F399908

General Info

Members Datasets Scaffolds Average Seq Length
308 169 616 301

Family's Representative Sequence

Representative Sequence 3300049652|Ga0501202_008345|Ga0501202_008345_418_1413
Length 331
Sequence LPIADLWRIADVKKQIGNRKLAIGNESASRLADTLRHLGTTWLFIKLGLADLPPLTFAGIRFVIACVILFVIIRLRDVRLPRARADWILLSISGILSFGLNYGLVFWGEQYISSGLAALLQATLPAFGLVFAHLYLPGERLSWAKIGGVVLGVCGVGVVFSNQLAIAGRQALAGCVALILSAIFAAYSNVLVKKYGKHLDPAILAAGQMFFGLLLLLGVGISLEGNPLRFHWTPIALLSLLYLAVIGSVIAFLLYYWLVLNMDVTKSMMIALVTPVVAVLLGMIVLDEQIGWRTLAGGAMIMSGIAFIVVRRGNRTSSRDLVSPTEFEVDS

Samples

Sample ID Description Type Environment
1 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
148 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
149 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
152 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
153 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
154 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
155 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 22.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501202_008345 3300049652 Unclassified 1887
2 MRS1b_contig_7289058 2162886011 Unclassified 1395
3 CNAas_1000508 3300000532 Bacteria 3807
4 JGI24748J21848_1000006 3300002074 Bacteria 212677
5 JGI24034J26672_10000002 3300002239 Bacteria 925353
6 JGI24751J29686_10000019 3300002459 Bacteria 107056
7 rootH2_10204870 3300003320 Bacteria 1726
8 Ga0065714_10002203 3300005288 Bacteria 58048
9 Ga0065704_10092198 3300005289 Bacteria 2668
10 Ga0065704_10094085 3300005289 Bacteria 2562
11 Ga0065704_10097298 3300005289 Unclassified 2401
12 Ga0065712_10000140 3300005290 Bacteria 58055
13 Ga0065712_10070075 3300005290 Bacteria 6353
14 Ga0065715_10120367 3300005293 Bacteria 2260
15 Ga0065715_10152456 3300005293 Unclassified 1707
16 Ga0065715_10264690 3300005293 Unclassified 1128
17 Ga0065707_10002471 3300005295 Bacteria 4547
18 Ga0070670_100000291 3300005331 Bacteria 44111
19 Ga0070670_100067115 3300005331 Bacteria 3079
20 Ga0070670_100194988 3300005331 Unclassified 1759
21 Ga0070680_100097538 3300005336 Bacteria 2437
22 Ga0070682_100019993 3300005337 Bacteria 3934
23 Ga0068868_100025126 3300005338 Bacteria 4526
24 Ga0070689_100015022 3300005340 Bacteria 5637
25 Ga0070689_100250582 3300005340 Unclassified 1461
26 Ga0070687_100001342 3300005343 Bacteria 8627
27 Ga0070692_10023304 3300005345 Unclassified 3032
28 Ga0070669_100002335 3300005353 Bacteria 13711
29 Ga0070669_100020116 3300005353 Bacteria 4765
30 Ga0070673_100116866 3300005364 Unclassified 2219
31 Ga0070673_100122440 3300005364 Bacteria 2172
32 Ga0070701_10066096 3300005438 Unclassified 1921
33 Ga0070705_100013016 3300005440 Bacteria 4245
34 Ga0070705_100363334 3300005440 Unclassified 1060
35 Ga0070700_100000264 3300005441 Bacteria 28021
36 Ga0070700_100005771 3300005441 Bacteria 6571
37 Ga0070700_100006766 3300005441 Bacteria 6143
38 Ga0070694_100025251 3300005444 Bacteria 3843
39 Ga0070694_100029207 3300005444 Unclassified 3596
40 Ga0070694_100054956 3300005444 Bacteria 2699
41 Ga0070694_100172555 3300005444 Bacteria 1594
42 Ga0070708_100015769 3300005445 Bacteria 6246
43 Ga0070708_100081438 3300005445 Bacteria 2931
44 Ga0070708_100218087 3300005445 Bacteria 1789
45 Ga0070662_100067025 3300005457 Bacteria 2635
46 Ga0068867_100265558 3300005459 Bacteria 1401
47 Ga0068867_100310644 3300005459 Bacteria 1303
48 Ga0070699_100001463 3300005518 Bacteria 21633
49 Ga0070699_100059832 3300005518 Bacteria 3300
50 Ga0070699_100256074 3300005518 Bacteria 1565
51 Ga0070699_100466024 3300005518 Unclassified 1146
52 Ga0070697_100000598 3300005536 Bacteria 27378
53 Ga0070697_100033949 3300005536 Unclassified 4111
54 Ga0068853_100103299 3300005539 Unclassified 2523
55 Ga0070686_100002844 3300005544 Bacteria 9535
56 Ga0070695_100063562 3300005545 Bacteria 2399
57 Ga0070696_100030214 3300005546 Bacteria 3708
58 Ga0070696_100039711 3300005546 Bacteria 3249
59 Ga0070693_100133665 3300005547 Unclassified 1554
60 Ga0070704_100376090 3300005549 Unclassified 1206
61 Ga0068857_100112185 3300005577 Bacteria 2451
62 Ga0068854_100059184 3300005578 Bacteria 2768
63 Ga0068854_100069894 3300005578 Bacteria 2565
64 Ga0068856_100080023 3300005614 Unclassified 3241
65 Ga0070702_100023929 3300005615 Bacteria 3252
66 Ga0068859_100106547 3300005617 Bacteria 2862
67 Ga0068859_100121655 3300005617 Unclassified 2677
68 Ga0068859_100130821 3300005617 Bacteria 2581
69 Ga0068859_100249944 3300005617 Bacteria 1863
70 Ga0068859_100620281 3300005617 Unclassified 1174
71 Ga0068859_100808527 3300005617 Unclassified 1025
72 Ga0068864_100040526 3300005618 Bacteria 3984
73 Ga0068864_100054402 3300005618 Bacteria 3454
74 Ga0068864_100133185 3300005618 Bacteria 2235
75 Ga0068866_10001509 3300005718 Bacteria 9903
76 Ga0068861_100135248 3300005719 Bacteria 2005
77 Ga0068861_100141719 3300005719 Bacteria 1962
78 Ga0068851_10143948 3300005834 Unclassified 1298
79 Ga0068870_10009834 3300005840 Bacteria 4366
80 Ga0068863_100039477 3300005841 Bacteria 4490
81 Ga0068858_100000099 3300005842 Bacteria 90483
82 Ga0068858_100131882 3300005842 Unclassified 2344
83 Ga0068858_100145402 3300005842 Bacteria 2226
84 Ga0068860_100027245 3300005843 Bacteria 5505
85 Ga0068860_100071354 3300005843 Bacteria 3301
86 Ga0068860_100161790 3300005843 Unclassified 2159
87 Ga0068860_100617817 3300005843 Unclassified 1090
88 Ga0068862_100003234 3300005844 Bacteria 14097
89 Ga0068862_100247225 3300005844 Unclassified 1624
90 Ga0068862_100616208 3300005844 Unclassified 1044
91 Ga0081455_10008230 3300005937 Bacteria 10869
92 Ga0081455_10044736 3300005937 Bacteria 3858
93 Ga0081455_10176795 3300005937 Bacteria 1620
94 Ga0081539_10003589 3300005985 Bacteria 18787
95 Ga0070716_100000028 3300006173 Bacteria 62646
96 Ga0097621_100087955 3300006237 Bacteria 2595
97 Ga0097621_100264511 3300006237 Bacteria 1510
98 Ga0068871_100005355 3300006358 Bacteria 8991
99 Ga0068871_100183644 3300006358 Bacteria 1798
100 Ga0075428_100280883 3300006844 Bacteria 1791
101 Ga0075430_100268763 3300006846 Unclassified 1412
102 Ga0075431_100110951 3300006847 Unclassified 2831
103 Ga0075431_100117817 3300006847 Bacteria 2740
104 Ga0075431_100154980 3300006847 Bacteria 2357
105 Ga0075433_10009160 3300006852 Bacteria 7907
106 Ga0075433_10010186 3300006852 Bacteria 7540
107 Ga0075433_10034327 3300006852 Bacteria 4356
108 Ga0075433_10112305 3300006852 Bacteria 2417
109 Ga0075433_10148281 3300006852 Bacteria 2086
110 Ga0075433_10256262 3300006852 Bacteria 1552
111 Ga0075434_100064388 3300006871 Unclassified 3650
112 Ga0075434_100177674 3300006871 Unclassified 2149
113 Ga0075429_100066019 3300006880 Unclassified 3150
114 Ga0075429_100367516 3300006880 Unclassified 1260
115 Ga0075436_100000005 3300006914 Bacteria 360336
116 Ga0097620_100106539 3300006931 Bacteria 2862
117 Ga0097620_100121658 3300006931 Unclassified 2677
118 Ga0097620_100130806 3300006931 Bacteria 2581
119 Ga0097620_100249950 3300006931 Bacteria 1863
120 Ga0097620_100620270 3300006931 Unclassified 1174
121 Ga0097620_100808547 3300006931 Unclassified 1025
122 Ga0075435_100000470 3300007076 Bacteria 24508
123 Ga0105251_10104076 3300009011 Bacteria 1297
124 Ga0111539_10004246 3300009094 Bacteria 18767
125 Ga0111539_10077762 3300009094 Bacteria 3905
126 Ga0111539_10104722 3300009094 Bacteria 3320
127 Ga0111539_10467732 3300009094 Bacteria 1468
128 Ga0105245_10524470 3300009098 Unclassified 1203
129 Ga0105247_10000001 3300009101 Bacteria 739726
130 Ga0105247_10004872 3300009101 Bacteria 8542
131 Ga0105247_10041084 3300009101 Bacteria 2829
132 Ga0114129_10028382 3300009147 Bacteria 7930
133 Ga0114129_10149334 3300009147 Bacteria 3199
134 Ga0114129_10307755 3300009147 Bacteria 2110
135 Ga0114129_10374207 3300009147 Bacteria 1882
136 Ga0114129_10721604 3300009147 Unclassified 1279
137 Ga0105243_10003534 3300009148 Bacteria 12632
138 Ga0105243_10026368 3300009148 Bacteria 4448
139 Ga0105243_10441758 3300009148 Bacteria 1218
140 Ga0105241_10081741 3300009174 Bacteria 2531
141 Ga0105241_10276534 3300009174 Unclassified 1432
142 Ga0105242_10002982 3300009176 Bacteria 13245
143 Ga0105242_10026615 3300009176 Bacteria 4585
144 Ga0105242_10029723 3300009176 Bacteria 4358
145 Ga0105242_10158648 3300009176 Unclassified 1978
146 Ga0105242_10197007 3300009176 Bacteria 1787
147 Ga0105248_10227787 3300009177 Bacteria 2098
148 Ga0105238_10301603 3300009551 Bacteria 1586
149 Ga0105249_10012301 3300009553 Bacteria 7541
150 Ga0105249_10174571 3300009553 Bacteria 2086
151 Ga0105239_10145045 3300010375 Bacteria 2647
152 Ga0105239_10252165 3300010375 Bacteria 1982
153 Ga0105246_10040686 3300011119 Bacteria 3139
154 Ga0105246_10051514 3300011119 Bacteria 2827
155 Ga0105246_10121870 3300011119 Unclassified 1934
156 Ga0157373_10020672 3300013100 Bacteria 4781
157 Ga0157373_10265364 3300013100 Bacteria 1215
158 Ga0157371_10171189 3300013102 Bacteria 1552
159 Ga0157378_10000001 3300013297 Bacteria 352632
160 Ga0163162_10047053 3300013306 Bacteria 4324
161 Ga0163162_10072933 3300013306 Bacteria 3488
162 Ga0163162_10103107 3300013306 Bacteria 2946
163 Ga0163162_10138856 3300013306 Bacteria 2542
164 Ga0163162_10269086 3300013306 Bacteria 1836
165 Ga0157372_10007062 3300013307 Bacteria 11965
166 Ga0157375_10002828 3300013308 Bacteria 15023
167 Ga0157375_10010336 3300013308 Bacteria 8216
168 Ga0157375_10069260 3300013308 Bacteria 3533
169 Ga0157375_10193168 3300013308 Bacteria 2191
170 Ga0163163_10050481 3300014325 Bacteria 4097
171 Ga0157380_10001877 3300014326 Bacteria 13926
172 Ga0157380_10214921 3300014326 Bacteria 1716
173 Ga0207713_1068416 3300025735 Bacteria 1320
174 Ga0207642_10112401 3300025899 Unclassified 1389
175 Ga0207710_10000003 3300025900 Bacteria 1071597
176 Ga0207710_10000525 3300025900 Bacteria 23439
177 Ga0207710_10022210 3300025900 Bacteria 2723
178 Ga0207647_10027524 3300025904 Bacteria 3706
179 Ga0207645_10113681 3300025907 Bacteria 1754
180 Ga0207643_10005678 3300025908 Bacteria 6675
181 Ga0207643_10099218 3300025908 Bacteria 1706
182 Ga0207684_10017387 3300025910 Bacteria 6170
183 Ga0207654_10054520 3300025911 Bacteria 2311
184 Ga0207707_10015102 3300025912 Bacteria 6722
185 Ga0207671_10303224 3300025914 Unclassified 1262
186 Ga0207662_10009476 3300025918 Bacteria 5359
187 Ga0207662_10055472 3300025918 Bacteria 2365
188 Ga0207662_10232679 3300025918 Bacteria 1204
189 Ga0207681_10001070 3300025923 Bacteria 17768
190 Ga0207681_10105078 3300025923 Bacteria 2044
191 Ga0207694_10200708 3300025924 Bacteria 1623
192 Ga0207650_10000007 3300025925 Bacteria 530810
193 Ga0207644_10000831 3300025931 Bacteria 19619
194 Ga0207690_10058127 3300025932 Bacteria 2615
195 Ga0207686_10000653 3300025934 Bacteria 21390
196 Ga0207686_10000693 3300025934 Bacteria 20889
197 Ga0207686_10041552 3300025934 Bacteria 2805
198 Ga0207709_10002865 3300025935 Bacteria 10564
199 Ga0207709_10011964 3300025935 Bacteria 4784
200 Ga0207709_10165159 3300025935 Bacteria 1548
201 Ga0207709_10198775 3300025935 Bacteria 1430
202 Ga0207670_10002088 3300025936 Bacteria 10446
203 Ga0207670_10060630 3300025936 Bacteria 2578
204 Ga0207670_10133562 3300025936 Bacteria 1822
205 Ga0207665_10000075 3300025939 Bacteria 63685
206 Ga0207711_10010613 3300025941 Bacteria 7660
207 Ga0207711_10117106 3300025941 Bacteria 2376
208 Ga0207711_10268618 3300025941 Unclassified 1569
209 Ga0207689_10087999 3300025942 Unclassified 2551
210 Ga0207689_10159954 3300025942 Unclassified 1856
211 Ga0207679_10114241 3300025945 Bacteria 2137
212 Ga0207679_10224981 3300025945 Unclassified 1580
213 Ga0207651_10094136 3300025960 Bacteria 2202
214 Ga0207651_10208602 3300025960 Bacteria 1571
215 Ga0207712_10017933 3300025961 Bacteria 4607
216 Ga0207712_10020282 3300025961 Bacteria 4352
217 Ga0207677_10156725 3300026023 Bacteria 1764
218 Ga0207703_10000371 3300026035 Bacteria 47961
219 Ga0207703_10076688 3300026035 Unclassified 2773
220 Ga0207639_10172706 3300026041 Unclassified 1832
221 Ga0207708_10000591 3300026075 Bacteria 27979
222 Ga0207708_10001182 3300026075 Bacteria 19652
223 Ga0207708_10007725 3300026075 Bacteria 7964
224 Ga0207641_10051548 3300026088 Bacteria 3485
225 Ga0207641_10252914 3300026088 Bacteria 1646
226 Ga0207648_10553736 3300026089 Bacteria 1057
227 Ga0207676_10013138 3300026095 Bacteria 5944
228 Ga0207676_10185054 3300026095 Bacteria 1827
229 Ga0207676_10225577 3300026095 Unclassified 1672
230 Ga0207674_10023324 3300026116 Bacteria 6631
231 Ga0207674_10100914 3300026116 Bacteria 2867
232 Ga0207674_10154192 3300026116 Unclassified 2253
233 Ga0207674_10233640 3300026116 Bacteria 1786
234 Ga0207675_100111913 3300026118 Bacteria 2576
235 Ga0207675_100268931 3300026118 Unclassified 1654
236 Ga0207698_10274136 3300026142 Bacteria 1557
237 Ga0207428_10038464 3300027907 Bacteria 3889
238 Ga0207428_10074341 3300027907 Unclassified 2665
239 Ga0207428_10232603 3300027907 Unclassified 1379
240 Ga0268265_10024809 3300028380 Bacteria 4248
241 Ga0268265_10222124 3300028380 Bacteria 1654
242 Ga0268264_10030581 3300028381 Bacteria 4414
243 Ga0268264_10154657 3300028381 Unclassified 2060
244 Ga0307408_100011251 3300031548 Bacteria 5909
245 Ga0307405_10004034 3300031731 Bacteria 6891
246 Ga0307410_10217163 3300031852 Bacteria 1469
247 Ga0307406_10001500 3300031901 Bacteria 12885
248 Ga0307412_10006205 3300031911 Bacteria 6741
249 Ga0307414_10008744 3300032004 Bacteria 5771
250 Ga0307415_100020842 3300032126 Bacteria 4013
251 Ga0307415_100045349 3300032126 Bacteria 2947
252 Ga0373949_0013712 3300035090 Bacteria 1800
253 Ga0373951_0000523 3300035091 Bacteria 10817
254 Ga0373942_0007668 3300035207 Bacteria 2509
255 Ga0373961_0052980 3300035241 Bacteria 1210
256 Ga0373927_0104204 3300035695 Unclassified 1847
257 Ga0439455_0021380 3300042012 Bacteria 1542
258 Ga0450889_002940 3300042144 Bacteria 1685
259 Ga0453683_0106331 3300044673 Bacteria 1763
260 Ga0451576_0083249 3300045051 Bacteria 3328
261 Ga0495636_0025770 3300047318 Bacteria 2389
262 Ga0496106_0000956 3300048909 Bacteria 21070
263 Ga0496106_0100855 3300048909 Unclassified 2239
264 Ga0496107_0369348 3300048910 Unclassified 1067
265 Ga0496109_0000093 3300048912 Bacteria 93170
266 Ga0496112_0228853 3300048915 Bacteria 1814
267 Ga0501296_000761 3300049519 Unclassified 3192
268 Ga0501298_005322 3300049521 Unclassified 2060
269 Ga0501199_003699 3300049650 Unclassified 1479
270 Ga0501209_001504 3300049656 Bacteria 3321
271 Ga0501209_002143 3300049656 Bacteria 2971
272 Ga0501216_002296 3300049660 Bacteria 2699
273 Ga0501216_004231 3300049660 Unclassified 2124
274 Ga0501217_000121 3300049661 Bacteria 10267
275 Ga0501223_000295 3300049663 Bacteria 12542
276 Ga0501224_007936 3300049664 Unclassified 1547
277 Ga0501227_001651 3300049665 Bacteria 4967
278 Ga0501227_006180 3300049665 Bacteria 2574
279 Ga0501228_005278 3300049666 Unclassified 1141
280 Ga0501249_004667 3300049679 Bacteria 2787
281 Ga0501225_0005536 3300049705 Bacteria 3703
282 Ga0501225_0011384 3300049705 Bacteria 2503
283 Ga0501229_002331 3300049706 Bacteria 2241
284 Ga0501234_021005 3300049707 Unclassified 1039
285 Ga0501081_0201256 3300049743 Bacteria 1444
286 Ga0501226_000593 3300049853 Bacteria 4991
287 nmdc:mga05p37_123965_c1 3300050507 Bacteria 3174
288 nmdc:mga05p37_13332_c1 3300050507 Bacteria 9847
289 nmdc:mga05p37_188644_c1 3300050507 Bacteria 2505
290 nmdc:mga05p37_398110_c1 3300050507 Bacteria 1608
291 nmdc:mga05p37_90796_c1 3300050507 Bacteria 3764
292 nmdc:mga0qj67_61611_c1 3300050509 Bacteria 2979
293 nmdc:mga06r32_136531_c1 3300050510 Unclassified 2427
294 nmdc:mga08y16_147704_c1 3300050511 Bacteria 2443
295 nmdc:mga08y16_169366_c1 3300050511 Unclassified 2269
296 nmdc:mga08y16_6871_c1 3300050511 Bacteria 11932
297 nmdc:mga0n895_107950_c1 3300050512 Bacteria 2798
298 nmdc:mga0n895_410552_c1 3300050512 Bacteria 1369
299 nmdc:mga0n895_86897_c1 3300050512 Bacteria 3124
300 nmdc:mga0rr50_2862_c1 3300050513 Bacteria 9825
301 nmdc:mga0rr50_370_c2 3300050513 Bacteria 20890
302 nmdc:mga08x19_27_c1 3300050514 Bacteria 226652
303 nmdc:mga0a205_163005_c1 3300050515 Bacteria 2125
304 nmdc:mga0a205_2765_c1 3300050515 Bacteria 15493
305 nmdc:mga0a205_36063_c1 3300050515 Bacteria 4751
306 nmdc:mga0a205_5019_c1 3300050515 Bacteria 11920
307 nmdc:mga0a205_66503_c1 3300050515 Unclassified 3483
308 Ga0501084_0058699 3300054114 Bacteria 3220
309 Ga0501202_008345
310 MRS1b_contig_7289058
311 CNAas_1000508
312 JGI24748J21848_1000006
313 JGI24034J26672_10000002
314 JGI24751J29686_10000019
315 rootH2_10204870
316 Ga0065714_10002203
317 Ga0065704_10092198
318 Ga0065704_10094085
319 Ga0065704_10097298
320 Ga0065712_10000140
321 Ga0065712_10070075
322 Ga0065715_10120367
323 Ga0065715_10152456
324 Ga0065715_10264690
325 Ga0065707_10002471
326 Ga0070670_100000291
327 Ga0070670_100067115
328 Ga0070670_100194988
329 Ga0070680_100097538
330 Ga0070682_100019993
331 Ga0068868_100025126
332 Ga0070689_100015022
333 Ga0070689_100250582
334 Ga0070687_100001342
335 Ga0070692_10023304
336 Ga0070669_100002335
337 Ga0070669_100020116
338 Ga0070673_100116866
339 Ga0070673_100122440
340 Ga0070701_10066096
341 Ga0070705_100013016
342 Ga0070705_100363334
343 Ga0070700_100000264
344 Ga0070700_100005771
345 Ga0070700_100006766
346 Ga0070694_100025251
347 Ga0070694_100029207
348 Ga0070694_100054956
349 Ga0070694_100172555
350 Ga0070708_100015769
351 Ga0070708_100081438
352 Ga0070708_100218087
353 Ga0070662_100067025
354 Ga0068867_100265558
355 Ga0068867_100310644
356 Ga0070699_100001463
357 Ga0070699_100059832
358 Ga0070699_100256074
359 Ga0070699_100466024
360 Ga0070697_100000598
361 Ga0070697_100033949
362 Ga0068853_100103299
363 Ga0070686_100002844
364 Ga0070695_100063562
365 Ga0070696_100030214
366 Ga0070696_100039711
367 Ga0070693_100133665
368 Ga0070704_100376090
369 Ga0068857_100112185
370 Ga0068854_100059184
371 Ga0068854_100069894
372 Ga0068856_100080023
373 Ga0070702_100023929
374 Ga0068859_100106547
375 Ga0068859_100121655
376 Ga0068859_100130821
377 Ga0068859_100249944
378 Ga0068859_100620281
379 Ga0068859_100808527
380 Ga0068864_100040526
381 Ga0068864_100054402
382 Ga0068864_100133185
383 Ga0068866_10001509
384 Ga0068861_100135248
385 Ga0068861_100141719
386 Ga0068851_10143948
387 Ga0068870_10009834
388 Ga0068863_100039477
389 Ga0068858_100000099
390 Ga0068858_100131882
391 Ga0068858_100145402
392 Ga0068860_100027245
393 Ga0068860_100071354
394 Ga0068860_100161790
395 Ga0068860_100617817
396 Ga0068862_100003234
397 Ga0068862_100247225
398 Ga0068862_100616208
399 Ga0081455_10008230
400 Ga0081455_10044736
401 Ga0081455_10176795
402 Ga0081539_10003589
403 Ga0070716_100000028
404 Ga0097621_100087955
405 Ga0097621_100264511
406 Ga0068871_100005355
407 Ga0068871_100183644
408 Ga0075428_100280883
409 Ga0075430_100268763
410 Ga0075431_100110951
411 Ga0075431_100117817
412 Ga0075431_100154980
413 Ga0075433_10009160
414 Ga0075433_10010186
415 Ga0075433_10034327
416 Ga0075433_10112305
417 Ga0075433_10148281
418 Ga0075433_10256262
419 Ga0075434_100064388
420 Ga0075434_100177674
421 Ga0075429_100066019
422 Ga0075429_100367516
423 Ga0075436_100000005
424 Ga0097620_100106539
425 Ga0097620_100121658
426 Ga0097620_100130806
427 Ga0097620_100249950
428 Ga0097620_100620270
429 Ga0097620_100808547
430 Ga0075435_100000470
431 Ga0105251_10104076
432 Ga0111539_10004246
433 Ga0111539_10077762
434 Ga0111539_10104722
435 Ga0111539_10467732
436 Ga0105245_10524470
437 Ga0105247_10000001
438 Ga0105247_10004872
439 Ga0105247_10041084
440 Ga0114129_10028382
441 Ga0114129_10149334
442 Ga0114129_10307755
443 Ga0114129_10374207
444 Ga0114129_10721604
445 Ga0105243_10003534
446 Ga0105243_10026368
447 Ga0105243_10441758
448 Ga0105241_10081741
449 Ga0105241_10276534
450 Ga0105242_10002982
451 Ga0105242_10026615
452 Ga0105242_10029723
453 Ga0105242_10158648
454 Ga0105242_10197007
455 Ga0105248_10227787
456 Ga0105238_10301603
457 Ga0105249_10012301
458 Ga0105249_10174571
459 Ga0105239_10145045
460 Ga0105239_10252165
461 Ga0105246_10040686
462 Ga0105246_10051514
463 Ga0105246_10121870
464 Ga0157373_10020672
465 Ga0157373_10265364
466 Ga0157371_10171189
467 Ga0157378_10000001
468 Ga0163162_10047053
469 Ga0163162_10072933
470 Ga0163162_10103107
471 Ga0163162_10138856
472 Ga0163162_10269086
473 Ga0157372_10007062
474 Ga0157375_10002828
475 Ga0157375_10010336
476 Ga0157375_10069260
477 Ga0157375_10193168
478 Ga0163163_10050481
479 Ga0157380_10001877
480 Ga0157380_10214921
481 Ga0207713_1068416
482 Ga0207642_10112401
483 Ga0207710_10000003
484 Ga0207710_10000525
485 Ga0207710_10022210
486 Ga0207647_10027524
487 Ga0207645_10113681
488 Ga0207643_10005678
489 Ga0207643_10099218
490 Ga0207684_10017387
491 Ga0207654_10054520
492 Ga0207707_10015102
493 Ga0207671_10303224
494 Ga0207662_10009476
495 Ga0207662_10055472
496 Ga0207662_10232679
497 Ga0207681_10001070
498 Ga0207681_10105078
499 Ga0207694_10200708
500 Ga0207650_10000007
501 Ga0207644_10000831
502 Ga0207690_10058127
503 Ga0207686_10000653
504 Ga0207686_10000693
505 Ga0207686_10041552
506 Ga0207709_10002865
507 Ga0207709_10011964
508 Ga0207709_10165159
509 Ga0207709_10198775
510 Ga0207670_10002088
511 Ga0207670_10060630
512 Ga0207670_10133562
513 Ga0207665_10000075
514 Ga0207711_10010613
515 Ga0207711_10117106
516 Ga0207711_10268618
517 Ga0207689_10087999
518 Ga0207689_10159954
519 Ga0207679_10114241
520 Ga0207679_10224981
521 Ga0207651_10094136
522 Ga0207651_10208602
523 Ga0207712_10017933
524 Ga0207712_10020282
525 Ga0207677_10156725
526 Ga0207703_10000371
527 Ga0207703_10076688
528 Ga0207639_10172706
529 Ga0207708_10000591
530 Ga0207708_10001182
531 Ga0207708_10007725
532 Ga0207641_10051548
533 Ga0207641_10252914
534 Ga0207648_10553736
535 Ga0207676_10013138
536 Ga0207676_10185054
537 Ga0207676_10225577
538 Ga0207674_10023324
539 Ga0207674_10100914
540 Ga0207674_10154192
541 Ga0207674_10233640
542 Ga0207675_100111913
543 Ga0207675_100268931
544 Ga0207698_10274136
545 Ga0207428_10038464
546 Ga0207428_10074341
547 Ga0207428_10232603
548 Ga0268265_10024809
549 Ga0268265_10222124
550 Ga0268264_10030581
551 Ga0268264_10154657
552 Ga0307408_100011251
553 Ga0307405_10004034
554 Ga0307410_10217163
555 Ga0307406_10001500
556 Ga0307412_10006205
557 Ga0307414_10008744
558 Ga0307415_100020842
559 Ga0307415_100045349
560 Ga0373949_0013712
561 Ga0373951_0000523
562 Ga0373942_0007668
563 Ga0373961_0052980
564 Ga0373927_0104204
565 Ga0439455_0021380
566 Ga0450889_002940
567 Ga0453683_0106331
568 Ga0451576_0083249
569 Ga0495636_0025770
570 Ga0496106_0000956
571 Ga0496106_0100855
572 Ga0496107_0369348
573 Ga0496109_0000093
574 Ga0496112_0228853
575 Ga0501296_000761
576 Ga0501298_005322
577 Ga0501199_003699
578 Ga0501209_001504
579 Ga0501209_002143
580 Ga0501216_002296
581 Ga0501216_004231
582 Ga0501217_000121
583 Ga0501223_000295
584 Ga0501224_007936
585 Ga0501227_001651
586 Ga0501227_006180
587 Ga0501228_005278
588 Ga0501249_004667
589 Ga0501225_0005536
590 Ga0501225_0011384
591 Ga0501229_002331
592 Ga0501234_021005
593 Ga0501081_0201256
594 Ga0501226_000593
595 nmdc:mga05p37_123965_c1
596 nmdc:mga05p37_13332_c1
597 nmdc:mga05p37_188644_c1
598 nmdc:mga05p37_398110_c1
599 nmdc:mga05p37_90796_c1
600 nmdc:mga0qj67_61611_c1
601 nmdc:mga06r32_136531_c1
602 nmdc:mga08y16_147704_c1
603 nmdc:mga08y16_169366_c1
604 nmdc:mga08y16_6871_c1
605 nmdc:mga0n895_107950_c1
606 nmdc:mga0n895_410552_c1
607 nmdc:mga0n895_86897_c1
608 nmdc:mga0rr50_2862_c1
609 nmdc:mga0rr50_370_c2
610 nmdc:mga08x19_27_c1
611 nmdc:mga0a205_163005_c1
612 nmdc:mga0a205_2765_c1
613 nmdc:mga0a205_36063_c1
614 nmdc:mga0a205_5019_c1
615 nmdc:mga0a205_66503_c1
616 Ga0501084_0058699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

37

161

0.97

PF00892

EamA

EamA-like transporter family

172

310

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.8169 2 291
5y79-assembly1.cif.gz_B crystal structure of the triose-phosphate/phosphate translocator in complex with 3-phosphoglycerate 0.7803 2 291
5i20-assembly2.cif.gz_B crystal structure of protein 0.7484 1 286
5i20-assembly3.cif.gz_C crystal structure of protein 0.7444 2 288
5i20-assembly1.cif.gz_A crystal structure of protein 0.7438 2 286
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8317 6 286 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8037 1 293 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.775 1 293 1.20.1740.10
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.771 6 286 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7273 1 288 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A7V4W526-F1-model_v4 EamA domain-containing protein 0.9628 3 285 GO:0016020
AF-A0A838NN70-F1-model_v4 EamA family transporter 0.9517 2 267 GO:0016020
AF-A0A7W1DR76-F1-model_v4 DMT family transporter 0.9516 1 289 GO:0016020
AF-A0A7W0XGY4-F1-model_v4 EamA family transporter 0.9508 1 295 GO:0016020
AF-A0A2V8NEK0-F1-model_v4 EamA domain-containing protein 0.9501 3 294 GO:0016020

Map