416_1000785054 161
197 3300032002 Ga0307416_100204324 Ga0307416_1002043243 161
198 3300032002 Ga0307416_100332727 Ga0307416_1003327273 161
199 3300035691 Ga0373931_0020315 Ga0373931_0020315_2350_2835 161
200 3300035692 Ga0373935_0247797 Ga0373935_0247797_572_1057 161
201 3300035725 Ga0373947_0393009 Ga0373947_0393009_138_623 161
202 3300037068 Ga0373925_0165351 Ga0373925_0165351_498_983 161
203 3300041459 Ga0451800_1480898 Ga0451800_1480898_15_500 161
204 3300042001 Ga0439441_004084 Ga0439441_004084_1138_1623 161
205 3300046477 Ga0495664_0165966 Ga0495664_0165966_338_823 161
206 3300046537 Ga0495598_0016777 Ga0495598_0016777_515_1000 161
207 3300046537 Ga0495598_0145235 Ga0495598_0145235_36_521 161
208 3300049571 Ga0501034_0134246 Ga0501034_0134246_666_1151 161
209 3300049573 Ga0501037_0438549 Ga0501037_0438549_357_842 161
210 3300049581 Ga0501047_0955315 Ga0501047_0955315_17_502 161
211 3300049583 Ga0501067_0111774 Ga0501067_0111774_211_696 161
212 3300049584 Ga0501068_0023728 Ga0501068_0023728_861_1346 161
213 3300049585 Ga0501069_0000753 Ga0501069_0000753_12977_13462 161
214 3300049586 Ga0501070_0007363 Ga0501070_0007363_7085_7570 161
215 3300049589 Ga0501073_0037060 Ga0501073_0037060_952_1437 161
216 3300049589 Ga0501073_0603407 Ga0501073_0603407_247_732 161
217 3300049741 Ga0501079_0216371 Ga0501079_0216371_935_1420 161
218 3300049742 Ga0501080_0159520 Ga0501080_0159520_155_640 161
219 3300049744 Ga0501083_0000417 Ga0501083_0000417_24967_25452 161
220 3300049822 Ga0501035_0332630 Ga0501035_0332630_60_545 161
221 3300050493 nmdc:mga0k408_87996_c1 nmdc:mga0k408_87996_c1_819_1313 161
222 3300050496 nmdc:mga07m45_110685_c1 nmdc:mga07m45_110685_c1_326_811 161
223 3300050511 nmdc:mga08y16_147_c1 nmdc:mga08y16_147_c1_30184_30669 161
224 3300050513 nmdc:mga0rr50_487437_c1 nmdc:mga0rr50_487437_c1_239_724 161
225 3300050514 nmdc:mga08x19_617537_c1 nmdc:mga08x19_617537_c1_200_685 161
226 3300054114 Ga0501084_0630158 Ga0501084_0630158_394_879 161
227 3300060353 Ga0501082_0072057 Ga0501082_0072057_1383_1868 161
228 3300005330 Ga0070690_100229452 Ga0070690_1002294523 162
229 3300005438 Ga0070701_10307315 Ga0070701_103073151 162
230 3300005440 Ga0070705_100703303 Ga0070705_1007033031 162
231 3300005441 Ga0070700_100101524 Ga0070700_1001015242 162
232 3300005578 Ga0068854_100381360 Ga0068854_1003813602 162
233 3300005615 Ga0070702_100221660 Ga0070702_1002216602 162
234 3300005842 Ga0068858_100001245 Ga0068858_1000012454 162
235 3300005843 Ga0068860_100306951 Ga0068860_1003069512 162
236 3300009093 Ga0105240_10352932 Ga0105240_103529322 162
237 3300009176 Ga0105242_10003935 Ga0105242_100039354 162
238 3300009177 Ga0105248_10144939 Ga0105248_101449393 162
239 3300013306 Ga0163162_10014658 Ga0163162_100146583 162
240 3300014326 Ga0157380_10329629 Ga0157380_103296292 162
241 3300014968 Ga0157379_10052682 Ga0157379_100526826 162
242 3300017792 Ga0163161_10413637 Ga0163161_104136372 162
243 3300025934 Ga0207686_10011878 Ga0207686_100118784 162
244 3300025935 Ga0207709_10413442 Ga0207709_104134422 162
245 3300025949 Ga0207667_10117745 Ga0207667_101177452 162
246 3300026035 Ga0207703_10007533 Ga0207703_100075337 162
247 3300031731 Ga0307405_10201185 Ga0307405_102011852 162
248 3300032002 Ga0307416_103453854 Ga0307416_1034538541 162
249 3300035085 Ga0373929_0032315 Ga0373929_0032315_516_1004 162
250 3300037471 Ga0395905_0014552 Ga0395905_0014552_6603_7091 162
251 3300042876 Ga0451577_0203621 Ga0451577_0203621_452_1048 162
252 3300042876 Ga0451577_0538410 Ga0451577_0538410_366_854 162
253 3300045051 Ga0451576_0293850 Ga0451576_0293850_68_556 162
254 3300045051 Ga0451576_0743300 Ga0451576_0743300_97_585 162
255 3300046681 Ga0495647_0153108 Ga0495647_0153108_210_698 162
256 3300005327 Ga0070658_10034866 Ga0070658_100348662 163
257 3300005366 Ga0070659_100048551 Ga0070659_1000485513 163
258 3300005435 Ga0070714_100207915 Ga0070714_1002079152 163
259 3300005436 Ga0070713_100506504 Ga0070713_1005065042 163
260 3300005530 Ga0070679_100019541 Ga0070679_1000195417 163
261 3300005530 Ga0070679_100553736 Ga0070679_1005537362 163
262 3300005539 Ga0068853_101032702 Ga0068853_1010327022 163
263 3300005563 Ga0068855_100090735 Ga0068855_1000907352 163
264 3300005564 Ga0070664_101033240 Ga0070664_1010332401 163
265 3300005614 Ga0068856_100269408 Ga0068856_1002694083 163
266 3300005616 Ga0068852_100001932 Ga0068852_1000019329 163
267 3300005616 Ga0068852_100030794 Ga0068852_1000307944 163
268 3300009093 Ga0105240_11006117 Ga0105240_110061172 163
269 3300009551 Ga0105238_10121633 Ga0105238_101216333 163
270 3300009551 Ga0105238_10640332 Ga0105238_106403322 163
271 3300013102 Ga0157371_10322834 Ga0157371_103228342 163
272 3300013105 Ga0157369_10002433 Ga0157369_1000243310 163
273 3300013105 Ga0157369_10521720 Ga0157369_105217201 163
274 3300013307 Ga0157372_10007773 Ga0157372_1000777310 163
275 3300013307 Ga0157372_10396243 Ga0157372_103962432 163
276 3300025898 Ga0207692_10277001 Ga0207692_102770012 163
277 3300025909 Ga0207705_10198760 Ga0207705_101987602 163
278 3300025916 Ga0207663_10199028 Ga0207663_101990282 163
279 3300025919 Ga0207657_10162461 Ga0207657_101624612 163
280 3300025921 Ga0207652_10023249 Ga0207652_100232495 163
281 3300025924 Ga0207694_10226755 Ga0207694_102267553 163
282 3300025928 Ga0207700_10211929 Ga0207700_102119292 163
283 3300025949 Ga0207667_10199796 Ga0207667_101997963 163
284 3300026041 Ga0207639_10013242 Ga0207639_100132426 163
285 3300026078 Ga0207702_10856353 Ga0207702_108563532 163
286 3300026142 Ga0207698_10002880 Ga0207698_1000288012 163
287 3300039437 Ga0436365_0216233 Ga0436365_0216233_110_601 163
288 3300014968 Ga0157379_10892330 Ga0157379_108923302 164
289 3300031548 Ga0307408_100166328 Ga0307408_1001663282 164
290 3300031852 Ga0307410_10019022 Ga0307410_100190222 164
291 3300031901 Ga0307406_10009272 Ga0307406_100092722 164
292 3300031911 Ga0307412_10029557 Ga0307412_100295575 164
293 3300031995 Ga0307409_100004693 Ga0307409_1000046936 164
294 3300031995 Ga0307409_100009430 Ga0307409_1000094305 164
295 3300032002 Ga0307416_100554033 Ga0307416_1005540332 164
296 3300042126 Ga0450888_023439 Ga0450888_023439_169_675 164
297 3300027471 Ga0209995_1028536 Ga0209995_10285362 165
298 3300046543 Ga0495645_0522947 Ga0495645_0522947_158_655 165
299 3300005340 Ga0070689_100139675 Ga0070689_1001396753 167
300 3300005365 Ga0070688_101086103 Ga0070688_1010861031 167
301 3300005719 Ga0068861_100533216 Ga0068861_1005332162 167
302 3300025936 Ga0207670_10137368 Ga0207670_101373682 167
303 3300026118 Ga0207675_100403418 Ga0207675_1004034182 167
304 3300006237 Ga0097621_100067031 Ga0097621_1000670314 172
305 3300009176 Ga0105242_10008702 Ga0105242_100087022 172
306 3300013297 Ga0157378_10222259 Ga0157378_102222592 172
307 3300025934 Ga0207686_10013937 Ga0207686_100139372 172
308 3300005290 Ga0065712_10087029 Ga0065712_100870292 173
309 3300005354 Ga0070675_100111441 Ga0070675_1001114413 173

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01782

RimM

RimM N-terminal domain

36

118

0.97

PF05239

PRC

PRC-barrel domain

124

196

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dog-assembly1.cif.gz_A solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 0.8113 1 87
7cq1-assembly1.cif.gz_A solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm 0.7917 90 172
5ode-assembly1.cif.gz_B structure of a novel oxidoreductase from gloeobacter violaceus 0.7902 110 147
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.7865 1 173
3a1p-assembly2.cif.gz_C structure of ribosome maturation protein rimm and ribosomal protein s19 0.765 1 173
ID Description Score Start End Superfamily
2f1lA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.9096 1 85 2.40.30.60
3h9nA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM 0.8861 2 81 2.40.30.60
af_Q2FZ44_92_167_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8803 86 173 2.30.30.240
af_P0A7X6_101_182_2.30.30.240 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8757 86 169 2.30.30.240
2f1lA02 Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain 0.8751 91 170 2.30.30.240
ID Description Score Start End GO Terms
AF-Q8PMY2-F1-model_v4 Ribosome maturation factor RimM 0.8827 1 170 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A3N5GXM5-F1-model_v4 Ribosome maturation factor RimM 0.8553 2 171 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022
AF-A0A1Q3YTX5-F1-model_v4 deleted 0.8423 2 168
AF-A0A3B1C6H7-F1-model_v4 16S rRNA processing protein RimM 0.839 1 171 GO:0005737
GO:0005840
GO:0006364
GO:0043022
AF-A0A7C4VS91-F1-model_v4 Ribosome maturation factor RimM 0.8337 2 170 GO:0005737
GO:0005840
GO:0006364
GO:0042274
GO:0043022

Feature Viewer

pLDDT pTM Quality
91.32 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map