F400070
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 191 | 309 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100048551|Ga0070659_1000485513 |
| Length | 199 |
| Sequence | VARLKRPASSPRPPSNPSSLDRVARPFAGDASRLVVMGRIAGSFGVKGWVKVKPFSEKEDALAGHDTWVVRTRDGWREMDLEDFEVHAKGPVAKLAGSDAREVSDALRGADVAVAREALGEAEEGSLYQVDLIGLDVVEEDGSLLGRVDGFFDAGETSVMVVAGADGRERLVPFVADFVKSVDREAKRVTVDWKAEYDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 135 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 138 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 143 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 146 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 147 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 150 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 151 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 152 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 1.29 |
| Rhizosphere | 95.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10087029 | 3300005290 | Bacteria | 2602 |
| 2 | Ga0065715_10305865 | 3300005293 | Bacteria | 1031 |
| 3 | Ga0065707_10081966 | 3300005295 | Bacteria | 26944 |
| 4 | Ga0070658_10034866 | 3300005327 | Bacteria | 4050 |
| 5 | Ga0070658_10125903 | 3300005327 | Bacteria | 2133 |
| 6 | Ga0070676_10388159 | 3300005328 | Bacteria | 968 |
| 7 | Ga0070683_100274466 | 3300005329 | Bacteria | 1604 |
| 8 | Ga0070690_100103876 | 3300005330 | Bacteria | 1887 |
| 9 | Ga0070690_100229452 | 3300005330 | Bacteria | 1305 |
| 10 | Ga0070690_101081895 | 3300005330 | Unclassified | 635 |
| 11 | Ga0070677_10143289 | 3300005333 | Bacteria | 1104 |
| 12 | Ga0068869_100076173 | 3300005334 | Bacteria | 2493 |
| 13 | Ga0068869_100162596 | 3300005334 | Bacteria | 1739 |
| 14 | Ga0070680_100293661 | 3300005336 | Bacteria | 1378 |
| 15 | Ga0070682_100153348 | 3300005337 | Bacteria | 1583 |
| 16 | Ga0070689_100072468 | 3300005340 | Bacteria | 2692 |
| 17 | Ga0070689_100139675 | 3300005340 | Bacteria | 1948 |
| 18 | Ga0070687_100081613 | 3300005343 | Bacteria | 1766 |
| 19 | Ga0070661_100267697 | 3300005344 | Bacteria | 1322 |
| 20 | Ga0070692_10145958 | 3300005345 | Bacteria | 1343 |
| 21 | Ga0070669_100087263 | 3300005353 | Bacteria | 2332 |
| 22 | Ga0070675_100009662 | 3300005354 | Bacteria | 7508 |
| 23 | Ga0070675_100025029 | 3300005354 | Bacteria | 4784 |
| 24 | Ga0070675_100111441 | 3300005354 | Bacteria | 2316 |
| 25 | Ga0070671_100339576 | 3300005355 | Bacteria | 1281 |
| 26 | Ga0070674_101117493 | 3300005356 | Bacteria | 696 |
| 27 | Ga0070673_100043585 | 3300005364 | Bacteria | 3468 |
| 28 | Ga0070673_100097728 | 3300005364 | Bacteria | 2412 |
| 29 | Ga0070673_100485447 | 3300005364 | Unclassified | 1116 |
| 30 | Ga0070673_101352756 | 3300005364 | Bacteria | 669 |
| 31 | Ga0070688_100036289 | 3300005365 | Bacteria | 2997 |
| 32 | Ga0070688_101086103 | 3300005365 | Unclassified | 639 |
| 33 | Ga0070659_100048551 | 3300005366 | Bacteria | 3335 |
| 34 | Ga0070714_100107247 | 3300005435 | Bacteria | 2468 |
| 35 | Ga0070714_100207915 | 3300005435 | Bacteria | 1793 |
| 36 | Ga0070713_100506504 | 3300005436 | Bacteria | 1140 |
| 37 | Ga0070701_10006208 | 3300005438 | Bacteria | 5012 |
| 38 | Ga0070701_10096928 | 3300005438 | Bacteria | 1626 |
| 39 | Ga0070701_10307315 | 3300005438 | Bacteria | 977 |
| 40 | Ga0070711_100833710 | 3300005439 | Bacteria | 784 |
| 41 | Ga0070705_100211968 | 3300005440 | Bacteria | 1336 |
| 42 | Ga0070705_100703303 | 3300005440 | Bacteria | 794 |
| 43 | Ga0070700_100101524 | 3300005441 | Bacteria | 1896 |
| 44 | Ga0070663_100410664 | 3300005455 | Bacteria | 1109 |
| 45 | Ga0070678_100736845 | 3300005456 | Bacteria | 890 |
| 46 | Ga0070681_10007545 | 3300005458 | Bacteria | 10628 |
| 47 | Ga0070681_10012364 | 3300005458 | Bacteria | 8464 |
| 48 | Ga0070681_10380919 | 3300005458 | Bacteria | 1321 |
| 49 | Ga0068867_100392422 | 3300005459 | Bacteria | 1168 |
| 50 | Ga0068867_100664870 | 3300005459 | Bacteria | 915 |
| 51 | Ga0068867_100706173 | 3300005459 | Bacteria | 890 |
| 52 | Ga0070699_100514869 | 3300005518 | Bacteria | 1087 |
| 53 | Ga0070699_100568278 | 3300005518 | Bacteria | 1033 |
| 54 | Ga0070679_100019541 | 3300005530 | Bacteria | 6591 |
| 55 | Ga0070679_100553736 | 3300005530 | Bacteria | 1094 |
| 56 | Ga0070679_100717600 | 3300005530 | Bacteria | 942 |
| 57 | Ga0070679_100899850 | 3300005530 | Bacteria | 828 |
| 58 | Ga0070684_100354106 | 3300005535 | Bacteria | 1350 |
| 59 | Ga0070697_101077270 | 3300005536 | Unclassified | 715 |
| 60 | Ga0068853_100024287 | 3300005539 | Bacteria | 5081 |
| 61 | Ga0068853_100029946 | 3300005539 | Bacteria | 4593 |
| 62 | Ga0068853_101032702 | 3300005539 | Bacteria | 792 |
| 63 | Ga0070672_100222223 | 3300005543 | Bacteria | 1584 |
| 64 | Ga0070696_100153404 | 3300005546 | Bacteria | 1692 |
| 65 | Ga0070693_100000865 | 3300005547 | Bacteria | 13507 |
| 66 | Ga0070693_100080520 | 3300005547 | Bacteria | 1940 |
| 67 | Ga0070693_100122692 | 3300005547 | Bacteria | 1613 |
| 68 | Ga0070665_100353032 | 3300005548 | Bacteria | 1476 |
| 69 | Ga0068855_100017780 | 3300005563 | Bacteria | 8547 |
| 70 | Ga0068855_100090735 | 3300005563 | Bacteria | 3525 |
| 71 | Ga0068855_100120702 | 3300005563 | Bacteria | 3000 |
| 72 | Ga0068855_100145068 | 3300005563 | Bacteria | 2703 |
| 73 | Ga0068855_101026066 | 3300005563 | Bacteria | 865 |
| 74 | Ga0070664_101033240 | 3300005564 | Bacteria | 773 |
| 75 | Ga0068854_100381360 | 3300005578 | Bacteria | 1162 |
| 76 | Ga0068856_100025504 | 3300005614 | Bacteria | 5765 |
| 77 | Ga0068856_100269408 | 3300005614 | Bacteria | 1719 |
| 78 | Ga0070702_100166065 | 3300005615 | Bacteria | 1431 |
| 79 | Ga0070702_100221660 | 3300005615 | Bacteria | 1265 |
| 80 | Ga0068852_100001932 | 3300005616 | Bacteria | 14116 |
| 81 | Ga0068852_100030794 | 3300005616 | Bacteria | 4421 |
| 82 | Ga0068859_100020233 | 3300005617 | Bacteria | 6681 |
| 83 | Ga0068859_100108748 | 3300005617 | Bacteria | 2833 |
| 84 | Ga0068861_100065962 | 3300005719 | Bacteria | 2790 |
| 85 | Ga0068861_100170109 | 3300005719 | Bacteria | 1805 |
| 86 | Ga0068861_100533216 | 3300005719 | Bacteria | 1067 |
| 87 | Ga0068851_10381603 | 3300005834 | Bacteria | 826 |
| 88 | Ga0068870_10167808 | 3300005840 | Bacteria | 1307 |
| 89 | Ga0068858_100001245 | 3300005842 | Bacteria | 26312 |
| 90 | Ga0068860_100306951 | 3300005843 | Bacteria | 1556 |
| 91 | Ga0068860_100371533 | 3300005843 | Bacteria | 1410 |
| 92 | Ga0081539_10173373 | 3300005985 | Bacteria | 1017 |
| 93 | Ga0075367_10163269 | 3300006178 | Bacteria | 1385 |
| 94 | Ga0075366_10007389 | 3300006195 | Bacteria | 6066 |
| 95 | Ga0075366_10117459 | 3300006195 | Bacteria | 1602 |
| 96 | Ga0097621_100041056 | 3300006237 | Bacteria | 3722 |
| 97 | Ga0097621_100067031 | 3300006237 | Bacteria | 2958 |
| 98 | Ga0097621_100721742 | 3300006237 | Bacteria | 919 |
| 99 | Ga0075370_10071686 | 3300006353 | Bacteria | 1982 |
| 100 | Ga0068871_100031636 | 3300006358 | Bacteria | 4174 |
| 101 | Ga0068871_100097175 | 3300006358 | Bacteria | 2461 |
| 102 | Ga0068865_100197152 | 3300006881 | Bacteria | 1561 |
| 103 | Ga0068865_100661726 | 3300006881 | Bacteria | 889 |
| 104 | Ga0075436_100848747 | 3300006914 | Bacteria | 682 |
| 105 | Ga0097620_100020233 | 3300006931 | Bacteria | 6681 |
| 106 | Ga0097620_100108746 | 3300006931 | Bacteria | 2833 |
| 107 | Ga0105240_10213958 | 3300009093 | Bacteria | 2250 |
| 108 | Ga0105240_10352932 | 3300009093 | Bacteria | 1668 |
| 109 | Ga0105240_10375460 | 3300009093 | Bacteria | 1607 |
| 110 | Ga0105240_11006117 | 3300009093 | Bacteria | 891 |
| 111 | Ga0111539_10000774 | 3300009094 | Bacteria | 41587 |
| 112 | Ga0105245_10183781 | 3300009098 | Bacteria | 1999 |
| 113 | Ga0105245_10438308 | 3300009098 | Bacteria | 1313 |
| 114 | Ga0105245_10685688 | 3300009098 | Bacteria | 1057 |
| 115 | Ga0105245_10842797 | 3300009098 | Bacteria | 956 |
| 116 | Ga0105243_11046145 | 3300009148 | Bacteria | 822 |
| 117 | Ga0105241_10117561 | 3300009174 | Bacteria | 2137 |
| 118 | Ga0105241_10128079 | 3300009174 | Bacteria | 2052 |
| 119 | Ga0105241_10141099 | 3300009174 | Bacteria | 1962 |
| 120 | Ga0105241_10623960 | 3300009174 | Bacteria | 976 |
| 121 | Ga0105242_10003935 | 3300009176 | Bacteria | 11546 |
| 122 | Ga0105242_10008702 | 3300009176 | Bacteria | 7787 |
| 123 | Ga0105242_10295194 | 3300009176 | Bacteria | 1477 |
| 124 | Ga0105248_10019213 | 3300009177 | Bacteria | 7559 |
| 125 | Ga0105248_10144939 | 3300009177 | Bacteria | 2680 |
| 126 | Ga0105237_10038124 | 3300009545 | Bacteria | 4855 |
| 127 | Ga0105238_10121633 | 3300009551 | Bacteria | 2590 |
| 128 | Ga0105238_10315167 | 3300009551 | Bacteria | 1549 |
| 129 | Ga0105238_10640332 | 3300009551 | Bacteria | 1073 |
| 130 | Ga0105249_10110697 | 3300009553 | Bacteria | 2595 |
| 131 | Ga0105249_11025511 | 3300009553 | Bacteria | 894 |
| 132 | Ga0105239_10014722 | 3300010375 | Bacteria | 8674 |
| 133 | Ga0157371_10322834 | 3300013102 | Bacteria | 1121 |
| 134 | Ga0157370_10003796 | 3300013104 | Bacteria | 17624 |
| 135 | Ga0157370_10558479 | 3300013104 | Bacteria | 1049 |
| 136 | Ga0157369_10002433 | 3300013105 | Bacteria | 22368 |
| 137 | Ga0157369_10521720 | 3300013105 | Bacteria | 1229 |
| 138 | Ga0157378_10041432 | 3300013297 | Bacteria | 4084 |
| 139 | Ga0157378_10222259 | 3300013297 | Bacteria | 1796 |
| 140 | Ga0163162_10014658 | 3300013306 | Bacteria | 7660 |
| 141 | Ga0163162_10484188 | 3300013306 | Bacteria | 1369 |
| 142 | Ga0157372_10007773 | 3300013307 | Bacteria | 11387 |
| 143 | Ga0157372_10045690 | 3300013307 | Bacteria | 4859 |
| 144 | Ga0157372_10396243 | 3300013307 | Bacteria | 1609 |
| 145 | Ga0157372_10922843 | 3300013307 | Bacteria | 1012 |
| 146 | Ga0157372_11295391 | 3300013307 | Bacteria | 841 |
| 147 | Ga0163163_11052229 | 3300014325 | Bacteria | 877 |
| 148 | Ga0157380_10001358 | 3300014326 | Bacteria | 15941 |
| 149 | Ga0157380_10064327 | 3300014326 | Bacteria | 2944 |
| 150 | Ga0157380_10165538 | 3300014326 | Bacteria | 1926 |
| 151 | Ga0157380_10187176 | 3300014326 | Bacteria | 1824 |
| 152 | Ga0157380_10329629 | 3300014326 | Bacteria | 1419 |
| 153 | Ga0157377_10048944 | 3300014745 | Bacteria | 2374 |
| 154 | Ga0157377_10111103 | 3300014745 | Bacteria | 1647 |
| 155 | Ga0157379_10052682 | 3300014968 | Bacteria | 3635 |
| 156 | Ga0157379_10340139 | 3300014968 | Bacteria | 1372 |
| 157 | Ga0157379_10892330 | 3300014968 | Bacteria | 843 |
| 158 | Ga0163161_10413637 | 3300017792 | Bacteria | 1083 |
| 159 | Ga0207656_10196242 | 3300025321 | Bacteria | 974 |
| 160 | Ga0207682_10032817 | 3300025893 | Bacteria | 2087 |
| 161 | Ga0207692_10277001 | 3300025898 | Bacteria | 1014 |
| 162 | Ga0207643_10026396 | 3300025908 | Bacteria | 3215 |
| 163 | Ga0207705_10198760 | 3300025909 | Bacteria | 1519 |
| 164 | Ga0207654_10039013 | 3300025911 | Bacteria | 2668 |
| 165 | Ga0207654_10234177 | 3300025911 | Bacteria | 1224 |
| 166 | Ga0207654_10528593 | 3300025911 | Bacteria | 836 |
| 167 | Ga0207695_10010633 | 3300025913 | Bacteria | 11243 |
| 168 | Ga0207671_10056936 | 3300025914 | Bacteria | 2897 |
| 169 | Ga0207663_10199028 | 3300025916 | Bacteria | 1444 |
| 170 | Ga0207663_10726255 | 3300025916 | Bacteria | 788 |
| 171 | Ga0207662_10020061 | 3300025918 | Bacteria | 3812 |
| 172 | Ga0207657_10162461 | 3300025919 | Bacteria | 1814 |
| 173 | Ga0207652_10020780 | 3300025921 | Bacteria | 5410 |
| 174 | Ga0207652_10020872 | 3300025921 | Bacteria | 5400 |
| 175 | Ga0207652_10023249 | 3300025921 | Bacteria | 5133 |
| 176 | Ga0207652_10780605 | 3300025921 | Bacteria | 849 |
| 177 | Ga0207681_10241955 | 3300025923 | Bacteria | 1405 |
| 178 | Ga0207694_10091477 | 3300025924 | Bacteria | 2401 |
| 179 | Ga0207694_10226755 | 3300025924 | Bacteria | 1525 |
| 180 | Ga0207659_10055239 | 3300025926 | Bacteria | 2839 |
| 181 | Ga0207659_10234981 | 3300025926 | Bacteria | 1480 |
| 182 | Ga0207700_10211929 | 3300025928 | Bacteria | 1638 |
| 183 | Ga0207664_10043246 | 3300025929 | Bacteria | 3522 |
| 184 | Ga0207664_10111926 | 3300025929 | Bacteria | 2272 |
| 185 | Ga0207686_10011878 | 3300025934 | Bacteria | 4780 |
| 186 | Ga0207686_10013937 | 3300025934 | Bacteria | 4461 |
| 187 | Ga0207709_10413442 | 3300025935 | Bacteria | 1034 |
| 188 | Ga0207670_10079239 | 3300025936 | Bacteria | 2293 |
| 189 | Ga0207670_10137368 | 3300025936 | Bacteria | 1799 |
| 190 | Ga0207691_10007747 | 3300025940 | Bacteria | 10338 |
| 191 | Ga0207689_10076475 | 3300025942 | Bacteria | 2752 |
| 192 | Ga0207689_10098902 | 3300025942 | Bacteria | 2397 |
| 193 | Ga0207661_10766865 | 3300025944 | Bacteria | 888 |
| 194 | Ga0207667_10006138 | 3300025949 | Bacteria | 14599 |
| 195 | Ga0207667_10048883 | 3300025949 | Bacteria | 4471 |
| 196 | Ga0207667_10108258 | 3300025949 | Bacteria | 2868 |
| 197 | Ga0207667_10117745 | 3300025949 | Bacteria | 2738 |
| 198 | Ga0207667_10199796 | 3300025949 | Bacteria | 2051 |
| 199 | Ga0207667_10295258 | 3300025949 | Bacteria | 1656 |
| 200 | Ga0207651_10059756 | 3300025960 | Bacteria | 2643 |
| 201 | Ga0207712_10752995 | 3300025961 | Bacteria | 853 |
| 202 | Ga0207668_10756367 | 3300025972 | Bacteria | 858 |
| 203 | Ga0207640_10263708 | 3300025981 | Bacteria | 1344 |
| 204 | Ga0207677_10736485 | 3300026023 | Bacteria | 877 |
| 205 | Ga0207703_10007533 | 3300026035 | Bacteria | 8636 |
| 206 | Ga0207703_10386722 | 3300026035 | Bacteria | 1295 |
| 207 | Ga0207639_10009851 | 3300026041 | Bacteria | 6600 |
| 208 | Ga0207639_10013242 | 3300026041 | Bacteria | 5766 |
| 209 | Ga0207639_10501399 | 3300026041 | Bacteria | 1109 |
| 210 | Ga0207678_10735976 | 3300026067 | Bacteria | 869 |
| 211 | Ga0207708_10432736 | 3300026075 | Bacteria | 1093 |
| 212 | Ga0207702_10022743 | 3300026078 | Bacteria | 5200 |
| 213 | Ga0207702_10856353 | 3300026078 | Bacteria | 900 |
| 214 | Ga0207648_10450512 | 3300026089 | Bacteria | 1172 |
| 215 | Ga0207648_10679335 | 3300026089 | Bacteria | 953 |
| 216 | Ga0207676_10311896 | 3300026095 | Bacteria | 1441 |
| 217 | Ga0207674_10022838 | 3300026116 | Bacteria | 6712 |
| 218 | Ga0207675_100004064 | 3300026118 | Bacteria | 14163 |
| 219 | Ga0207675_100403418 | 3300026118 | Bacteria | 1347 |
| 220 | Ga0207683_10037803 | 3300026121 | Bacteria | 4205 |
| 221 | Ga0207698_10002880 | 3300026142 | Bacteria | 10291 |
| 222 | Ga0207698_10333471 | 3300026142 | Bacteria | 1426 |
| 223 | Ga0209995_1028536 | 3300027471 | Bacteria | 932 |
| 224 | Ga0207428_10031730 | 3300027907 | Bacteria | 4354 |
| 225 | Ga0268266_10382299 | 3300028379 | Bacteria | 1328 |
| 226 | Ga0268266_11230916 | 3300028379 | Unclassified | 724 |
| 227 | Ga0268265_10417611 | 3300028380 | Bacteria | 1245 |
| 228 | Ga0268264_10290744 | 3300028381 | Bacteria | 1535 |
| 229 | Ga0265330_10132480 | 3300031235 | Bacteria | 1061 |
| 230 | Ga0307408_100166328 | 3300031548 | Bacteria | 1757 |
| 231 | Ga0307408_100500922 | 3300031548 | Bacteria | 1063 |
| 232 | Ga0265314_10173024 | 3300031711 | Bacteria | 1301 |
| 233 | Ga0307405_10201185 | 3300031731 | Bacteria | 1447 |
| 234 | Ga0307405_10373332 | 3300031731 | Bacteria | 1108 |
| 235 | Ga0307405_10565445 | 3300031731 | Bacteria | 922 |
| 236 | Ga0307405_10623282 | 3300031731 | Bacteria | 883 |
| 237 | Ga0307413_10405581 | 3300031824 | Bacteria | 1069 |
| 238 | Ga0307410_10019022 | 3300031852 | Bacteria | 4167 |
| 239 | Ga0307406_10009272 | 3300031901 | Bacteria | 5516 |
| 240 | Ga0307407_10375176 | 3300031903 | Bacteria | 1014 |
| 241 | Ga0307412_10029557 | 3300031911 | Bacteria | 3441 |
| 242 | Ga0307409_100004693 | 3300031995 | Bacteria | 7735 |
| 243 | Ga0307409_100009430 | 3300031995 | Bacteria | 5995 |
| 244 | Ga0307416_100062469 | 3300032002 | Bacteria | 3046 |
| 245 | Ga0307416_100062665 | 3300032002 | Bacteria | 3042 |
| 246 | Ga0307416_100078505 | 3300032002 | Bacteria | 2778 |
| 247 | Ga0307416_100204324 | 3300032002 | Bacteria | 1878 |
| 248 | Ga0307416_100332727 | 3300032002 | Bacteria | 1527 |
| 249 | Ga0307416_100554033 | 3300032002 | Bacteria | 1223 |
| 250 | Ga0307416_103453854 | 3300032002 | Unclassified | 529 |
| 251 | Ga0373928_0023987 | 3300035084 | Bacteria | 1305 |
| 252 | Ga0373929_0032315 | 3300035085 | Bacteria | 1125 |
| 253 | Ga0373931_0020315 | 3300035691 | Bacteria | 3322 |
| 254 | Ga0373935_0247797 | 3300035692 | Bacteria | 1246 |
| 255 | Ga0373933_0419777 | 3300035724 | Bacteria | 874 |
| 256 | Ga0373947_0393009 | 3300035725 | Bacteria | 935 |
| 257 | Ga0373925_0165351 | 3300037068 | Bacteria | 1744 |
| 258 | Ga0395905_0014552 | 3300037471 | Bacteria | 7506 |
| 259 | Ga0436365_0216233 | 3300039437 | Bacteria | 883 |
| 260 | Ga0451800_1480898 | 3300041459 | Bacteria | 595 |
| 261 | Ga0439441_004084 | 3300042001 | Bacteria | 2192 |
| 262 | Ga0450888_023439 | 3300042126 | Unclassified | 797 |
| 263 | Ga0451577_0203621 | 3300042876 | Bacteria | 1787 |
| 264 | Ga0451577_0538410 | 3300042876 | Unclassified | 1060 |
| 265 | Ga0466961_0165715 | 3300044693 | Bacteria | 1376 |
| 266 | Ga0466957_0035519 | 3300044842 | Bacteria | 2991 |
| 267 | Ga0451576_0293850 | 3300045051 | Bacteria | 1699 |
| 268 | Ga0451576_0743300 | 3300045051 | Bacteria | 1030 |
| 269 | Ga0466958_0021170 | 3300045836 | Bacteria | 3797 |
| 270 | Ga0495638_0024258 | 3300046460 | Bacteria | 3957 |
| 271 | Ga0495664_0165966 | 3300046477 | Bacteria | 1340 |
| 272 | Ga0495598_0016777 | 3300046537 | Bacteria | 1876 |
| 273 | Ga0495598_0145235 | 3300046537 | Bacteria | 824 |
| 274 | Ga0495621_0010410 | 3300046539 | Bacteria | 2844 |
| 275 | Ga0495645_0522947 | 3300046543 | Bacteria | 739 |
| 276 | Ga0495625_0001706 | 3300046660 | Bacteria | 25551 |
| 277 | Ga0495647_0153108 | 3300046681 | Bacteria | 990 |
| 278 | Ga0495658_0200388 | 3300046683 | Bacteria | 1244 |
| 279 | Ga0495672_0121016 | 3300047320 | Bacteria | 1391 |
| 280 | Ga0496101_0570592 | 3300048904 | Bacteria | 895 |
| 281 | Ga0496110_0098468 | 3300048913 | Bacteria | 2621 |
| 282 | Ga0496114_0390208 | 3300048917 | Bacteria | 1233 |
| 283 | Ga0496118_0157558 | 3300048921 | Bacteria | 1410 |
| 284 | Ga0496121_0349423 | 3300048924 | Bacteria | 985 |
| 285 | Ga0501034_0134246 | 3300049571 | Bacteria | 2457 |
| 286 | Ga0501034_0590941 | 3300049571 | Bacteria | 1016 |
| 287 | Ga0501037_0438549 | 3300049573 | Bacteria | 892 |
| 288 | Ga0501047_0955315 | 3300049581 | Unclassified | 670 |
| 289 | Ga0501067_0111774 | 3300049583 | Bacteria | 1519 |
| 290 | Ga0501068_0023728 | 3300049584 | Bacteria | 3597 |
| 291 | Ga0501069_0000753 | 3300049585 | Bacteria | 15120 |
| 292 | Ga0501069_0074070 | 3300049585 | Bacteria | 1910 |
| 293 | Ga0501070_0007363 | 3300049586 | Bacteria | 9344 |
| 294 | Ga0501073_0037060 | 3300049589 | Bacteria | 3464 |
| 295 | Ga0501073_0603407 | 3300049589 | Bacteria | 758 |
| 296 | Ga0501079_0216371 | 3300049741 | Bacteria | 1496 |
| 297 | Ga0501080_0159520 | 3300049742 | Bacteria | 2083 |
| 298 | Ga0501083_0000417 | 3300049744 | Bacteria | 27243 |
| 299 | Ga0501035_0332630 | 3300049822 | Bacteria | 1274 |
| 300 | nmdc:mga0k408_87996_c1 | 3300050493 | Bacteria | 1824 |
| 301 | nmdc:mga07m45_110685_c1 | 3300050496 | Bacteria | 969 |
| 302 | nmdc:mga0qj67_548916_c1 | 3300050509 | Bacteria | 927 |
| 303 | nmdc:mga08y16_147_c1 | 3300050511 | Bacteria | 61021 |
| 304 | nmdc:mga0rr50_26825_c1 | 3300050513 | Bacteria | 4027 |
| 305 | nmdc:mga0rr50_487437_c1 | 3300050513 | Bacteria | 1047 |
| 306 | nmdc:mga08x19_617537_c1 | 3300050514 | Bacteria | 768 |
| 307 | nmdc:mga08x19_98727_c1 | 3300050514 | Bacteria | 1935 |
| 308 | Ga0501084_0630158 | 3300054114 | Bacteria | 905 |
| 309 | Ga0501082_0072057 | 3300060353 | Bacteria | 2976 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0200388 | Ga0495658_0200388_321_770 | 149 |
| 2 | 3300026023 | Ga0207677_10736485 | Ga0207677_107364852 | 152 |
| 3 | 3300005343 | Ga0070687_100081613 | Ga0070687_1000816132 | 153 |
| 4 | 3300005355 | Ga0070671_100339576 | Ga0070671_1003395763 | 153 |
| 5 | 3300005364 | Ga0070673_100097728 | Ga0070673_1000977283 | 153 |
| 6 | 3300006237 | Ga0097621_100721742 | Ga0097621_1007217422 | 153 |
| 7 | 3300025918 | Ga0207662_10020061 | Ga0207662_100200614 | 153 |
| 8 | 3300025981 | Ga0207640_10263708 | Ga0207640_102637083 | 153 |
| 9 | 3300026095 | Ga0207676_10311896 | Ga0207676_103118962 | 153 |
| 10 | 3300035084 | Ga0373928_0023987 | Ga0373928_0023987_93_554 | 153 |
| 11 | 3300044693 | Ga0466961_0165715 | Ga0466961_0165715_306_899 | 153 |
| 12 | 3300044842 | Ga0466957_0035519 | Ga0466957_0035519_1536_2129 | 153 |
| 13 | 3300046539 | Ga0495621_0010410 | Ga0495621_0010410_1600_2061 | 153 |
| 14 | 3300025916 | Ga0207663_10726255 | Ga0207663_107262552 | 155 |
| 15 | 3300045836 | Ga0466958_0021170 | Ga0466958_0021170_3023_3616 | 155 |
| 16 | 3300005435 | Ga0070714_100107247 | Ga0070714_1001072473 | 156 |
| 17 | 3300005439 | Ga0070711_100833710 | Ga0070711_1008337102 | 156 |
| 18 | 3300005518 | Ga0070699_100568278 | Ga0070699_1005682782 | 156 |
| 19 | 3300005563 | Ga0068855_100145068 | Ga0068855_1001450682 | 156 |
| 20 | 3300009093 | Ga0105240_10375460 | Ga0105240_103754603 | 156 |
| 21 | 3300013104 | Ga0157370_10003796 | Ga0157370_100037962 | 156 |
| 22 | 3300025929 | Ga0207664_10111926 | Ga0207664_101119263 | 156 |
| 23 | 3300025949 | Ga0207667_10108258 | Ga0207667_101082584 | 156 |
| 24 | 3300005563 | Ga0068855_100120702 | Ga0068855_1001207022 | 158 |
| 25 | 3300013307 | Ga0157372_11295391 | Ga0157372_112953912 | 158 |
| 26 | 3300025949 | Ga0207667_10048883 | Ga0207667_100488832 | 158 |
| 27 | 3300005293 | Ga0065715_10305865 | Ga0065715_103058652 | 159 |
| 28 | 3300005295 | Ga0065707_10081966 | Ga0065707_100819663 | 159 |
| 29 | 3300005327 | Ga0070658_10125903 | Ga0070658_101259033 | 159 |
| 30 | 3300005337 | Ga0070682_100153348 | Ga0070682_1001533483 | 159 |
| 31 | 3300005353 | Ga0070669_100087263 | Ga0070669_1000872631 | 159 |
| 32 | 3300005354 | Ga0070675_100009662 | Ga0070675_1000096625 | 159 |
| 33 | 3300005364 | Ga0070673_100485447 | Ga0070673_1004854472 | 159 |
| 34 | 3300005455 | Ga0070663_100410664 | Ga0070663_1004106641 | 159 |
| 35 | 3300005458 | Ga0070681_10007545 | Ga0070681_1000754512 | 159 |
| 36 | 3300005459 | Ga0068867_100706173 | Ga0068867_1007061731 | 159 |
| 37 | 3300005539 | Ga0068853_100024287 | Ga0068853_1000242875 | 159 |
| 38 | 3300005719 | Ga0068861_100170109 | Ga0068861_1001701092 | 159 |
| 39 | 3300005840 | Ga0068870_10167808 | Ga0068870_101678082 | 159 |
| 40 | 3300005843 | Ga0068860_100371533 | Ga0068860_1003715333 | 159 |
| 41 | 3300006881 | Ga0068865_100197152 | Ga0068865_1001971523 | 159 |
| 42 | 3300009098 | Ga0105245_10438308 | Ga0105245_104383082 | 159 |
| 43 | 3300009174 | Ga0105241_10128079 | Ga0105241_101280793 | 159 |
| 44 | 3300009176 | Ga0105242_10295194 | Ga0105242_102951943 | 159 |
| 45 | 3300009545 | Ga0105237_10038124 | Ga0105237_100381244 | 159 |
| 46 | 3300010375 | Ga0105239_10014722 | Ga0105239_100147222 | 159 |
| 47 | 3300013307 | Ga0157372_10922843 | Ga0157372_109228432 | 159 |
| 48 | 3300014326 | Ga0157380_10001358 | Ga0157380_1000135813 | 159 |
| 49 | 3300014745 | Ga0157377_10048944 | Ga0157377_100489444 | 159 |
| 50 | 3300014968 | Ga0157379_10340139 | Ga0157379_103401393 | 159 |
| 51 | 3300025911 | Ga0207654_10039013 | Ga0207654_100390133 | 159 |
| 52 | 3300025914 | Ga0207671_10056936 | Ga0207671_100569364 | 159 |
| 53 | 3300025921 | Ga0207652_10020872 | Ga0207652_100208724 | 159 |
| 54 | 3300025926 | Ga0207659_10055239 | Ga0207659_100552393 | 159 |
| 55 | 3300025949 | Ga0207667_10295258 | Ga0207667_102952582 | 159 |
| 56 | 3300025960 | Ga0207651_10059756 | Ga0207651_100597562 | 159 |
| 57 | 3300026041 | Ga0207639_10009851 | Ga0207639_100098515 | 159 |
| 58 | 3300026067 | Ga0207678_10735976 | Ga0207678_107359761 | 159 |
| 59 | 3300026116 | Ga0207674_10022838 | Ga0207674_100228386 | 159 |
| 60 | 3300026118 | Ga0207675_100004064 | Ga0207675_1000040649 | 159 |
| 61 | 3300028379 | Ga0268266_11230916 | Ga0268266_112309161 | 159 |
| 62 | 3300028380 | Ga0268265_10417611 | Ga0268265_104176112 | 159 |
| 63 | 3300031824 | Ga0307413_10405581 | Ga0307413_104055812 | 159 |
| 64 | 3300035724 | Ga0373933_0419777 | Ga0373933_0419777_84_602 | 159 |
| 65 | 3300046460 | Ga0495638_0024258 | Ga0495638_0024258_1360_1911 | 159 |
| 66 | 3300046660 | Ga0495625_0001706 | Ga0495625_0001706_22596_23147 | 159 |
| 67 | 3300047320 | Ga0495672_0121016 | Ga0495672_0121016_811_1311 | 159 |
| 68 | 3300048904 | Ga0496101_0570592 | Ga0496101_0570592_55_573 | 159 |
| 69 | 3300048913 | Ga0496110_0098468 | Ga0496110_0098468_300_881 | 159 |
| 70 | 3300048917 | Ga0496114_0390208 | Ga0496114_0390208_262_843 | 159 |
| 71 | 3300048921 | Ga0496118_0157558 | Ga0496118_0157558_339_890 | 159 |
| 72 | 3300048924 | Ga0496121_0349423 | Ga0496121_0349423_45_596 | 159 |
| 73 | 3300049571 | Ga0501034_0590941 | Ga0501034_0590941_446_931 | 159 |
| 74 | 3300049585 | Ga0501069_0074070 | Ga0501069_0074070_1265_1744 | 159 |
| 75 | 3300050509 | nmdc:mga0qj67_548916_c1 | nmdc:mga0qj67_548916_c1_393_914 | 159 |
| 76 | 3300005985 | Ga0081539_10173373 | Ga0081539_101733732 | 160 |
| 77 | 3300050513 | nmdc:mga0rr50_26825_c1 | nmdc:mga0rr50_26825_c1_122_604 | 160 |
| 78 | 3300050514 | nmdc:mga08x19_98727_c1 | nmdc:mga08x19_98727_c1_411_893 | 160 |
| 79 | 3300005328 | Ga0070676_10388159 | Ga0070676_103881592 | 161 |
| 80 | 3300005329 | Ga0070683_100274466 | Ga0070683_1002744662 | 161 |
| 81 | 3300005330 | Ga0070690_100103876 | Ga0070690_1001038763 | 161 |
| 82 | 3300005330 | Ga0070690_101081895 | Ga0070690_1010818951 | 161 |
| 83 | 3300005333 | Ga0070677_10143289 | Ga0070677_101432892 | 161 |
| 84 | 3300005334 | Ga0068869_100076173 | Ga0068869_1000761732 | 161 |
| 85 | 3300005334 | Ga0068869_100162596 | Ga0068869_1001625962 | 161 |
| 86 | 3300005336 | Ga0070680_100293661 | Ga0070680_1002936611 | 161 |
| 87 | 3300005340 | Ga0070689_100072468 | Ga0070689_1000724684 | 161 |
| 88 | 3300005344 | Ga0070661_100267697 | Ga0070661_1002676973 | 161 |
| 89 | 3300005345 | Ga0070692_10145958 | Ga0070692_101459582 | 161 |
| 90 | 3300005354 | Ga0070675_100025029 | Ga0070675_1000250292 | 161 |
| 91 | 3300005356 | Ga0070674_101117493 | Ga0070674_1011174931 | 161 |
| 92 | 3300005364 | Ga0070673_100043585 | Ga0070673_1000435853 | 161 |
| 93 | 3300005364 | Ga0070673_101352756 | Ga0070673_1013527561 | 161 |
| 94 | 3300005365 | Ga0070688_100036289 | Ga0070688_1000362891 | 161 |
| 95 | 3300005438 | Ga0070701_10006208 | Ga0070701_100062087 | 161 |
| 96 | 3300005438 | Ga0070701_10096928 | Ga0070701_100969283 | 161 |
| 97 | 3300005440 | Ga0070705_100211968 | Ga0070705_1002119682 | 161 |
| 98 | 3300005456 | Ga0070678_100736845 | Ga0070678_1007368452 | 161 |
| 99 | 3300005458 | Ga0070681_10012364 | Ga0070681_100123648 | 161 |
| 100 | 3300005458 | Ga0070681_10380919 | Ga0070681_103809193 | 161 |
| 101 | 3300005459 | Ga0068867_100392422 | Ga0068867_1003924221 | 161 |
| 102 | 3300005459 | Ga0068867_100664870 | Ga0068867_1006648702 | 161 |
| 103 | 3300005518 | Ga0070699_100514869 | Ga0070699_1005148692 | 161 |
| 104 | 3300005530 | Ga0070679_100717600 | Ga0070679_1007176002 | 161 |
| 105 | 3300005530 | Ga0070679_100899850 | Ga0070679_1008998502 | 161 |
| 106 | 3300005535 | Ga0070684_100354106 | Ga0070684_1003541061 | 161 |
| 107 | 3300005536 | Ga0070697_101077270 | Ga0070697_1010772701 | 161 |
| 108 | 3300005539 | Ga0068853_100029946 | Ga0068853_1000299464 | 161 |
| 109 | 3300005543 | Ga0070672_100222223 | Ga0070672_1002222232 | 161 |
| 110 | 3300005546 | Ga0070696_100153404 | Ga0070696_1001534043 | 161 |
| 111 | 3300005547 | Ga0070693_100000865 | Ga0070693_10000086516 | 161 |
| 112 | 3300005547 | Ga0070693_100080520 | Ga0070693_1000805202 | 161 |
| 113 | 3300005547 | Ga0070693_100122692 | Ga0070693_1001226922 | 161 |
| 114 | 3300005548 | Ga0070665_100353032 | Ga0070665_1003530322 | 161 |
| 115 | 3300005563 | Ga0068855_100017780 | Ga0068855_1000177805 | 161 |
| 116 | 3300005563 | Ga0068855_101026066 | Ga0068855_1010260662 | 161 |
| 117 | 3300005614 | Ga0068856_100025504 | Ga0068856_1000255044 | 161 |
| 118 | 3300005615 | Ga0070702_100166065 | Ga0070702_1001660653 | 161 |
| 119 | 3300005617 | Ga0068859_100020233 | Ga0068859_1000202333 | 161 |
| 120 | 3300005617 | Ga0068859_100108748 | Ga0068859_1001087481 | 161 |
| 121 | 3300005719 | Ga0068861_100065962 | Ga0068861_1000659623 | 161 |
| 122 | 3300005834 | Ga0068851_10381603 | Ga0068851_103816031 | 161 |
| 123 | 3300006178 | Ga0075367_10163269 | Ga0075367_101632693 | 161 |
| 124 | 3300006195 | Ga0075366_10007389 | Ga0075366_100073896 | 161 |
| 125 | 3300006195 | Ga0075366_10117459 | Ga0075366_101174592 | 161 |
| 126 | 3300006237 | Ga0097621_100041056 | Ga0097621_1000410562 | 161 |
| 127 | 3300006353 | Ga0075370_10071686 | Ga0075370_100716863 | 161 |
| 128 | 3300006358 | Ga0068871_100031636 | Ga0068871_1000316362 | 161 |
| 129 | 3300006358 | Ga0068871_100097175 | Ga0068871_1000971754 | 161 |
| 130 | 3300006881 | Ga0068865_100661726 | Ga0068865_1006617262 | 161 |
| 131 | 3300006914 | Ga0075436_100848747 | Ga0075436_1008487471 | 161 |
| 132 | 3300006931 | Ga0097620_100020233 | Ga0097620_1000202333 | 161 |
| 133 | 3300006931 | Ga0097620_100108746 | Ga0097620_1001087464 | 161 |
| 134 | 3300009093 | Ga0105240_10213958 | Ga0105240_102139583 | 161 |
| 135 | 3300009094 | Ga0111539_10000774 | Ga0111539_1000077421 | 161 |
| 136 | 3300009098 | Ga0105245_10183781 | Ga0105245_101837813 | 161 |
| 137 | 3300009098 | Ga0105245_10685688 | Ga0105245_106856882 | 161 |
| 138 | 3300009098 | Ga0105245_10842797 | Ga0105245_108427972 | 161 |
| 139 | 3300009148 | Ga0105243_11046145 | Ga0105243_110461452 | 161 |
| 140 | 3300009174 | Ga0105241_10117561 | Ga0105241_101175613 | 161 |
| 141 | 3300009174 | Ga0105241_10141099 | Ga0105241_101410992 | 161 |
| 142 | 3300009174 | Ga0105241_10623960 | Ga0105241_106239602 | 161 |
| 143 | 3300009177 | Ga0105248_10019213 | Ga0105248_100192134 | 161 |
| 144 | 3300009551 | Ga0105238_10315167 | Ga0105238_103151672 | 161 |
| 145 | 3300009553 | Ga0105249_10110697 | Ga0105249_101106972 | 161 |
| 146 | 3300009553 | Ga0105249_11025511 | Ga0105249_110255112 | 161 |
| 147 | 3300013104 | Ga0157370_10558479 | Ga0157370_105584792 | 161 |
| 148 | 3300013297 | Ga0157378_10041432 | Ga0157378_100414325 | 161 |
| 149 | 3300013306 | Ga0163162_10484188 | Ga0163162_104841883 | 161 |
| 150 | 3300013307 | Ga0157372_10045690 | Ga0157372_100456902 | 161 |
| 151 | 3300014325 | Ga0163163_11052229 | Ga0163163_110522292 | 161 |
| 152 | 3300014326 | Ga0157380_10064327 | Ga0157380_100643273 | 161 |
| 153 | 3300014326 | Ga0157380_10165538 | Ga0157380_101655383 | 161 |
| 154 | 3300014326 | Ga0157380_10187176 | Ga0157380_101871763 | 161 |
| 155 | 3300014745 | Ga0157377_10111103 | Ga0157377_101111033 | 161 |
| 156 | 3300025321 | Ga0207656_10196242 | Ga0207656_101962422 | 161 |
| 157 | 3300025893 | Ga0207682_10032817 | Ga0207682_100328173 | 161 |
| 158 | 3300025908 | Ga0207643_10026396 | Ga0207643_100263964 | 161 |
| 159 | 3300025911 | Ga0207654_10234177 | Ga0207654_102341772 | 161 |
| 160 | 3300025911 | Ga0207654_10528593 | Ga0207654_105285932 | 161 |
| 161 | 3300025913 | Ga0207695_10010633 | Ga0207695_1001063315 | 161 |
| 162 | 3300025921 | Ga0207652_10020780 | Ga0207652_100207801 | 161 |
| 163 | 3300025921 | Ga0207652_10780605 | Ga0207652_107806052 | 161 |
| 164 | 3300025923 | Ga0207681_10241955 | Ga0207681_102419553 | 161 |
| 165 | 3300025924 | Ga0207694_10091477 | Ga0207694_100914771 | 161 |
| 166 | 3300025926 | Ga0207659_10234981 | Ga0207659_102349812 | 161 |
| 167 | 3300025929 | Ga0207664_10043246 | Ga0207664_100432464 | 161 |
| 168 | 3300025936 | Ga0207670_10079239 | Ga0207670_100792392 | 161 |
| 169 | 3300025940 | Ga0207691_10007747 | Ga0207691_100077477 | 161 |
| 170 | 3300025942 | Ga0207689_10076475 | Ga0207689_100764754 | 161 |
| 171 | 3300025942 | Ga0207689_10098902 | Ga0207689_100989022 | 161 |
| 172 | 3300025944 | Ga0207661_10766865 | Ga0207661_107668652 | 161 |
| 173 | 3300025949 | Ga0207667_10006138 | Ga0207667_1000613814 | 161 |
| 174 | 3300025961 | Ga0207712_10752995 | Ga0207712_107529952 | 161 |
| 175 | 3300025972 | Ga0207668_10756367 | Ga0207668_107563672 | 161 |
| 176 | 3300026035 | Ga0207703_10386722 | Ga0207703_103867222 | 161 |
| 177 | 3300026041 | Ga0207639_10501399 | Ga0207639_105013992 | 161 |
| 178 | 3300026075 | Ga0207708_10432736 | Ga0207708_104327362 | 161 |
| 179 | 3300026078 | Ga0207702_10022743 | Ga0207702_100227432 | 161 |
| 180 | 3300026089 | Ga0207648_10450512 | Ga0207648_104505122 | 161 |
| 181 | 3300026089 | Ga0207648_10679335 | Ga0207648_106793352 | 161 |
| 182 | 3300026121 | Ga0207683_10037803 | Ga0207683_100378035 | 161 |
| 183 | 3300026142 | Ga0207698_10333471 | Ga0207698_103334712 | 161 |
| 184 | 3300027907 | Ga0207428_10031730 | Ga0207428_100317304 | 161 |
| 185 | 3300028379 | Ga0268266_10382299 | Ga0268266_103822992 | 161 |
| 186 | 3300028381 | Ga0268264_10290744 | Ga0268264_102907443 | 161 |
| 187 | 3300031235 | Ga0265330_10132480 | Ga0265330_101324802 | 161 |
| 188 | 3300031548 | Ga0307408_100500922 | Ga0307408_1005009222 | 161 |
| 189 | 3300031711 | Ga0265314_10173024 | Ga0265314_101730242 | 161 |
| 190 | 3300031731 | Ga0307405_10373332 | Ga0307405_103733321 | 161 |
| 191 | 3300031731 | Ga0307405_10565445 | Ga0307405_105654452 | 161 |
| 192 | 3300031731 | Ga0307405_10623282 | Ga0307405_106232822 | 161 |
| 193 | 3300031903 | Ga0307407_10375176 | Ga0307407_103751762 | 161 |
| 194 | 3300032002 | Ga0307416_100062469 | Ga0307416_1000624694 | 161 |
| 195 | 3300032002 | Ga0307416_100062665 | Ga0307416_1000626654 | 161 |
| 196 | 3300032002 | Ga0307416_100078505 | Ga0307416_1000785054 | 161 |
| 197 | 3300032002 | Ga0307416_100204324 | Ga0307416_1002043243 | 161 |
| 198 | 3300032002 | Ga0307416_100332727 | Ga0307416_1003327273 | 161 |
| 199 | 3300035691 | Ga0373931_0020315 | Ga0373931_0020315_2350_2835 | 161 |
| 200 | 3300035692 | Ga0373935_0247797 | Ga0373935_0247797_572_1057 | 161 |
| 201 | 3300035725 | Ga0373947_0393009 | Ga0373947_0393009_138_623 | 161 |
| 202 | 3300037068 | Ga0373925_0165351 | Ga0373925_0165351_498_983 | 161 |
| 203 | 3300041459 | Ga0451800_1480898 | Ga0451800_1480898_15_500 | 161 |
| 204 | 3300042001 | Ga0439441_004084 | Ga0439441_004084_1138_1623 | 161 |
| 205 | 3300046477 | Ga0495664_0165966 | Ga0495664_0165966_338_823 | 161 |
| 206 | 3300046537 | Ga0495598_0016777 | Ga0495598_0016777_515_1000 | 161 |
| 207 | 3300046537 | Ga0495598_0145235 | Ga0495598_0145235_36_521 | 161 |
| 208 | 3300049571 | Ga0501034_0134246 | Ga0501034_0134246_666_1151 | 161 |
| 209 | 3300049573 | Ga0501037_0438549 | Ga0501037_0438549_357_842 | 161 |
| 210 | 3300049581 | Ga0501047_0955315 | Ga0501047_0955315_17_502 | 161 |
| 211 | 3300049583 | Ga0501067_0111774 | Ga0501067_0111774_211_696 | 161 |
| 212 | 3300049584 | Ga0501068_0023728 | Ga0501068_0023728_861_1346 | 161 |
| 213 | 3300049585 | Ga0501069_0000753 | Ga0501069_0000753_12977_13462 | 161 |
| 214 | 3300049586 | Ga0501070_0007363 | Ga0501070_0007363_7085_7570 | 161 |
| 215 | 3300049589 | Ga0501073_0037060 | Ga0501073_0037060_952_1437 | 161 |
| 216 | 3300049589 | Ga0501073_0603407 | Ga0501073_0603407_247_732 | 161 |
| 217 | 3300049741 | Ga0501079_0216371 | Ga0501079_0216371_935_1420 | 161 |
| 218 | 3300049742 | Ga0501080_0159520 | Ga0501080_0159520_155_640 | 161 |
| 219 | 3300049744 | Ga0501083_0000417 | Ga0501083_0000417_24967_25452 | 161 |
| 220 | 3300049822 | Ga0501035_0332630 | Ga0501035_0332630_60_545 | 161 |
| 221 | 3300050493 | nmdc:mga0k408_87996_c1 | nmdc:mga0k408_87996_c1_819_1313 | 161 |
| 222 | 3300050496 | nmdc:mga07m45_110685_c1 | nmdc:mga07m45_110685_c1_326_811 | 161 |
| 223 | 3300050511 | nmdc:mga08y16_147_c1 | nmdc:mga08y16_147_c1_30184_30669 | 161 |
| 224 | 3300050513 | nmdc:mga0rr50_487437_c1 | nmdc:mga0rr50_487437_c1_239_724 | 161 |
| 225 | 3300050514 | nmdc:mga08x19_617537_c1 | nmdc:mga08x19_617537_c1_200_685 | 161 |
| 226 | 3300054114 | Ga0501084_0630158 | Ga0501084_0630158_394_879 | 161 |
| 227 | 3300060353 | Ga0501082_0072057 | Ga0501082_0072057_1383_1868 | 161 |
| 228 | 3300005330 | Ga0070690_100229452 | Ga0070690_1002294523 | 162 |
| 229 | 3300005438 | Ga0070701_10307315 | Ga0070701_103073151 | 162 |
| 230 | 3300005440 | Ga0070705_100703303 | Ga0070705_1007033031 | 162 |
| 231 | 3300005441 | Ga0070700_100101524 | Ga0070700_1001015242 | 162 |
| 232 | 3300005578 | Ga0068854_100381360 | Ga0068854_1003813602 | 162 |
| 233 | 3300005615 | Ga0070702_100221660 | Ga0070702_1002216602 | 162 |
| 234 | 3300005842 | Ga0068858_100001245 | Ga0068858_1000012454 | 162 |
| 235 | 3300005843 | Ga0068860_100306951 | Ga0068860_1003069512 | 162 |
| 236 | 3300009093 | Ga0105240_10352932 | Ga0105240_103529322 | 162 |
| 237 | 3300009176 | Ga0105242_10003935 | Ga0105242_100039354 | 162 |
| 238 | 3300009177 | Ga0105248_10144939 | Ga0105248_101449393 | 162 |
| 239 | 3300013306 | Ga0163162_10014658 | Ga0163162_100146583 | 162 |
| 240 | 3300014326 | Ga0157380_10329629 | Ga0157380_103296292 | 162 |
| 241 | 3300014968 | Ga0157379_10052682 | Ga0157379_100526826 | 162 |
| 242 | 3300017792 | Ga0163161_10413637 | Ga0163161_104136372 | 162 |
| 243 | 3300025934 | Ga0207686_10011878 | Ga0207686_100118784 | 162 |
| 244 | 3300025935 | Ga0207709_10413442 | Ga0207709_104134422 | 162 |
| 245 | 3300025949 | Ga0207667_10117745 | Ga0207667_101177452 | 162 |
| 246 | 3300026035 | Ga0207703_10007533 | Ga0207703_100075337 | 162 |
| 247 | 3300031731 | Ga0307405_10201185 | Ga0307405_102011852 | 162 |
| 248 | 3300032002 | Ga0307416_103453854 | Ga0307416_1034538541 | 162 |
| 249 | 3300035085 | Ga0373929_0032315 | Ga0373929_0032315_516_1004 | 162 |
| 250 | 3300037471 | Ga0395905_0014552 | Ga0395905_0014552_6603_7091 | 162 |
| 251 | 3300042876 | Ga0451577_0203621 | Ga0451577_0203621_452_1048 | 162 |
| 252 | 3300042876 | Ga0451577_0538410 | Ga0451577_0538410_366_854 | 162 |
| 253 | 3300045051 | Ga0451576_0293850 | Ga0451576_0293850_68_556 | 162 |
| 254 | 3300045051 | Ga0451576_0743300 | Ga0451576_0743300_97_585 | 162 |
| 255 | 3300046681 | Ga0495647_0153108 | Ga0495647_0153108_210_698 | 162 |
| 256 | 3300005327 | Ga0070658_10034866 | Ga0070658_100348662 | 163 |
| 257 | 3300005366 | Ga0070659_100048551 | Ga0070659_1000485513 | 163 |
| 258 | 3300005435 | Ga0070714_100207915 | Ga0070714_1002079152 | 163 |
| 259 | 3300005436 | Ga0070713_100506504 | Ga0070713_1005065042 | 163 |
| 260 | 3300005530 | Ga0070679_100019541 | Ga0070679_1000195417 | 163 |
| 261 | 3300005530 | Ga0070679_100553736 | Ga0070679_1005537362 | 163 |
| 262 | 3300005539 | Ga0068853_101032702 | Ga0068853_1010327022 | 163 |
| 263 | 3300005563 | Ga0068855_100090735 | Ga0068855_1000907352 | 163 |
| 264 | 3300005564 | Ga0070664_101033240 | Ga0070664_1010332401 | 163 |
| 265 | 3300005614 | Ga0068856_100269408 | Ga0068856_1002694083 | 163 |
| 266 | 3300005616 | Ga0068852_100001932 | Ga0068852_1000019329 | 163 |
| 267 | 3300005616 | Ga0068852_100030794 | Ga0068852_1000307944 | 163 |
| 268 | 3300009093 | Ga0105240_11006117 | Ga0105240_110061172 | 163 |
| 269 | 3300009551 | Ga0105238_10121633 | Ga0105238_101216333 | 163 |
| 270 | 3300009551 | Ga0105238_10640332 | Ga0105238_106403322 | 163 |
| 271 | 3300013102 | Ga0157371_10322834 | Ga0157371_103228342 | 163 |
| 272 | 3300013105 | Ga0157369_10002433 | Ga0157369_1000243310 | 163 |
| 273 | 3300013105 | Ga0157369_10521720 | Ga0157369_105217201 | 163 |
| 274 | 3300013307 | Ga0157372_10007773 | Ga0157372_1000777310 | 163 |
| 275 | 3300013307 | Ga0157372_10396243 | Ga0157372_103962432 | 163 |
| 276 | 3300025898 | Ga0207692_10277001 | Ga0207692_102770012 | 163 |
| 277 | 3300025909 | Ga0207705_10198760 | Ga0207705_101987602 | 163 |
| 278 | 3300025916 | Ga0207663_10199028 | Ga0207663_101990282 | 163 |
| 279 | 3300025919 | Ga0207657_10162461 | Ga0207657_101624612 | 163 |
| 280 | 3300025921 | Ga0207652_10023249 | Ga0207652_100232495 | 163 |
| 281 | 3300025924 | Ga0207694_10226755 | Ga0207694_102267553 | 163 |
| 282 | 3300025928 | Ga0207700_10211929 | Ga0207700_102119292 | 163 |
| 283 | 3300025949 | Ga0207667_10199796 | Ga0207667_101997963 | 163 |
| 284 | 3300026041 | Ga0207639_10013242 | Ga0207639_100132426 | 163 |
| 285 | 3300026078 | Ga0207702_10856353 | Ga0207702_108563532 | 163 |
| 286 | 3300026142 | Ga0207698_10002880 | Ga0207698_1000288012 | 163 |
| 287 | 3300039437 | Ga0436365_0216233 | Ga0436365_0216233_110_601 | 163 |
| 288 | 3300014968 | Ga0157379_10892330 | Ga0157379_108923302 | 164 |
| 289 | 3300031548 | Ga0307408_100166328 | Ga0307408_1001663282 | 164 |
| 290 | 3300031852 | Ga0307410_10019022 | Ga0307410_100190222 | 164 |
| 291 | 3300031901 | Ga0307406_10009272 | Ga0307406_100092722 | 164 |
| 292 | 3300031911 | Ga0307412_10029557 | Ga0307412_100295575 | 164 |
| 293 | 3300031995 | Ga0307409_100004693 | Ga0307409_1000046936 | 164 |
| 294 | 3300031995 | Ga0307409_100009430 | Ga0307409_1000094305 | 164 |
| 295 | 3300032002 | Ga0307416_100554033 | Ga0307416_1005540332 | 164 |
| 296 | 3300042126 | Ga0450888_023439 | Ga0450888_023439_169_675 | 164 |
| 297 | 3300027471 | Ga0209995_1028536 | Ga0209995_10285362 | 165 |
| 298 | 3300046543 | Ga0495645_0522947 | Ga0495645_0522947_158_655 | 165 |
| 299 | 3300005340 | Ga0070689_100139675 | Ga0070689_1001396753 | 167 |
| 300 | 3300005365 | Ga0070688_101086103 | Ga0070688_1010861031 | 167 |
| 301 | 3300005719 | Ga0068861_100533216 | Ga0068861_1005332162 | 167 |
| 302 | 3300025936 | Ga0207670_10137368 | Ga0207670_101373682 | 167 |
| 303 | 3300026118 | Ga0207675_100403418 | Ga0207675_1004034182 | 167 |
| 304 | 3300006237 | Ga0097621_100067031 | Ga0097621_1000670314 | 172 |
| 305 | 3300009176 | Ga0105242_10008702 | Ga0105242_100087022 | 172 |
| 306 | 3300013297 | Ga0157378_10222259 | Ga0157378_102222592 | 172 |
| 307 | 3300025934 | Ga0207686_10013937 | Ga0207686_100139372 | 172 |
| 308 | 3300005290 | Ga0065712_10087029 | Ga0065712_100870292 | 173 |
| 309 | 3300005354 | Ga0070675_100111441 | Ga0070675_1001114413 | 173 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dog-assembly1.cif.gz_A | solution structure of the n-terminal domain of rimm from thermus thermophilus hb8 | 0.8113 | 1 | 87 |
| 7cq1-assembly1.cif.gz_A | solution structure of the c-terminal domain of mycobacterium tuberculosis ribosome maturation factor protein rimm | 0.7917 | 90 | 172 |
| 5ode-assembly1.cif.gz_B | structure of a novel oxidoreductase from gloeobacter violaceus | 0.7902 | 110 | 147 |
| 3a1p-assembly2.cif.gz_C | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.7865 | 1 | 173 |
| 3a1p-assembly2.cif.gz_C | structure of ribosome maturation protein rimm and ribosomal protein s19 | 0.765 | 1 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f1lA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.9096 | 1 | 85 | 2.40.30.60 |
| 3h9nA01 | Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;RimM | 0.8861 | 2 | 81 | 2.40.30.60 |
| af_Q2FZ44_92_167_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.8803 | 86 | 173 | 2.30.30.240 |
| af_P0A7X6_101_182_2.30.30.240 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.8757 | 86 | 169 | 2.30.30.240 |
| 2f1lA02 | Mainly Beta;Roll;SH3 type barrels.;PRC-barrel domain | 0.8751 | 91 | 170 | 2.30.30.240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q8PMY2-F1-model_v4 | Ribosome maturation factor RimM | 0.8827 | 1 | 170 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-A0A3N5GXM5-F1-model_v4 | Ribosome maturation factor RimM | 0.8553 | 2 | 171 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
| AF-A0A1Q3YTX5-F1-model_v4 | deleted | 0.8423 | 2 | 168 |
|
| AF-A0A3B1C6H7-F1-model_v4 | 16S rRNA processing protein RimM | 0.839 | 1 | 171 |
GO:0005737
GO:0005840 GO:0006364 GO:0043022 |
| AF-A0A7C4VS91-F1-model_v4 | Ribosome maturation factor RimM | 0.8337 | 2 | 170 |
GO:0005737
GO:0005840 GO:0006364 GO:0042274 GO:0043022 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar