F400008

General Info

Members Datasets Scaffolds Average Seq Length
309 163 619 124

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1007019|Ga0055542_10070194
Length 150
Sequence MVKGLQPAGPSLQRLSQGGESGRPKSRMSATPPVSDFIRSSFRSVWALELLLHLRRTSDRAWSTGQLVEAMRGSAMIVDQSLDGLMRMGLVSIDADGCARFQPATDDLARMVDETEQLYIRKPETVRKIIVSGTHKGLANFADAFRLWKD

Samples

Sample ID Description Type Environment
1 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
145 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
161 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
162 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.85
Nodule 0
Rhizoplane 0.97
Rhizosphere 90.29
Stem 0
Stem Tuber 0
Unclassified 15.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055542_1007019 3300003762 Bacteria 2337
2 MBSR1b_contig_2102004 2162886012 Bacteria 1415
3 JGI24740J21852_10018020 3300001979 Bacteria 2515
4 JGI24740J21852_10078377 3300001979 Unclassified 870
5 JGI24739J22299_10002108 3300001989 Bacteria 7617
6 JGI24739J22299_10006598 3300001989 Bacteria 4374
7 JGI24739J22299_10010990 3300001989 Bacteria 3348
8 JGI24737J22298_10005923 3300001990 Bacteria 4206
9 JGI24737J22298_10009037 3300001990 Bacteria 3321
10 JGI24737J22298_10021533 3300001990 Bacteria 2054
11 JGI24737J22298_10021538 3300001990 Bacteria 2054
12 JGI24735J21928_10002680 3300002067 Bacteria 6154
13 JGI24735J21928_10002860 3300002067 Bacteria 5952
14 JGI24735J21928_10003360 3300002067 Bacteria 5459
15 JGI24735J21928_10005013 3300002067 Bacteria 4410
16 JGI24735J21928_10007559 3300002067 Bacteria 3542
17 JGI24735J21928_10012192 3300002067 Bacteria 2719
18 JGI24735J21928_10016225 3300002067 Bacteria 2316
19 JGI24735J21928_10018393 3300002067 Bacteria 2154
20 JGI24735J21928_10019412 3300002067 Bacteria 2089
21 JGI24738J21930_10002578 3300002075 Bacteria 4698
22 JGI24738J21930_10018062 3300002075 Bacteria 1476
23 JGI24744J21845_10003337 3300002077 Bacteria 3296
24 JGI24033J26618_1022519 3300002155 Unclassified 815
25 JGI24742J22300_10013167 3300002244 Bacteria 1384
26 JGI25157J39369_1023834 3300002741 Unclassified 719
27 JGI25165J46597_1000094 3300003214 Bacteria 164674
28 rootH1_10037570 3300003316 Bacteria 1652
29 rootH2_10134777 3300003320 Bacteria 1475
30 rootL2_10069057 3300003322 Bacteria 2584
31 rootL2_10069058 3300003322 Bacteria 1610
32 rootL2_10069857 3300003322 Bacteria 3995
33 rootL2_10246917 3300003322 Unclassified 1327
34 rootL2_10374078 3300003322 Unclassified 1133
35 rootH1_10012388 3300003323 Bacteria 1163
36 rootH1_10017191 3300003323 Bacteria 1348
37 rootH1_10087128 3300003316 Bacteria 4365
38 rootH1_10087128 3300003323 Bacteria 1090
39 Ga0055542_1016895 3300003762 Bacteria 1139
40 Ga0055529_1004746 3300003763 Bacteria 2040
41 Ga0065715_10191064 3300005293 Bacteria 1407
42 Ga0070658_10000106 3300005327 Bacteria 74827
43 Ga0070658_10002213 3300005327 Bacteria 16316
44 Ga0070658_10003471 3300005327 Bacteria 12948
45 Ga0070658_10057652 3300005327 Bacteria 3160
46 Ga0070683_100582487 3300005329 Bacteria 1070
47 Ga0070677_10014989 3300005333 Bacteria 2739
48 Ga0068869_100005772 3300005334 Bacteria 7807
49 Ga0070680_100496416 3300005336 Bacteria 1044
50 Ga0068868_100000016 3300005338 Bacteria 102357
51 Ga0070660_100000264 3300005339 Bacteria 34742
52 Ga0070660_100004036 3300005339 Bacteria 10137
53 Ga0070660_100034357 3300005339 Bacteria 3830
54 Ga0070660_100054066 3300005339 Bacteria 3099
55 Ga0070660_100108630 3300005339 Bacteria 2205
56 Ga0070660_100143276 3300005339 Bacteria 1918
57 Ga0070661_100038654 3300005344 Bacteria 3475
58 Ga0070661_100267534 3300005344 Bacteria 1323
59 Ga0070661_100696989 3300005344 Bacteria 827
60 Ga0070669_100926643 3300005353 Unclassified 745
61 Ga0070675_100071900 3300005354 Bacteria 2871
62 Ga0070675_100135338 3300005354 Bacteria 2103
63 Ga0070671_100027833 3300005355 Bacteria 4653
64 Ga0070673_100000017 3300005364 Bacteria 112829
65 Ga0070673_100267164 3300005364 Bacteria 1496
66 Ga0070673_100339021 3300005364 Bacteria 1332
67 Ga0070659_100064510 3300005366 Bacteria 2899
68 Ga0070659_100131621 3300005366 Bacteria 2032
69 Ga0070659_100156832 3300005366 Bacteria 1859
70 Ga0070659_100273625 3300005366 Bacteria 1404
71 Ga0070659_100345836 3300005366 Bacteria 1247
72 Ga0070659_100961673 3300005366 Unclassified 748
73 Ga0070667_101396448 3300005367 Bacteria 657
74 Ga0070714_100132585 3300005435 Bacteria 2227
75 Ga0070713_100581139 3300005436 Unclassified 1063
76 Ga0070663_100991711 3300005455 Unclassified 730
77 Ga0070678_100043195 3300005456 Bacteria 3209
78 Ga0070678_100938109 3300005456 Unclassified 793
79 Ga0070662_100152045 3300005457 Bacteria 1803
80 Ga0070662_100212012 3300005457 Bacteria 1542
81 Ga0070681_10173853 3300005458 Bacteria 2075
82 Ga0070681_10385139 3300005458 Bacteria 1313
83 Ga0068867_100000013 3300005459 Bacteria 112835
84 Ga0070679_100146888 3300005530 Bacteria 2335
85 Ga0070684_100473920 3300005535 Unclassified 1158
86 Ga0068853_100063290 3300005539 Bacteria 3204
87 Ga0068853_100109146 3300005539 Bacteria 2456
88 Ga0070672_100243609 3300005543 Bacteria 1513
89 Ga0068855_100008513 3300005563 Bacteria 12401
90 Ga0068855_100301102 3300005563 Bacteria 1776
91 Ga0070664_100800126 3300005564 Bacteria 881
92 Ga0068857_100012610 3300005577 Bacteria 7365
93 Ga0068857_100074123 3300005577 Bacteria 3033
94 Ga0068856_100110611 3300005614 Bacteria 2744
95 Ga0068856_100697462 3300005614 Unclassified 1035
96 Ga0068852_100002509 3300005616 Bacteria 12637
97 Ga0068852_100598552 3300005616 Unclassified 1106
98 Ga0068852_101538998 3300005616 Bacteria 687
99 Ga0068859_100050558 3300005617 Bacteria 4175
100 Ga0068866_10287394 3300005718 Unclassified 1021
101 Ga0068862_101139775 3300005844 Unclassified 776
102 Ga0075366_10115651 3300006195 Bacteria 1615
103 Ga0097621_100035316 3300006237 Bacteria 3994
104 Ga0068871_100161524 3300006358 Bacteria 1917
105 Ga0068865_100000007 3300006881 Bacteria 185316
106 Ga0097620_100050558 3300006931 Bacteria 4175
107 Ga0105240_10216381 3300009093 Bacteria 2235
108 Ga0105240_10456246 3300009093 Bacteria 1429
109 Ga0105240_10738727 3300009093 Unclassified 1071
110 Ga0105245_10001648 3300009098 Bacteria 20315
111 Ga0105247_10033525 3300009101 Unclassified 3124
112 Ga0105243_10001477 3300009148 Bacteria 20619
113 Ga0105241_10817538 3300009174 Unclassified 860
114 Ga0105242_10000196 3300009176 Bacteria 46996
115 Ga0105237_10242212 3300009545 Bacteria 1805
116 Ga0105237_10423661 3300009545 Bacteria 1337
117 Ga0105238_10014621 3300009551 Bacteria 7935
118 Ga0105238_10086663 3300009551 Bacteria 3119
119 Ga0105238_10491166 3300009551 Bacteria 1228
120 Ga0105249_10053951 3300009553 Bacteria 3675
121 Ga0105239_10023463 3300010375 Bacteria 6795
122 Ga0105239_10610562 3300010375 Bacteria 1244
123 Ga0105239_11172308 3300010375 Bacteria 885
124 Ga0105246_10005216 3300011119 Bacteria 7902
125 Ga0157373_10053359 3300013100 Bacteria 2875
126 Ga0157373_10074056 3300013100 Bacteria 2402
127 Ga0157373_10751277 3300013100 Unclassified 717
128 Ga0157371_10037979 3300013102 Bacteria 3445
129 Ga0157371_10099842 3300013102 Bacteria 2058
130 Ga0157370_10000692 3300013104 Bacteria 42084
131 Ga0157370_10099587 3300013104 Bacteria 2724
132 Ga0157370_10196150 3300013104 Bacteria 1874
133 Ga0157370_10223735 3300013104 Unclassified 1743
134 Ga0157369_10041278 3300013105 Bacteria 5037
135 Ga0157369_10081599 3300013105 Bacteria 3461
136 Ga0157369_10177943 3300013105 Bacteria 2239
137 Ga0157369_10559936 3300013105 Bacteria 1181
138 Ga0157374_10004516 3300013296 Bacteria 11689
139 Ga0157378_10000674 3300013297 Bacteria 32205
140 Ga0163162_10401600 3300013306 Bacteria 1503
141 Ga0157372_10015332 3300013307 Bacteria 8213
142 Ga0157372_10121678 3300013307 Bacteria 2998
143 Ga0157372_10167057 3300013307 Bacteria 2545
144 Ga0157372_10169481 3300013307 Bacteria 2526
145 Ga0157372_10412268 3300013307 Bacteria 1574
146 Ga0157375_10141229 3300013308 Bacteria 2536
147 Ga0157375_10228490 3300013308 Bacteria 2019
148 Ga0157377_10002668 3300014745 Bacteria 7920
149 Ga0157379_10097054 3300014968 Unclassified 2645
150 Ga0157376_10000081 3300014969 Bacteria 72584
151 Ga0157376_10301935 3300014969 Bacteria 1516
152 Ga0163161_10405781 3300017792 Bacteria 1093
153 Ga0207427_100290 3300025231 Bacteria 35901
154 Ga0209026_1003029 3300025250 Bacteria 5787
155 Ga0209148_1000074 3300025254 Bacteria 314356
156 Ga0209148_1003329 3300025254 Bacteria 4522
157 Ga0209233_1000003 3300025261 Bacteria 1607366
158 Ga0209455_1003491 3300025272 Bacteria 5537
159 Ga0207682_10048298 3300025893 Bacteria 1754
160 Ga0207647_10021174 3300025904 Bacteria 4345
161 Ga0207647_10049209 3300025904 Bacteria 2615
162 Ga0207647_10066357 3300025904 Bacteria 2188
163 Ga0207647_10103154 3300025904 Bacteria 1691
164 Ga0207647_10124694 3300025904 Bacteria 1516
165 Ga0207645_10001106 3300025907 Bacteria 22259
166 Ga0207645_10692458 3300025907 Unclassified 693
167 Ga0207705_10000044 3300025909 Bacteria 180886
168 Ga0207705_10000078 3300025909 Bacteria 120247
169 Ga0207705_10013691 3300025909 Bacteria 5852
170 Ga0207705_10083712 3300025909 Bacteria 2328
171 Ga0207654_10709065 3300025911 Unclassified 723
172 Ga0207695_10388268 3300025913 Bacteria 1281
173 Ga0207695_10622820 3300025913 Unclassified 960
174 Ga0207695_10946422 3300025913 Bacteria 741
175 Ga0207671_10389122 3300025914 Bacteria 1108
176 Ga0207657_10000696 3300025919 Bacteria 35731
177 Ga0207657_10012436 3300025919 Bacteria 8407
178 Ga0207657_10064511 3300025919 Bacteria 3126
179 Ga0207657_10189409 3300025919 Bacteria 1660
180 Ga0207657_10886469 3300025919 Unclassified 688
181 Ga0207694_10008167 3300025924 Bacteria 7908
182 Ga0207650_10178476 3300025925 Bacteria 1691
183 Ga0207659_10184966 3300025926 Bacteria 1653
184 Ga0207659_10357002 3300025926 Bacteria 1214
185 Ga0207687_10016994 3300025927 Bacteria 4783
186 Ga0207664_10151485 3300025929 Bacteria 1970
187 Ga0207644_10019034 3300025931 Bacteria 4654
188 Ga0207690_10224919 3300025932 Bacteria 1438
189 Ga0207690_10360254 3300025932 Unclassified 1152
190 Ga0207690_10749865 3300025932 Unclassified 805
191 Ga0207706_10101198 3300025933 Bacteria 2535
192 Ga0207706_10152750 3300025933 Bacteria 2031
193 Ga0207706_10238040 3300025933 Bacteria 1591
194 Ga0207706_10552984 3300025933 Unclassified 991
195 Ga0207686_10000260 3300025934 Bacteria 39872
196 Ga0207709_10000156 3300025935 Bacteria 93099
197 Ga0207704_10000017 3300025938 Bacteria 154190
198 Ga0207691_10147407 3300025940 Bacteria 2071
199 Ga0207689_10011538 3300025942 Bacteria 7568
200 Ga0207661_10516950 3300025944 Bacteria 1092
201 Ga0207667_10485802 3300025949 Bacteria 1253
202 Ga0207651_10000011 3300025960 Bacteria 191950
203 Ga0207651_10691072 3300025960 Unclassified 898
204 Ga0207712_10022228 3300025961 Bacteria 4174
205 Ga0207640_11038743 3300025981 Unclassified 722
206 Ga0207677_10000173 3300026023 Bacteria 50916
207 Ga0207703_10143148 3300026035 Bacteria 2077
208 Ga0207639_10027275 3300026041 Bacteria 4159
209 Ga0207639_10329338 3300026041 Bacteria 1358
210 Ga0207678_10422984 3300026067 Bacteria 1155
211 Ga0207702_10114941 3300026078 Bacteria 2399
212 Ga0207702_10684597 3300026078 Bacteria 1010
213 Ga0207648_10000045 3300026089 Bacteria 111963
214 Ga0207674_10007682 3300026116 Bacteria 12553
215 Ga0207674_10019058 3300026116 Bacteria 7436
216 Ga0207674_11193538 3300026116 Unclassified 731
217 Ga0207683_10129417 3300026121 Bacteria 2270
218 Ga0207683_10989646 3300026121 Unclassified 781
219 Ga0207698_10016146 3300026142 Bacteria 5024
220 Ga0207698_10079117 3300026142 Bacteria 2643
221 Ga0207698_10734411 3300026142 Unclassified 985
222 Ga0207698_11236404 3300026142 Unclassified 761
223 Ga0268265_11635588 3300028380 Unclassified 649
224 Ga0307413_10396669 3300031824 Bacteria 1080
225 Ga0307413_10400511 3300031824 Bacteria 1075
226 Ga0307409_100269027 3300031995 Bacteria 1568
227 Ga0307409_100530375 3300031995 Bacteria 1152
228 Ga0307416_100187048 3300032002 Bacteria 1948
229 Ga0307416_100277672 3300032002 Bacteria 1650
230 Ga0307414_10000536 3300032004 Bacteria 19786
231 Ga0307414_10037815 3300032004 Bacteria 3235
232 Ga0307414_10406585 3300032004 Bacteria 1184
233 Ga0307411_10152681 3300032005 Bacteria 1718
234 Ga0307411_10277099 3300032005 Bacteria 1333
235 Ga0307411_10330368 3300032005 Bacteria 1235
236 Ga0307415_101015008 3300032126 Bacteria 772
237 Ga0307415_102345575 3300032126 Unclassified 524
238 Ga0373931_0347328 3300035691 Unclassified 928
239 Ga0395899_0020957 3300037312 Bacteria 4957
240 Ga0395899_0037068 3300037312 Bacteria 3656
241 Ga0395899_0183440 3300037312 Bacteria 1468
242 Ga0395899_0211493 3300037312 Bacteria 1347
243 Ga0395899_0259876 3300037312 Bacteria 1188
244 Ga0395900_0001394 3300037418 Bacteria 28915
245 Ga0395900_0002890 3300037418 Bacteria 18700
246 Ga0395900_0263513 3300037418 Bacteria 1720
247 Ga0395900_0400995 3300037418 Bacteria 1336
248 Ga0395900_0408626 3300037418 Bacteria 1320
249 Ga0395900_1471471 3300037418 Unclassified 593
250 Ga0395898_0583433 3300037466 Bacteria 1060
251 Ga0395905_0001106 3300037471 Bacteria 33891
252 Ga0395905_0132689 3300037471 Bacteria 2342
253 Ga0395905_0426722 3300037471 Bacteria 1222
254 Ga0395901_0034703 3300038443 Bacteria 5210
255 Ga0395901_0809546 3300038443 Bacteria 925
256 Ga0439448_0097568 3300042005 Bacteria 997
257 Ga0439448_0169470 3300042005 Unclassified 761
258 Ga0439455_0015935 3300042012 Bacteria 1733
259 Ga0439458_0000352 3300042157 Bacteria 11468
260 Ga0439458_0004590 3300042157 Bacteria 3158
261 Ga0439458_0090419 3300042157 Bacteria 787
262 Ga0466972_0060729 3300044658 Bacteria 1813
263 Ga0466965_0015417 3300044683 Bacteria 3631
264 Ga0466965_0261305 3300044683 Bacteria 931
265 Ga0466965_0447126 3300044683 Unclassified 719
266 Ga0466966_0216886 3300044684 Bacteria 1156
267 Ga0466966_0283919 3300044684 Bacteria 995
268 Ga0466966_0747925 3300044684 Bacteria 589
269 Ga0466961_0071915 3300044693 Bacteria 2194
270 Ga0466963_0042905 3300044694 Bacteria 2971
271 Ga0466963_1299885 3300044694 Unclassified 510
272 Ga0466964_0003480 3300044706 Bacteria 5748
273 Ga0466964_0087528 3300044706 Bacteria 1350
274 Ga0466971_0010051 3300044719 Bacteria 4134
275 Ga0466971_0224940 3300044719 Bacteria 890
276 Ga0466970_0058984 3300044765 Bacteria 2055
277 Ga0466957_0280031 3300044842 Bacteria 1116
278 Ga0466957_0568485 3300044842 Bacteria 791
279 Ga0466960_0002004 3300044901 Bacteria 7559
280 Ga0466960_0007103 3300044901 Bacteria 4528
281 Ga0466960_0287622 3300044901 Bacteria 923
282 Ga0466959_0051737 3300045049 Bacteria 3010
283 Ga0466958_0068107 3300045836 Bacteria 2176
284 Ga0466958_0070056 3300045836 Bacteria 2145
285 Ga0466958_0090145 3300045836 Bacteria 1897
286 Ga0466958_0420682 3300045836 Bacteria 864
287 Ga0466958_0789368 3300045836 Unclassified 619
288 Ga0466967_0018297 3300045976 Bacteria 5595
289 Ga0466967_0068055 3300045976 Bacteria 3178
290 Ga0466967_0261754 3300045976 Bacteria 1655
291 Ga0466967_0339955 3300045976 Bacteria 1451
292 Ga0466967_0458231 3300045976 Bacteria 1247
293 Ga0466967_1087243 3300045976 Unclassified 797
294 Ga0466967_1097691 3300045976 Unclassified 793
295 Ga0495663_0004434 3300046525 Bacteria 3948
296 Ga0495670_0020857 3300046691 Bacteria 3231
297 Ga0495670_0262392 3300046691 Bacteria 922
298 Ga0495649_0192572 3300046694 Bacteria 1061
299 Ga0495687_131091 3300047443 Unclassified 887
300 Ga0496108_0936326 3300048911 Bacteria 742
301 Ga0496110_0317165 3300048913 Bacteria 1420
302 Ga0496111_0250037 3300048914 Bacteria 1316
303 Ga0501257_154796 3300049686 Unclassified 634
304 nmdc:mga0k408_287726_c1 3300050493 Unclassified 981
305 nmdc:mga07m45_230858_c1 3300050496 Unclassified 1077
306 Ga0500658_0451668 3300053134 Bacteria 585
307 Ga0500611_019279 3300053727 Bacteria 1270
308 Ga0500587_000331 3300053739 Bacteria 5332
309 Ga0466962_0194434 3300061719 Bacteria 990
310 Ga0466962_0470501 3300061719 Bacteria 634
311 Ga0055542_1007019
312 MBSR1b_contig_2102004
313 JGI24740J21852_10018020
314 JGI24740J21852_10078377
315 JGI24739J22299_10002108
316 JGI24739J22299_10006598
317 JGI24739J22299_10010990
318 JGI24737J22298_10005923
319 JGI24737J22298_10009037
320 JGI24737J22298_10021533
321 JGI24737J22298_10021538
322 JGI24735J21928_10002680
323 JGI24735J21928_10002860
324 JGI24735J21928_10003360
325 JGI24735J21928_10005013
326 JGI24735J21928_10007559
327 JGI24735J21928_10012192
328 JGI24735J21928_10016225
329 JGI24735J21928_10018393
330 JGI24735J21928_10019412
331 JGI24738J21930_10002578
332 JGI24738J21930_10018062
333 JGI24744J21845_10003337
334 JGI24033J26618_1022519
335 JGI24742J22300_10013167
336 JGI25157J39369_1023834
337 JGI25165J46597_1000094
338 rootH1_10037570
339 rootH2_10134777
340 rootL2_10069057
341 rootL2_10069058
342 rootL2_10069857
343 rootL2_10246917
344 rootL2_10374078
345 rootH1_10012388
346 rootH1_10017191
347 rootH1_10087128
348 Ga0055542_1016895
349 Ga0055529_1004746
350 Ga0065715_10191064
351 Ga0070658_10000106
352 Ga0070658_10002213
353 Ga0070658_10003471
354 Ga0070658_10057652
355 Ga0070683_100582487
356 Ga0070677_10014989
357 Ga0068869_100005772
358 Ga0070680_100496416
359 Ga0068868_100000016
360 Ga0070660_100000264
361 Ga0070660_100004036
362 Ga0070660_100034357
363 Ga0070660_100054066
364 Ga0070660_100108630
365 Ga0070660_100143276
366 Ga0070661_100038654
367 Ga0070661_100267534
368 Ga0070661_100696989
369 Ga0070669_100926643
370 Ga0070675_100071900
371 Ga0070675_100135338
372 Ga0070671_100027833
373 Ga0070673_100000017
374 Ga0070673_100267164
375 Ga0070673_100339021
376 Ga0070659_100064510
377 Ga0070659_100131621
378 Ga0070659_100156832
379 Ga0070659_100273625
380 Ga0070659_100345836
381 Ga0070659_100961673
382 Ga0070667_101396448
383 Ga0070714_100132585
384 Ga0070713_100581139
385 Ga0070663_100991711
386 Ga0070678_100043195
387 Ga0070678_100938109
388 Ga0070662_100152045
389 Ga0070662_100212012
390 Ga0070681_10173853
391 Ga0070681_10385139
392 Ga0068867_100000013
393 Ga0070679_100146888
394 Ga0070684_100473920
395 Ga0068853_100063290
396 Ga0068853_100109146
397 Ga0070672_100243609
398 Ga0068855_100008513
399 Ga0068855_100301102
400 Ga0070664_100800126
401 Ga0068857_100012610
402 Ga0068857_100074123
403 Ga0068856_100110611
404 Ga0068856_100697462
405 Ga0068852_100002509
406 Ga0068852_100598552
407 Ga0068852_101538998
408 Ga0068859_100050558
409 Ga0068866_10287394
410 Ga0068862_101139775
411 Ga0075366_10115651
412 Ga0097621_100035316
413 Ga0068871_100161524
414 Ga0068865_100000007
415 Ga0097620_100050558
416 Ga0105240_10216381
417 Ga0105240_10456246
418 Ga0105240_10738727
419 Ga0105245_10001648
420 Ga0105247_10033525
421 Ga0105243_10001477
422 Ga0105241_10817538
423 Ga0105242_10000196
424 Ga0105237_10242212
425 Ga0105237_10423661
426 Ga0105238_10014621
427 Ga0105238_10086663
428 Ga0105238_10491166
429 Ga0105249_10053951
430 Ga0105239_10023463
431 Ga0105239_10610562
432 Ga0105239_11172308
433 Ga0105246_10005216
434 Ga0157373_10053359
435 Ga0157373_10074056
436 Ga0157373_10751277
437 Ga0157371_10037979
438 Ga0157371_10099842
439 Ga0157370_10000692
440 Ga0157370_10099587
441 Ga0157370_10196150
442 Ga0157370_10223735
443 Ga0157369_10041278
444 Ga0157369_10081599
445 Ga0157369_10177943
446 Ga0157369_10559936
447 Ga0157374_10004516
448 Ga0157378_10000674
449 Ga0163162_10401600
450 Ga0157372_10015332
451 Ga0157372_10121678
452 Ga0157372_10167057
453 Ga0157372_10169481
454 Ga0157372_10412268
455 Ga0157375_10141229
456 Ga0157375_10228490
457 Ga0157377_10002668
458 Ga0157379_10097054
459 Ga0157376_10000081
460 Ga0157376_10301935
461 Ga0163161_10405781
462 Ga0207427_100290
463 Ga0209026_1003029
464 Ga0209148_1000074
465 Ga0209148_1003329
466 Ga0209233_1000003
467 Ga0209455_1003491
468 Ga0207682_10048298
469 Ga0207647_10021174
470 Ga0207647_10049209
471 Ga0207647_10066357
472 Ga0207647_10103154
473 Ga0207647_10124694
474 Ga0207645_10001106
475 Ga0207645_10692458
476 Ga0207705_10000044
477 Ga0207705_10000078
478 Ga0207705_10013691
479 Ga0207705_10083712
480 Ga0207654_10709065
481 Ga0207695_10388268
482 Ga0207695_10622820
483 Ga0207695_10946422
484 Ga0207671_10389122
485 Ga0207657_10000696
486 Ga0207657_10012436
487 Ga0207657_10064511
488 Ga0207657_10189409
489 Ga0207657_10886469
490 Ga0207694_10008167
491 Ga0207650_10178476
492 Ga0207659_10184966
493 Ga0207659_10357002
494 Ga0207687_10016994
495 Ga0207664_10151485
496 Ga0207644_10019034
497 Ga0207690_10224919
498 Ga0207690_10360254
499 Ga0207690_10749865
500 Ga0207706_10101198
501 Ga0207706_10152750
502 Ga0207706_10238040
503 Ga0207706_10552984
504 Ga0207686_10000260
505 Ga0207709_10000156
506 Ga0207704_10000017
507 Ga0207691_10147407
508 Ga0207689_10011538
509 Ga0207661_10516950
510 Ga0207667_10485802
511 Ga0207651_10000011
512 Ga0207651_10691072
513 Ga0207712_10022228
514 Ga0207640_11038743
515 Ga0207677_10000173
516 Ga0207703_10143148
517 Ga0207639_10027275
518 Ga0207639_10329338
519 Ga0207678_10422984
520 Ga0207702_10114941
521 Ga0207702_10684597
522 Ga0207648_10000045
523 Ga0207674_10007682
524 Ga0207674_10019058
525 Ga0207674_11193538
526 Ga0207683_10129417
527 Ga0207683_10989646
528 Ga0207698_10016146
529 Ga0207698_10079117
530 Ga0207698_10734411
531 Ga0207698_11236404
532 Ga0268265_11635588
533 Ga0307413_10396669
534 Ga0307413_10400511
535 Ga0307409_100269027
536 Ga0307409_100530375
537 Ga0307416_100187048
538 Ga0307416_100277672
539 Ga0307414_10000536
540 Ga0307414_10037815
541 Ga0307414_10406585
542 Ga0307411_10152681
543 Ga0307411_10277099
544 Ga0307411_10330368
545 Ga0307415_101015008
546 Ga0307415_102345575
547 Ga0373931_0347328
548 Ga0395899_0020957
549 Ga0395899_0037068
550 Ga0395899_0183440
551 Ga0395899_0211493
552 Ga0395899_0259876
553 Ga0395900_0001394
554 Ga0395900_0002890
555 Ga0395900_0263513
556 Ga0395900_0400995
557 Ga0395900_0408626
558 Ga0395900_1471471
559 Ga0395898_0583433
560 Ga0395905_0001106
561 Ga0395905_0132689
562 Ga0395905_0426722
563 Ga0395901_0034703
564 Ga0395901_0809546
565 Ga0439448_0097568
566 Ga0439448_0169470
567 Ga0439455_0015935
568 Ga0439458_0000352
569 Ga0439458_0004590
570 Ga0439458_0090419
571 Ga0466972_0060729
572 Ga0466965_0015417
573 Ga0466965_0261305
574 Ga0466965_0447126
575 Ga0466966_0216886
576 Ga0466966_0283919
577 Ga0466966_0747925
578 Ga0466961_0071915
579 Ga0466963_0042905
580 Ga0466963_1299885
581 Ga0466964_0003480
582 Ga0466964_0087528
583 Ga0466971_0010051
584 Ga0466971_0224940
585 Ga0466970_0058984
586 Ga0466957_0280031
587 Ga0466957_0568485
588 Ga0466960_0002004
589 Ga0466960_0007103
590 Ga0466960_0287622
591 Ga0466959_0051737
592 Ga0466958_0068107
593 Ga0466958_0070056
594 Ga0466958_0090145
595 Ga0466958_0420682
596 Ga0466958_0789368
597 Ga0466967_0018297
598 Ga0466967_0068055
599 Ga0466967_0261754
600 Ga0466967_0339955
601 Ga0466967_0458231
602 Ga0466967_1087243
603 Ga0466967_1097691
604 Ga0495663_0004434
605 Ga0495670_0020857
606 Ga0495670_0262392
607 Ga0495649_0192572
608 Ga0495687_131091
609 Ga0496108_0936326
610 Ga0496110_0317165
611 Ga0496111_0250037
612 Ga0501257_154796
613 nmdc:mga0k408_287726_c1
614 nmdc:mga07m45_230858_c1
615 Ga0500658_0451668
616 Ga0500611_019279
617 Ga0500587_000331
618 Ga0466962_0194434
619 Ga0466962_0470501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.924 21 65
1z05-assembly1.cif.gz_A-2 crystal structure of the rok family transcriptional regulator, homolog of e.coli mlc protein. 0.9143 21 65
3f22-assembly1.cif.gz_B crystal structure of zalpha in complex with d(cgtacg) 0.9061 21 65
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8979 21 74
1j75-assembly1.cif.gz_A-2 crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna 0.8968 21 73
ID Description Score Start End Superfamily
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9121 32 74 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9046 21 72 1.10.10.10
af_P71977_12_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9001 21 75 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8979 21 74 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.894 19 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6G7ZPV4-F1-model_v4 Transcriptional regulator 0.973 1 122
AF-A0A6G7ZPV4-F1-model_v4 Transcriptional regulator 0.9652 1 122
AF-A0A853FZJ4-F1-model_v4 IclR family transcriptional regulator 0.9448 21 74 GO:0003677
GO:0003700
GO:0045892
AF-A0A7X6BMA8-F1-model_v4 Uncharacterized protein 0.9369 1 104
AF-A0A5A7VJV5-F1-model_v4 MarR family transcriptional regulator 0.9331 5 118

Map