F399885

General Info

Members Datasets Scaffolds Average Seq Length
308 190 304 252

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0087797|Ga0496120_0087797_52_891
Length 279
Sequence MGHLPAQGLALTQPGEDDRRMSQFDVSAEAYVRFMGRFSSVLAGPFADVGLRGVPSSAAVLDVGCGPGMLTAELARRRGESRVSAVDPEQGFAEATAAAFPASDVHQAPAEHLPFTDGSFGATLAQLVVQFMSDPVAGLAEMARVTAAGGRVSACVWDFGGGTGALSGFWRAAMRTDPDATGEGERPGTTAGDLTRLFTLAGLRDVHESVLTAAIDFPTFEDWWQPFTLGVGPAGVYVASLDAAGRARLEADLRSEYGDGPFTIHAGALTATGTVAAPA

Samples

Sample ID Description Type Environment
1 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
2 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
3 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
4 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 0
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 0
Rhizoplane 15.58
Rhizosphere 78.9
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10073606 3300003320 Bacteria 5132
2 Ga0070670_100022561 3300005331 Bacteria 5416
3 Ga0070680_100023006 3300005336 Bacteria 4966
4 Ga0070682_100007824 3300005337 Bacteria 6015
5 Ga0070682_100085798 3300005337 Bacteria 2049
6 Ga0070660_100408360 3300005339 Bacteria 1123
7 Ga0070660_100650403 3300005339 Bacteria 883
8 Ga0070689_100152769 3300005340 Bacteria 1862
9 Ga0070691_10056996 3300005341 Bacteria 1874
10 Ga0070692_10007381 3300005345 Bacteria 4837
11 Ga0070675_100102753 3300005354 Bacteria 2408
12 Ga0070671_100030949 3300005355 Bacteria 4418
13 Ga0070659_100012720 3300005366 Bacteria 6245
14 Ga0070659_100090285 3300005366 Bacteria 2455
15 Ga0070659_100195880 3300005366 Bacteria 1662
16 Ga0070667_100002017 3300005367 Bacteria 17988
17 Ga0070667_100046307 3300005367 Bacteria 3658
18 Ga0070667_100401357 3300005367 Unclassified 1248
19 Ga0070709_10025485 3300005434 Bacteria 3495
20 Ga0070714_100198525 3300005435 Bacteria 1834
21 Ga0070713_100082615 3300005436 Bacteria 2744
22 Ga0070701_10163680 3300005438 Bacteria 1290
23 Ga0070711_100230344 3300005439 Bacteria 1444
24 Ga0070700_100104601 3300005441 Bacteria 1871
25 Ga0070700_100270402 3300005441 Bacteria 1228
26 Ga0070678_100001999 3300005456 Bacteria 11014
27 Ga0070662_100118495 3300005457 Bacteria 2026
28 Ga0070685_10039632 3300005466 Bacteria 2677
29 Ga0070685_10101115 3300005466 Bacteria 1761
30 Ga0070685_10112227 3300005466 Bacteria 1681
31 Ga0070706_100702758 3300005467 Bacteria 938
32 Ga0070699_100642032 3300005518 Bacteria 969
33 Ga0070679_100174153 3300005530 Bacteria 2124
34 Ga0068853_100013446 3300005539 Bacteria 6682
35 Ga0068853_100091495 3300005539 Bacteria 2675
36 Ga0068853_100138154 3300005539 Bacteria 2186
37 Ga0070672_100093967 3300005543 Bacteria 2423
38 Ga0070665_100029587 3300005548 Bacteria 5512
39 Ga0070665_100168902 3300005548 Bacteria 2189
40 Ga0068857_100005474 3300005577 Bacteria 10829
41 Ga0068857_100113775 3300005577 Bacteria 2433
42 Ga0068854_100258018 3300005578 Bacteria 1395
43 Ga0068856_100032068 3300005614 Bacteria 5142
44 Ga0068856_100070706 3300005614 Bacteria 3453
45 Ga0070702_100051115 3300005615 Bacteria 2365
46 Ga0068852_100042807 3300005616 Bacteria 3836
47 Ga0068852_100048634 3300005616 Bacteria 3624
48 Ga0068852_100052201 3300005616 Bacteria 3513
49 Ga0068852_100299956 3300005616 Unclassified 1555
50 Ga0068859_100137506 3300005617 Bacteria 2517
51 Ga0068864_100294989 3300005618 Bacteria 1516
52 Ga0068866_10070995 3300005718 Bacteria 1840
53 Ga0068851_10000003 3300005834 Bacteria 293018
54 Ga0068870_10015353 3300005840 Bacteria 3631
55 Ga0068863_100039224 3300005841 Bacteria 4507
56 Ga0068858_100000293 3300005842 Bacteria 54164
57 Ga0068858_100032102 3300005842 Bacteria 4878
58 Ga0068858_100571616 3300005842 Bacteria 1095
59 Ga0068860_100022338 3300005843 Bacteria 6121
60 Ga0068860_100092006 3300005843 Bacteria 2890
61 Ga0068862_100126043 3300005844 Bacteria 2261
62 Ga0081455_10000030 3300005937 Bacteria 148346
63 Ga0075365_10245810 3300006038 Bacteria 1257
64 Ga0075365_10261374 3300006038 Bacteria 1217
65 Ga0075432_10021688 3300006058 Bacteria 2196
66 Ga0068871_100089966 3300006358 Bacteria 2556
67 Ga0075428_100003091 3300006844 Bacteria 18165
68 Ga0075428_100003214 3300006844 Bacteria 17874
69 Ga0075430_100033444 3300006846 Bacteria 4364
70 Ga0075431_100016337 3300006847 Bacteria 7529
71 Ga0075433_10288747 3300006852 Bacteria 1453
72 Ga0075433_10462260 3300006852 Bacteria 1118
73 Ga0075434_100243288 3300006871 Bacteria 1819
74 Ga0075429_100010783 3300006880 Bacteria 7903
75 Ga0075436_100097148 3300006914 Bacteria 2049
76 Ga0097620_100137503 3300006931 Bacteria 2517
77 Ga0075435_100160305 3300007076 Bacteria 1894
78 Ga0105251_10050556 3300009011 Bacteria 1985
79 Ga0105240_10315835 3300009093 Unclassified 1782
80 Ga0111539_10007749 3300009094 Bacteria 13712
81 Ga0111539_10239630 3300009094 Bacteria 2111
82 Ga0105245_10010110 3300009098 Bacteria 8218
83 Ga0105245_10013894 3300009098 Bacteria 7012
84 Ga0105245_10062828 3300009098 Bacteria 3351
85 Ga0105245_10208794 3300009098 Bacteria 1879
86 Ga0105245_10332117 3300009098 Bacteria 1501
87 Ga0105247_10010177 3300009101 Bacteria 5696
88 Ga0114129_10017811 3300009147 Bacteria 10114
89 Ga0114129_10553639 3300009147 Bacteria 1495
90 Ga0105243_10124342 3300009148 Bacteria 2180
91 Ga0105243_10562551 3300009148 Bacteria 1091
92 Ga0105241_10008192 3300009174 Bacteria 7694
93 Ga0105241_10048472 3300009174 Bacteria 3233
94 Ga0105242_10132885 3300009176 Bacteria 2150
95 Ga0105248_10079660 3300009177 Bacteria 3681
96 Ga0105248_10122227 3300009177 Bacteria 2937
97 Ga0105237_10008872 3300009545 Bacteria 10838
98 Ga0105237_10035219 3300009545 Bacteria 5066
99 Ga0105237_10109873 3300009545 Bacteria 2749
100 Ga0105238_10004693 3300009551 Bacteria 13519
101 Ga0105249_10368765 3300009553 Bacteria 1459
102 Ga0105239_10050307 3300010375 Bacteria 4571
103 Ga0105239_10252206 3300010375 Unclassified 1982
104 Ga0105239_10938100 3300010375 Unclassified 994
105 Ga0105246_10061094 3300011119 Bacteria 2620
106 Ga0105246_10437902 3300011119 Unclassified 1095
107 Ga0157373_10030915 3300013100 Bacteria 3853
108 Ga0157371_10005797 3300013102 Bacteria 10339
109 Ga0157369_10888642 3300013105 Bacteria 914
110 Ga0157374_10026348 3300013296 Bacteria 5231
111 Ga0157374_10044046 3300013296 Bacteria 4124
112 Ga0157374_10230113 3300013296 Bacteria 1821
113 Ga0157372_10664386 3300013307 Bacteria 1213
114 Ga0157375_10125797 3300013308 Bacteria 2678
115 Ga0157375_10369543 3300013308 Bacteria 1600
116 Ga0163163_10067652 3300014325 Bacteria 3552
117 Ga0157380_10167572 3300014326 Bacteria 1916
118 Ga0182008_10086102 3300014497 Bacteria 1547
119 Ga0157379_10099200 3300014968 Bacteria 2615
120 Ga0157379_10133793 3300014968 Bacteria 2233
121 Ga0157379_10252708 3300014968 Unclassified 1600
122 Ga0157376_10122512 3300014969 Bacteria 2307
123 Ga0209148_1001278 3300025254 Bacteria 13738
124 Ga0207656_10000002 3300025321 Bacteria 792178
125 Ga0207688_10081073 3300025901 Bacteria 1853
126 Ga0207647_10108562 3300025904 Bacteria 1642
127 Ga0207643_10034773 3300025908 Bacteria 2824
128 Ga0207705_10058169 3300025909 Bacteria 2789
129 Ga0207705_10178355 3300025909 Bacteria 1602
130 Ga0207684_10082345 3300025910 Bacteria 2740
131 Ga0207654_10000003 3300025911 Bacteria 1030378
132 Ga0207654_10045817 3300025911 Bacteria 2491
133 Ga0207707_10072236 3300025912 Bacteria 3008
134 Ga0207695_10028346 3300025913 Bacteria 6214
135 Ga0207695_10088354 3300025913 Bacteria 3120
136 Ga0207671_10000002 3300025914 Bacteria 1144816
137 Ga0207671_10321014 3300025914 Bacteria 1225
138 Ga0207660_10259285 3300025917 Bacteria 1374
139 Ga0207662_10168099 3300025918 Bacteria 1405
140 Ga0207657_10012098 3300025919 Bacteria 8527
141 Ga0207657_10016773 3300025919 Bacteria 7051
142 Ga0207652_10227710 3300025921 Bacteria 1680
143 Ga0207694_10000138 3300025924 Bacteria 74645
144 Ga0207694_10088488 3300025924 Bacteria 2441
145 Ga0207650_10022120 3300025925 Bacteria 4500
146 Ga0207687_10022323 3300025927 Bacteria 4210
147 Ga0207687_10125085 3300025927 Bacteria 1929
148 Ga0207687_10228732 3300025927 Bacteria 1468
149 Ga0207687_10687931 3300025927 Bacteria 867
150 Ga0207700_10163106 3300025928 Bacteria 1852
151 Ga0207664_10111031 3300025929 Bacteria 2280
152 Ga0207664_10539294 3300025929 Bacteria 1046
153 Ga0207690_10135279 3300025932 Unclassified 1809
154 Ga0207690_10435995 3300025932 Bacteria 1051
155 Ga0207686_10159147 3300025934 Unclassified 1581
156 Ga0207670_10389759 3300025936 Bacteria 1111
157 Ga0207691_10026064 3300025940 Bacteria 5486
158 Ga0207691_10057570 3300025940 Bacteria 3536
159 Ga0207691_10331931 3300025940 Bacteria 1303
160 Ga0207711_10023498 3300025941 Bacteria 5160
161 Ga0207711_10081134 3300025941 Bacteria 2834
162 Ga0207711_10102309 3300025941 Bacteria 2536
163 Ga0207711_10304424 3300025941 Bacteria 1470
164 Ga0207689_10005841 3300025942 Bacteria 10914
165 Ga0207667_10057332 3300025949 Bacteria 4088
166 Ga0207651_10110067 3300025960 Bacteria 2066
167 Ga0207658_10050531 3300025986 Bacteria 3060
168 Ga0207703_10000305 3300026035 Bacteria 53985
169 Ga0207703_10078287 3300026035 Bacteria 2746
170 Ga0207703_10152781 3300026035 Bacteria 2014
171 Ga0207639_10023482 3300026041 Bacteria 4454
172 Ga0207639_10072813 3300026041 Bacteria 2692
173 Ga0207639_10250403 3300026041 Bacteria 1544
174 Ga0207708_10029521 3300026075 Bacteria 4156
175 Ga0207702_10008928 3300026078 Bacteria 8453
176 Ga0207702_10218046 3300026078 Bacteria 1777
177 Ga0207641_10088638 3300026088 Bacteria 2702
178 Ga0207641_10159298 3300026088 Bacteria 2051
179 Ga0207641_10235180 3300026088 Unclassified 1705
180 Ga0207676_10380634 3300026095 Bacteria 1313
181 Ga0207674_10069289 3300026116 Bacteria 3548
182 Ga0207674_10140544 3300026116 Bacteria 2374
183 Ga0207674_10320844 3300026116 Unclassified 1498
184 Ga0207683_10016523 3300026121 Bacteria 6283
185 Ga0207698_10000343 3300026142 Bacteria 27502
186 Ga0207698_10041321 3300026142 Bacteria 3435
187 Ga0207698_10108277 3300026142 Bacteria 2322
188 Ga0207698_10225418 3300026142 Unclassified 1697
189 Ga0207428_10011305 3300027907 Bacteria 7904
190 Ga0207428_10036248 3300027907 Bacteria 4025
191 Ga0268266_10066017 3300028379 Bacteria 3129
192 Ga0268264_10017260 3300028381 Bacteria 5913
193 Ga0265326_10002732 3300028558 Bacteria 5916
194 Ga0265338_10229373 3300028800 Unclassified 1382
195 Ga0265340_10013537 3300031247 Bacteria 4283
196 Ga0265314_10137801 3300031711 Bacteria 1513
197 Ga0307406_10121525 3300031901 Bacteria 1817
198 Ga0307407_10051079 3300031903 Bacteria 2369
199 Ga0307409_100002563 3300031995 Bacteria 9544
200 Ga0307415_100000548 3300032126 Bacteria 16447
201 Ga0373943_0265124 3300035170 Bacteria 968
202 Ga0395898_0096856 3300037466 Bacteria 2834
203 Ga0395905_0051646 3300037471 Bacteria 3851
204 Ga0395901_0291378 3300038443 Bacteria 1694
205 Ga0395901_0479220 3300038443 Bacteria 1269
206 Ga0439463_057492 3300042016 Archaea 994
207 Ga0466965_0369254 3300044683 Bacteria 788
208 Ga0466961_0044757 3300044693 Bacteria 2832
209 Ga0466970_0087585 3300044765 Bacteria 1689
210 Ga0466960_0123464 3300044901 Bacteria 1359
211 Ga0466967_0673826 3300045976 Bacteria 1024
212 Ga0495603_0039362 3300046455 Bacteria 2833
213 Ga0495629_0077997 3300046459 Bacteria 2313
214 Ga0495630_0269910 3300046517 Bacteria 1300
215 Ga0495630_0441635 3300046517 Bacteria 997
216 Ga0495624_0136060 3300046690 Bacteria 1506
217 Ga0495676_0242774 3300047321 Bacteria 1232
218 Ga0495676_0338441 3300047321 Bacteria 1008
219 Ga0495602_0150064 3300048088 Bacteria 1834
220 Ga0496100_0600635 3300048903 Bacteria 854
221 Ga0496101_0006739 3300048904 Bacteria 7406
222 Ga0496101_0024492 3300048904 Bacteria 4178
223 Ga0496101_0027882 3300048904 Bacteria 3939
224 Ga0496101_0047355 3300048904 Bacteria 3086
225 Ga0496101_0131295 3300048904 Bacteria 1902
226 Ga0496102_0000029 3300048905 Bacteria 222195
227 Ga0496102_0048609 3300048905 Bacteria 3857
228 Ga0496102_0061598 3300048905 Bacteria 3434
229 Ga0496102_0109633 3300048905 Bacteria 2572
230 Ga0496102_0269661 3300048905 Bacteria 1605
231 Ga0496103_0000143 3300048906 Bacteria 74753
232 Ga0496103_0020106 3300048906 Bacteria 4009
233 Ga0496103_0063708 3300048906 Bacteria 2297
234 Ga0496104_0022236 3300048907 Bacteria 5823
235 Ga0496104_0051020 3300048907 Bacteria 3904
236 Ga0496104_0719670 3300048907 Unclassified 906
237 Ga0496105_0061111 3300048908 Bacteria 3108
238 Ga0496105_0067050 3300048908 Bacteria 2963
239 Ga0496105_0068656 3300048908 Bacteria 2928
240 Ga0496106_0016591 3300048909 Bacteria 5450
241 Ga0496106_0033636 3300048909 Bacteria 3825
242 Ga0496106_0155342 3300048909 Bacteria 1806
243 Ga0496107_0002487 3300048910 Bacteria 11969
244 Ga0496107_0009000 3300048910 Bacteria 6920
245 Ga0496107_0047100 3300048910 Bacteria 3104
246 Ga0496108_0142019 3300048911 Bacteria 2069
247 Ga0496108_0154194 3300048911 Bacteria 1983
248 Ga0496108_0371448 3300048911 Bacteria 1248
249 Ga0496109_0018967 3300048912 Bacteria 6056
250 Ga0496109_0031746 3300048912 Bacteria 4743
251 Ga0496109_0037262 3300048912 Bacteria 4394
252 Ga0496109_0064311 3300048912 Bacteria 3357
253 Ga0496110_0006065 3300048913 Bacteria 9528
254 Ga0496110_0063209 3300048913 Bacteria 3271
255 Ga0496111_0109445 3300048914 Bacteria 2034
256 Ga0496112_0184069 3300048915 Bacteria 2052
257 Ga0496112_0547290 3300048915 Bacteria 1091
258 Ga0496113_0066067 3300048916 Bacteria 2738
259 Ga0496113_0138023 3300048916 Bacteria 1917
260 Ga0496114_0005043 3300048917 Bacteria 10299
261 Ga0496114_0011860 3300048917 Bacteria 6974
262 Ga0496114_0014397 3300048917 Bacteria 6348
263 Ga0496114_0032635 3300048917 Bacteria 4287
264 Ga0496114_0115137 3300048917 Bacteria 2306
265 Ga0496114_0794674 3300048917 Bacteria 825
266 Ga0496115_0012382 3300048918 Bacteria 6417
267 Ga0496115_0016622 3300048918 Bacteria 5606
268 Ga0496117_0029709 3300048920 Bacteria 4209
269 Ga0496118_0029770 3300048921 Bacteria 4571
270 Ga0496118_0045768 3300048921 Bacteria 3411
271 Ga0496119_0000568 3300048922 Bacteria 49842
272 Ga0496119_0146240 3300048922 Bacteria 1271
273 Ga0496120_0001805 3300048923 Bacteria 24026
274 Ga0496120_0028796 3300048923 Bacteria 3399
275 Ga0496120_0087797 3300048923 Bacteria 1669
276 Ga0496120_0112093 3300048923 Bacteria 1423
277 Ga0501031_0086878 3300049568 Bacteria 2039
278 Ga0501034_0439427 3300049571 Bacteria 1223
279 Ga0501040_0071295 3300049576 Bacteria 2399
280 Ga0501040_0267914 3300049576 Bacteria 1219
281 Ga0501046_0469948 3300049580 Bacteria 903
282 Ga0501048_0372687 3300049582 Bacteria 1019
283 Ga0501067_0045653 3300049583 Bacteria 2432
284 Ga0501071_0128464 3300049587 Bacteria 1882
285 Ga0501072_0706853 3300049588 Bacteria 792
286 Ga0501076_0131580 3300049592 Bacteria 2029
287 Ga0501076_0222933 3300049592 Bacteria 1541
288 Ga0501081_0068536 3300049743 Bacteria 2470
289 Ga0501081_0339910 3300049743 Bacteria 1105
290 nmdc:mga05p37_1717_c1 3300050507 Bacteria 25532
291 nmdc:mga09592_127683_c1 3300050508 Bacteria 2186
292 nmdc:mga09592_941_c1 3300050508 Bacteria 22864
293 nmdc:mga0qj67_4358_c1 3300050509 Bacteria 10248
294 nmdc:mga06r32_1167_c1 3300050510 Bacteria 23649
295 nmdc:mga06r32_77592_c1 3300050510 Bacteria 3227
296 nmdc:mga08y16_36373_c1 3300050511 Bacteria 5171
297 nmdc:mga08y16_411720_c1 3300050511 Bacteria 1383
298 nmdc:mga0n895_235680_c1 3300050512 Bacteria 1857
299 nmdc:mga0rr50_224898_c1 3300050513 Bacteria 1551
300 nmdc:mga0a205_21001_c1 3300050515 Bacteria 6171
301 nmdc:mga0a205_447690_c1 3300050515 Bacteria 1152
302 Ga0495595_0033535 3300053084 Bacteria 2318
303 Ga0500643_000497 3300053087 Bacteria 28195
304 Ga0530510_0171054 3300061734 Bacteria 1609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0547290 Ga0496112_0547290_406_1029 206
2 3300049588 Ga0501072_0706853 Ga0501072_0706853_17_661 213
3 3300009098 Ga0105245_10013894 Ga0105245_100138947 216
4 3300048912 Ga0496109_0031746 Ga0496109_0031746_34_711 225
5 3300049576 Ga0501040_0267914 Ga0501040_0267914_301_1059 229
6 3300049580 Ga0501046_0469948 Ga0501046_0469948_22_780 229
7 3300049587 Ga0501071_0128464 Ga0501071_0128464_966_1724 229
8 3300049592 Ga0501076_0222933 Ga0501076_0222933_495_1253 229
9 3300049743 Ga0501081_0068536 Ga0501081_0068536_1293_2051 229
10 3300061734 Ga0530510_0171054 Ga0530510_0171054_335_1093 229
11 3300044901 Ga0466960_0123464 Ga0466960_0123464_128_883 231
12 3300031903 Ga0307407_10051079 Ga0307407_100510792 232
13 3300025927 Ga0207687_10228732 Ga0207687_102287322 234
14 3300045976 Ga0466967_0673826 Ga0466967_0673826_155_916 238
15 3300005367 Ga0070667_100002017 Ga0070667_10000201711 239
16 3300005436 Ga0070713_100082615 Ga0070713_1000826152 239
17 3300044765 Ga0466970_0087585 Ga0466970_0087585_17_736 239
18 3300046690 Ga0495624_0136060 Ga0495624_0136060_64_783 239
19 3300048088 Ga0495602_0150064 Ga0495602_0150064_402_1121 239
20 3300048905 Ga0496102_0269661 Ga0496102_0269661_10_738 239
21 3300048917 Ga0496114_0794674 Ga0496114_0794674_14_739 239
22 3300048914 Ga0496111_0109445 Ga0496111_0109445_378_1103 240
23 3300005435 Ga0070714_100198525 Ga0070714_1001985252 244
24 3300025929 Ga0207664_10539294 Ga0207664_105392942 244
25 3300037466 Ga0395898_0096856 Ga0395898_0096856_170_928 245
26 3300005434 Ga0070709_10025485 Ga0070709_100254853 248
27 3300005614 Ga0068856_100032068 Ga0068856_1000320686 248
28 3300025928 Ga0207700_10163106 Ga0207700_101631064 248
29 3300025929 Ga0207664_10111031 Ga0207664_101110312 248
30 3300026078 Ga0207702_10218046 Ga0207702_102180463 248
31 3300026088 Ga0207641_10159298 Ga0207641_101592983 248
32 iso_pu_bacteria 2643221690 2644503459 248
33 iso_pu_bacteria 2856858025 2856862453 248
34 iso_pu_bacteria 2857481737 2857486198 248
35 iso_pu_bacteria 2884994152 2884997918 248
36 3300049582 Ga0501048_0372687 Ga0501048_0372687_95_847 249
37 3300053087 Ga0500643_000497 Ga0500643_000497_7854_8609 249
38 3300038443 Ga0395901_0479220 Ga0395901_0479220_323_1075 250
39 3300044683 Ga0466965_0369254 Ga0466965_0369254_12_764 250
40 3300009176 Ga0105242_10132885 Ga0105242_101328853 251
41 3300011119 Ga0105246_10437902 Ga0105246_104379021 251
42 3300013296 Ga0157374_10026348 Ga0157374_100263484 251
43 3300025918 Ga0207662_10168099 Ga0207662_101680991 251
44 3300025927 Ga0207687_10022323 Ga0207687_100223231 251
45 3300025934 Ga0207686_10159147 Ga0207686_101591472 251
46 3300025940 Ga0207691_10331931 Ga0207691_103319312 251
47 3300026035 Ga0207703_10152781 Ga0207703_101527812 251
48 3300037471 Ga0395905_0051646 Ga0395905_0051646_1549_2304 251
49 3300044693 Ga0466961_0044757 Ga0466961_0044757_1480_2235 251
50 3300048904 Ga0496101_0131295 Ga0496101_0131295_1101_1862 251
51 3300048905 Ga0496102_0048609 Ga0496102_0048609_3081_3842 251
52 3300048907 Ga0496104_0051020 Ga0496104_0051020_2951_3712 251
53 3300048909 Ga0496106_0155342 Ga0496106_0155342_284_1045 251
54 3300048910 Ga0496107_0002487 Ga0496107_0002487_8273_9034 251
55 3300049583 Ga0501067_0045653 Ga0501067_0045653_135_899 251
56 3300003320 rootH2_10073606 rootH2_100736062 252
57 3300005331 Ga0070670_100022561 Ga0070670_1000225616 252
58 3300005336 Ga0070680_100023006 Ga0070680_1000230062 252
59 3300005337 Ga0070682_100007824 Ga0070682_1000078245 252
60 3300005337 Ga0070682_100085798 Ga0070682_1000857983 252
61 3300005339 Ga0070660_100408360 Ga0070660_1004083602 252
62 3300005339 Ga0070660_100650403 Ga0070660_1006504031 252
63 3300005340 Ga0070689_100152769 Ga0070689_1001527692 252
64 3300005341 Ga0070691_10056996 Ga0070691_100569962 252
65 3300005345 Ga0070692_10007381 Ga0070692_100073815 252
66 3300005354 Ga0070675_100102753 Ga0070675_1001027533 252
67 3300005355 Ga0070671_100030949 Ga0070671_1000309492 252
68 3300005366 Ga0070659_100012720 Ga0070659_1000127205 252
69 3300005366 Ga0070659_100090285 Ga0070659_1000902852 252
70 3300005366 Ga0070659_100195880 Ga0070659_1001958802 252
71 3300005367 Ga0070667_100046307 Ga0070667_1000463074 252
72 3300005367 Ga0070667_100401357 Ga0070667_1004013572 252
73 3300005438 Ga0070701_10163680 Ga0070701_101636802 252
74 3300005439 Ga0070711_100230344 Ga0070711_1002303441 252
75 3300005441 Ga0070700_100104601 Ga0070700_1001046012 252
76 3300005441 Ga0070700_100270402 Ga0070700_1002704022 252
77 3300005456 Ga0070678_100001999 Ga0070678_1000019997 252
78 3300005457 Ga0070662_100118495 Ga0070662_1001184953 252
79 3300005466 Ga0070685_10039632 Ga0070685_100396322 252
80 3300005466 Ga0070685_10101115 Ga0070685_101011152 252
81 3300005466 Ga0070685_10112227 Ga0070685_101122272 252
82 3300005467 Ga0070706_100702758 Ga0070706_1007027581 252
83 3300005518 Ga0070699_100642032 Ga0070699_1006420322 252
84 3300005530 Ga0070679_100174153 Ga0070679_1001741532 252
85 3300005539 Ga0068853_100013446 Ga0068853_1000134468 252
86 3300005539 Ga0068853_100091495 Ga0068853_1000914957 252
87 3300005539 Ga0068853_100138154 Ga0068853_1001381543 252
88 3300005543 Ga0070672_100093967 Ga0070672_1000939675 252
89 3300005548 Ga0070665_100029587 Ga0070665_1000295875 252
90 3300005548 Ga0070665_100168902 Ga0070665_1001689022 252
91 3300005577 Ga0068857_100005474 Ga0068857_1000054746 252
92 3300005577 Ga0068857_100113775 Ga0068857_1001137755 252
93 3300005578 Ga0068854_100258018 Ga0068854_1002580182 252
94 3300005614 Ga0068856_100070706 Ga0068856_1000707065 252
95 3300005615 Ga0070702_100051115 Ga0070702_1000511153 252
96 3300005616 Ga0068852_100042807 Ga0068852_1000428075 252
97 3300005616 Ga0068852_100048634 Ga0068852_1000486345 252
98 3300005616 Ga0068852_100052201 Ga0068852_1000522015 252
99 3300005616 Ga0068852_100299956 Ga0068852_1002999562 252
100 3300005617 Ga0068859_100137506 Ga0068859_1001375063 252
101 3300005618 Ga0068864_100294989 Ga0068864_1002949892 252
102 3300005718 Ga0068866_10070995 Ga0068866_100709952 252
103 3300005834 Ga0068851_10000003 Ga0068851_10000003209 252
104 3300005840 Ga0068870_10015353 Ga0068870_100153532 252
105 3300005841 Ga0068863_100039224 Ga0068863_1000392245 252
106 3300005842 Ga0068858_100000293 Ga0068858_10000029318 252
107 3300005842 Ga0068858_100032102 Ga0068858_1000321023 252
108 3300005842 Ga0068858_100571616 Ga0068858_1005716161 252
109 3300005843 Ga0068860_100022338 Ga0068860_1000223387 252
110 3300005843 Ga0068860_100092006 Ga0068860_1000920062 252
111 3300005844 Ga0068862_100126043 Ga0068862_1001260433 252
112 3300005937 Ga0081455_10000030 Ga0081455_1000003060 252
113 3300006038 Ga0075365_10245810 Ga0075365_102458102 252
114 3300006038 Ga0075365_10261374 Ga0075365_102613742 252
115 3300006058 Ga0075432_10021688 Ga0075432_100216883 252
116 3300006358 Ga0068871_100089966 Ga0068871_1000899662 252
117 3300006844 Ga0075428_100003091 Ga0075428_10000309110 252
118 3300006844 Ga0075428_100003214 Ga0075428_10000321417 252
119 3300006846 Ga0075430_100033444 Ga0075430_1000334442 252
120 3300006847 Ga0075431_100016337 Ga0075431_1000163378 252
121 3300006852 Ga0075433_10288747 Ga0075433_102887472 252
122 3300006852 Ga0075433_10462260 Ga0075433_104622602 252
123 3300006871 Ga0075434_100243288 Ga0075434_1002432883 252
124 3300006880 Ga0075429_100010783 Ga0075429_1000107832 252
125 3300006914 Ga0075436_100097148 Ga0075436_1000971482 252
126 3300006931 Ga0097620_100137503 Ga0097620_1001375033 252
127 3300007076 Ga0075435_100160305 Ga0075435_1001603052 252
128 3300009011 Ga0105251_10050556 Ga0105251_100505562 252
129 3300009093 Ga0105240_10315835 Ga0105240_103158352 252
130 3300009094 Ga0111539_10007749 Ga0111539_1000774913 252
131 3300009094 Ga0111539_10239630 Ga0111539_102396302 252
132 3300009098 Ga0105245_10010110 Ga0105245_100101107 252
133 3300009098 Ga0105245_10062828 Ga0105245_100628284 252
134 3300009098 Ga0105245_10208794 Ga0105245_102087943 252
135 3300009098 Ga0105245_10332117 Ga0105245_103321172 252
136 3300009101 Ga0105247_10010177 Ga0105247_100101773 252
137 3300009147 Ga0114129_10017811 Ga0114129_100178114 252
138 3300009147 Ga0114129_10553639 Ga0114129_105536392 252
139 3300009148 Ga0105243_10124342 Ga0105243_101243423 252
140 3300009148 Ga0105243_10562551 Ga0105243_105625512 252
141 3300009174 Ga0105241_10008192 Ga0105241_100081927 252
142 3300009174 Ga0105241_10048472 Ga0105241_100484722 252
143 3300009177 Ga0105248_10079660 Ga0105248_100796605 252
144 3300009177 Ga0105248_10122227 Ga0105248_101222272 252
145 3300009545 Ga0105237_10008872 Ga0105237_1000887210 252
146 3300009545 Ga0105237_10035219 Ga0105237_100352198 252
147 3300009545 Ga0105237_10109873 Ga0105237_101098732 252
148 3300009551 Ga0105238_10004693 Ga0105238_100046939 252
149 3300009553 Ga0105249_10368765 Ga0105249_103687652 252
150 3300010375 Ga0105239_10050307 Ga0105239_100503072 252
151 3300010375 Ga0105239_10252206 Ga0105239_102522063 252
152 3300010375 Ga0105239_10938100 Ga0105239_109381002 252
153 3300011119 Ga0105246_10061094 Ga0105246_100610942 252
154 3300013100 Ga0157373_10030915 Ga0157373_100309154 252
155 3300013102 Ga0157371_10005797 Ga0157371_100057979 252
156 3300013105 Ga0157369_10888642 Ga0157369_108886421 252
157 3300013296 Ga0157374_10044046 Ga0157374_100440463 252
158 3300013296 Ga0157374_10230113 Ga0157374_102301131 252
159 3300013307 Ga0157372_10664386 Ga0157372_106643861 252
160 3300013308 Ga0157375_10125797 Ga0157375_101257973 252
161 3300013308 Ga0157375_10369543 Ga0157375_103695432 252
162 3300014325 Ga0163163_10067652 Ga0163163_100676525 252
163 3300014326 Ga0157380_10167572 Ga0157380_101675721 252
164 3300014497 Ga0182008_10086102 Ga0182008_100861023 252
165 3300014968 Ga0157379_10099200 Ga0157379_100992002 252
166 3300014968 Ga0157379_10133793 Ga0157379_101337932 252
167 3300014968 Ga0157379_10252708 Ga0157379_102527082 252
168 3300014969 Ga0157376_10122512 Ga0157376_101225124 252
169 3300025254 Ga0209148_1001278 Ga0209148_100127815 252
170 3300025321 Ga0207656_10000002 Ga0207656_1000000228 252
171 3300025901 Ga0207688_10081073 Ga0207688_100810732 252
172 3300025904 Ga0207647_10108562 Ga0207647_101085623 252
173 3300025908 Ga0207643_10034773 Ga0207643_100347732 252
174 3300025909 Ga0207705_10058169 Ga0207705_100581693 252
175 3300025909 Ga0207705_10178355 Ga0207705_101783552 252
176 3300025910 Ga0207684_10082345 Ga0207684_100823452 252
177 3300025911 Ga0207654_10000003 Ga0207654_100000037 252
178 3300025911 Ga0207654_10045817 Ga0207654_100458173 252
179 3300025912 Ga0207707_10072236 Ga0207707_100722362 252
180 3300025913 Ga0207695_10028346 Ga0207695_100283464 252
181 3300025913 Ga0207695_10088354 Ga0207695_100883543 252
182 3300025914 Ga0207671_10000002 Ga0207671_10000002322 252
183 3300025914 Ga0207671_10321014 Ga0207671_103210142 252
184 3300025917 Ga0207660_10259285 Ga0207660_102592852 252
185 3300025919 Ga0207657_10012098 Ga0207657_100120985 252
186 3300025919 Ga0207657_10016773 Ga0207657_1001677310 252
187 3300025921 Ga0207652_10227710 Ga0207652_102277102 252
188 3300025924 Ga0207694_10000138 Ga0207694_1000013844 252
189 3300025924 Ga0207694_10088488 Ga0207694_100884883 252
190 3300025925 Ga0207650_10022120 Ga0207650_100221202 252
191 3300025927 Ga0207687_10125085 Ga0207687_101250852 252
192 3300025927 Ga0207687_10687931 Ga0207687_106879311 252
193 3300025932 Ga0207690_10135279 Ga0207690_101352791 252
194 3300025932 Ga0207690_10435995 Ga0207690_104359951 252
195 3300025936 Ga0207670_10389759 Ga0207670_103897592 252
196 3300025940 Ga0207691_10026064 Ga0207691_100260645 252
197 3300025940 Ga0207691_10057570 Ga0207691_100575706 252
198 3300025941 Ga0207711_10023498 Ga0207711_100234983 252
199 3300025941 Ga0207711_10081134 Ga0207711_100811342 252
200 3300025941 Ga0207711_10102309 Ga0207711_101023094 252
201 3300025941 Ga0207711_10304424 Ga0207711_103044242 252
202 3300025942 Ga0207689_10005841 Ga0207689_100058419 252
203 3300025949 Ga0207667_10057332 Ga0207667_100573327 252
204 3300025960 Ga0207651_10110067 Ga0207651_101100672 252
205 3300025986 Ga0207658_10050531 Ga0207658_100505315 252
206 3300026035 Ga0207703_10000305 Ga0207703_1000030518 252
207 3300026035 Ga0207703_10078287 Ga0207703_100782872 252
208 3300026041 Ga0207639_10023482 Ga0207639_100234822 252
209 3300026041 Ga0207639_10072813 Ga0207639_100728133 252
210 3300026041 Ga0207639_10250403 Ga0207639_102504031 252
211 3300026075 Ga0207708_10029521 Ga0207708_100295212 252
212 3300026078 Ga0207702_10008928 Ga0207702_100089288 252
213 3300026088 Ga0207641_10088638 Ga0207641_100886383 252
214 3300026088 Ga0207641_10235180 Ga0207641_102351802 252
215 3300026095 Ga0207676_10380634 Ga0207676_103806342 252
216 3300026116 Ga0207674_10069289 Ga0207674_100692895 252
217 3300026116 Ga0207674_10140544 Ga0207674_101405442 252
218 3300026116 Ga0207674_10320844 Ga0207674_103208442 252
219 3300026121 Ga0207683_10016523 Ga0207683_100165232 252
220 3300026142 Ga0207698_10000343 Ga0207698_100003437 252
221 3300026142 Ga0207698_10041321 Ga0207698_100413215 252
222 3300026142 Ga0207698_10108277 Ga0207698_101082772 252
223 3300026142 Ga0207698_10225418 Ga0207698_102254182 252
224 3300027907 Ga0207428_10011305 Ga0207428_100113058 252
225 3300027907 Ga0207428_10036248 Ga0207428_100362484 252
226 3300028379 Ga0268266_10066017 Ga0268266_100660172 252
227 3300028381 Ga0268264_10017260 Ga0268264_100172604 252
228 3300028558 Ga0265326_10002732 Ga0265326_100027322 252
229 3300028800 Ga0265338_10229373 Ga0265338_102293731 252
230 3300031247 Ga0265340_10013537 Ga0265340_100135374 252
231 3300031711 Ga0265314_10137801 Ga0265314_101378013 252
232 3300031901 Ga0307406_10121525 Ga0307406_101215252 252
233 3300031995 Ga0307409_100002563 Ga0307409_1000025634 252
234 3300032126 Ga0307415_100000548 Ga0307415_1000005482 252
235 3300035170 Ga0373943_0265124 Ga0373943_0265124_121_879 252
236 3300038443 Ga0395901_0291378 Ga0395901_0291378_215_973 252
237 3300042016 Ga0439463_057492 Ga0439463_057492_195_959 252
238 3300046455 Ga0495603_0039362 Ga0495603_0039362_1393_2151 252
239 3300046459 Ga0495629_0077997 Ga0495629_0077997_97_855 252
240 3300046517 Ga0495630_0269910 Ga0495630_0269910_509_1282 252
241 3300046517 Ga0495630_0441635 Ga0495630_0441635_76_834 252
242 3300047321 Ga0495676_0242774 Ga0495676_0242774_397_1155 252
243 3300047321 Ga0495676_0338441 Ga0495676_0338441_94_855 252
244 3300048903 Ga0496100_0600635 Ga0496100_0600635_38_799 252
245 3300048904 Ga0496101_0006739 Ga0496101_0006739_4688_5467 252
246 3300048904 Ga0496101_0024492 Ga0496101_0024492_3338_4099 252
247 3300048904 Ga0496101_0027882 Ga0496101_0027882_2571_3332 252
248 3300048904 Ga0496101_0047355 Ga0496101_0047355_1314_2081 252
249 3300048905 Ga0496102_0000029 Ga0496102_0000029_171276_172055 252
250 3300048905 Ga0496102_0061598 Ga0496102_0061598_48_809 252
251 3300048905 Ga0496102_0109633 Ga0496102_0109633_118_876 252
252 3300048906 Ga0496103_0000143 Ga0496103_0000143_57806_58585 252
253 3300048906 Ga0496103_0020106 Ga0496103_0020106_2213_2980 252
254 3300048906 Ga0496103_0063708 Ga0496103_0063708_823_1584 252
255 3300048907 Ga0496104_0022236 Ga0496104_0022236_3516_4277 252
256 3300048907 Ga0496104_0719670 Ga0496104_0719670_51_812 252
257 3300048908 Ga0496105_0061111 Ga0496105_0061111_48_809 252
258 3300048908 Ga0496105_0067050 Ga0496105_0067050_1034_1795 252
259 3300048908 Ga0496105_0068656 Ga0496105_0068656_1249_2010 252
260 3300048909 Ga0496106_0016591 Ga0496106_0016591_2305_3072 252
261 3300048909 Ga0496106_0033636 Ga0496106_0033636_2173_2934 252
262 3300048910 Ga0496107_0009000 Ga0496107_0009000_2773_3540 252
263 3300048910 Ga0496107_0047100 Ga0496107_0047100_1277_2038 252
264 3300048911 Ga0496108_0142019 Ga0496108_0142019_335_1096 252
265 3300048911 Ga0496108_0154194 Ga0496108_0154194_748_1506 252
266 3300048911 Ga0496108_0371448 Ga0496108_0371448_351_1112 252
267 3300048912 Ga0496109_0018967 Ga0496109_0018967_3197_3958 252
268 3300048912 Ga0496109_0037262 Ga0496109_0037262_1393_2151 252
269 3300048912 Ga0496109_0064311 Ga0496109_0064311_669_1430 252
270 3300048913 Ga0496110_0006065 Ga0496110_0006065_2228_2989 252
271 3300048913 Ga0496110_0063209 Ga0496110_0063209_941_1699 252
272 3300048915 Ga0496112_0184069 Ga0496112_0184069_417_1178 252
273 3300048916 Ga0496113_0066067 Ga0496113_0066067_1171_1932 252
274 3300048916 Ga0496113_0138023 Ga0496113_0138023_718_1479 252
275 3300048917 Ga0496114_0005043 Ga0496114_0005043_6745_7506 252
276 3300048917 Ga0496114_0011860 Ga0496114_0011860_3879_4640 252
277 3300048917 Ga0496114_0014397 Ga0496114_0014397_4229_4990 252
278 3300048917 Ga0496114_0032635 Ga0496114_0032635_2744_3502 252
279 3300048917 Ga0496114_0115137 Ga0496114_0115137_1447_2214 252
280 3300048918 Ga0496115_0012382 Ga0496115_0012382_2087_2848 252
281 3300048918 Ga0496115_0016622 Ga0496115_0016622_4759_5520 252
282 3300048920 Ga0496117_0029709 Ga0496117_0029709_2364_3122 252
283 3300048921 Ga0496118_0029770 Ga0496118_0029770_1801_2580 252
284 3300048921 Ga0496118_0045768 Ga0496118_0045768_1553_2311 252
285 3300048922 Ga0496119_0000568 Ga0496119_0000568_903_1661 252
286 3300048922 Ga0496119_0146240 Ga0496119_0146240_270_1049 252
287 3300048923 Ga0496120_0001805 Ga0496120_0001805_21550_22308 252
288 3300048923 Ga0496120_0028796 Ga0496120_0028796_1943_2701 252
289 3300048923 Ga0496120_0087797 Ga0496120_0087797_52_891 252
290 3300048923 Ga0496120_0112093 Ga0496120_0112093_402_1160 252
291 3300049568 Ga0501031_0086878 Ga0501031_0086878_359_1117 252
292 3300049571 Ga0501034_0439427 Ga0501034_0439427_204_965 252
293 3300049576 Ga0501040_0071295 Ga0501040_0071295_1263_2021 252
294 3300049592 Ga0501076_0131580 Ga0501076_0131580_622_1380 252
295 3300049743 Ga0501081_0339910 Ga0501081_0339910_187_945 252
296 3300050507 nmdc:mga05p37_1717_c1 nmdc:mga05p37_1717_c1_7434_8201 252
297 3300050508 nmdc:mga09592_127683_c1 nmdc:mga09592_127683_c1_1211_1972 252
298 3300050508 nmdc:mga09592_941_c1 nmdc:mga09592_941_c1_14689_15456 252
299 3300050509 nmdc:mga0qj67_4358_c1 nmdc:mga0qj67_4358_c1_3519_4286 252
300 3300050510 nmdc:mga06r32_1167_c1 nmdc:mga06r32_1167_c1_14143_14910 252
301 3300050510 nmdc:mga06r32_77592_c1 nmdc:mga06r32_77592_c1_479_1240 252
302 3300050511 nmdc:mga08y16_36373_c1 nmdc:mga08y16_36373_c1_1585_2352 252
303 3300050511 nmdc:mga08y16_411720_c1 nmdc:mga08y16_411720_c1_354_1115 252
304 3300050512 nmdc:mga0n895_235680_c1 nmdc:mga0n895_235680_c1_799_1566 252
305 3300050513 nmdc:mga0rr50_224898_c1 nmdc:mga0rr50_224898_c1_160_921 252
306 3300050515 nmdc:mga0a205_21001_c1 nmdc:mga0a205_21001_c1_5065_5826 252
307 3300050515 nmdc:mga0a205_447690_c1 nmdc:mga0a205_447690_c1_263_1030 252
308 3300053084 Ga0495595_0033535 Ga0495595_0033535_362_1120 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

61

154

0.94

PF08242

Methyltransf_12

Methyltransferase domain

61

152

0.94

PF13649

Methyltransf_25

Methyltransferase domain

60

150

0.94

PF13847

Methyltransf_31

Methyltransferase domain

55

158

0.87

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

48

159

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m83-assembly1.cif.gz_A-2 crystal structure of tylm1 s120a bound to sah and dtdp-phenol 0.8185 7 134
6m82-assembly1.cif.gz_A crystal structure of tylm1 y14paf bound to sah and dtdp-phenol 0.8177 7 134
3bxo-assembly1.cif.gz_B crystal structure of streptomyces venezuelae desvi 0.8155 3 134
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8135 19 133
3px2-assembly1.cif.gz_D structure of tylm1 from streptomyces fradiae h123n mutant in complex with sah and dtdp-quip3n 0.8086 7 134
ID Description Score Start End Superfamily
af_Q80WQ4_26_187_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8916 34 136 3.40.50.150
af_O01594_147_310_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8723 33 131 3.40.50.150
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8632 32 131 3.40.50.150
af_A0A1D6QMW6_179_313_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8598 38 131 3.40.50.150
af_O61833_6_236_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8555 8 124 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A853DKQ2-F1-model_v4 SAM-dependent methyltransferase 0.9589 2 251 GO:0008757
GO:0032259
AF-A0A5D0XQ80-F1-model_v4 Class I SAM-dependent methyltransferase 0.9487 2 124 GO:0008757
GO:0032259
AF-A0A853DKQ2-F1-model_v4 SAM-dependent methyltransferase 0.9479 2 251 GO:0008757
GO:0032259
AF-A0A528KWT0-F1-model_v4 Methyltransferase domain-containing protein 0.9296 1 252 GO:0008757
GO:0032259
AF-A0A528KWT0-F1-model_v4 Methyltransferase domain-containing protein 0.926 1 252 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
95.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map