F399876

General Info

Members Datasets Scaffolds Average Seq Length
308 197 308 202

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0002144|Ga0496109_0002144_12925_13602
Length 225
Sequence MAQRPPVRERGTDHAAPRGSPRMMEGSERRLRVLVVDDHDVVHWGFRLMLTQQAWVDRCLSARNADEAVELTRRYEPHVAVVDLFIGEESGAAVSAQLREAWAGVKVLLVSGAGQISPRAAAAAGAAGFVSKDMPAADIARAVRMVGLGHNVFPNQPDESGVILTGREREVLELVRSGATNREIAAALHLSPHTIKEHASGLYRKLDARNRAEAVDRAQRLGLLG

Samples

Sample ID Description Type Environment
1 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
187 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.6
Nodule 0
Rhizoplane 4.22
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1019416 3300002073 Bacteria 794
2 JGI24748J21848_1021104 3300002074 Bacteria 786
3 JGI25407J50210_10049965 3300003373 Bacteria 1061
4 Ga0070683_100021169 3300005329 Bacteria 5799
5 Ga0070670_100714954 3300005331 Bacteria 901
6 Ga0068869_100051664 3300005334 Bacteria 2982
7 Ga0070682_100012653 3300005337 Bacteria 4841
8 Ga0068868_100034344 3300005338 Bacteria 3915
9 Ga0070689_100118712 3300005340 Bacteria 2111
10 Ga0070691_10012024 3300005341 Bacteria 3963
11 Ga0070691_10028563 3300005341 Bacteria 2607
12 Ga0070661_100120756 3300005344 Bacteria 1963
13 Ga0070692_10063297 3300005345 Bacteria 1954
14 Ga0070668_100112529 3300005347 Bacteria 2168
15 Ga0070668_100282037 3300005347 Bacteria 1388
16 Ga0070675_100157557 3300005354 Bacteria 1950
17 Ga0070671_100312711 3300005355 Bacteria 1338
18 Ga0070674_100190342 3300005356 Bacteria 1578
19 Ga0070659_100246228 3300005366 Bacteria 1481
20 Ga0070703_10036252 3300005406 Bacteria 1514
21 Ga0070714_100008517 3300005435 Bacteria 8016
22 Ga0070713_100030057 3300005436 Bacteria 4310
23 Ga0070713_100055881 3300005436 Bacteria 3282
24 Ga0070713_100071456 3300005436 Bacteria 2932
25 Ga0070710_10051389 3300005437 Bacteria 2314
26 Ga0070705_100166432 3300005440 Bacteria 1479
27 Ga0070700_100004700 3300005441 Bacteria 7159
28 Ga0070700_100067813 3300005441 Bacteria 2267
29 Ga0070700_100134990 3300005441 Bacteria 1670
30 Ga0070663_100113695 3300005455 Bacteria 2038
31 Ga0070678_100054934 3300005456 Bacteria 2905
32 Ga0070662_100035181 3300005457 Bacteria 3536
33 Ga0068867_100073018 3300005459 Bacteria 2569
34 Ga0070685_10036774 3300005466 Bacteria 2769
35 Ga0068853_100138947 3300005539 Bacteria 2180
36 Ga0070695_100138785 3300005545 Bacteria 1683
37 Ga0070704_100018579 3300005549 Bacteria 4449
38 Ga0070664_100027263 3300005564 Bacteria 4746
39 Ga0068856_100046731 3300005614 Bacteria 4263
40 Ga0070702_100037266 3300005615 Bacteria 2700
41 Ga0070702_100396505 3300005615 Bacteria 986
42 Ga0068852_100008989 3300005616 Bacteria 7396
43 Ga0068859_100270311 3300005617 Bacteria 1792
44 Ga0068864_100008830 3300005618 Bacteria 8309
45 Ga0068861_100028955 3300005719 Bacteria 4045
46 Ga0068861_100066857 3300005719 Bacteria 2772
47 Ga0068863_100048952 3300005841 Bacteria 4008
48 Ga0068860_100272385 3300005843 Bacteria 1652
49 Ga0068862_100083258 3300005844 Bacteria 2778
50 Ga0081455_10049022 3300005937 Bacteria 3643
51 Ga0081538_10000128 3300005981 Bacteria 77546
52 Ga0081538_10000698 3300005981 Bacteria 36881
53 Ga0081538_10016239 3300005981 Bacteria 5721
54 Ga0081538_10026993 3300005981 Bacteria 3995
55 Ga0081539_10029368 3300005985 Bacteria 3436
56 Ga0081539_10255248 3300005985 Bacteria 777
57 Ga0070717_10009444 3300006028 Bacteria 7330
58 Ga0070717_10218983 3300006028 Bacteria 1673
59 Ga0075365_10415676 3300006038 Bacteria 949
60 Ga0075363_100020417 3300006048 Bacteria 3322
61 Ga0075363_100182107 3300006048 Bacteria 1196
62 Ga0075432_10062382 3300006058 Bacteria 1329
63 Ga0070712_100058502 3300006175 Bacteria 2711
64 Ga0075367_10021086 3300006178 Bacteria 3638
65 Ga0075367_10397976 3300006178 Bacteria 871
66 Ga0075428_100007055 3300006844 Bacteria 12450
67 Ga0075428_100141706 3300006844 Bacteria 2613
68 Ga0075430_100035941 3300006846 Bacteria 4201
69 Ga0075433_10091136 3300006852 Bacteria 2695
70 Ga0075433_10135546 3300006852 Bacteria 2188
71 Ga0075434_100008053 3300006871 Bacteria 9774
72 Ga0075429_100047565 3300006880 Bacteria 3732
73 Ga0068865_100110161 3300006881 Bacteria 2030
74 Ga0075436_100113329 3300006914 Bacteria 1893
75 Ga0097620_100270280 3300006931 Bacteria 1792
76 Ga0075435_100060734 3300007076 Bacteria 3065
77 Ga0105240_10699499 3300009093 Bacteria 1106
78 Ga0111539_10030486 3300009094 Bacteria 6555
79 Ga0111539_10082291 3300009094 Bacteria 3786
80 Ga0111539_10469367 3300009094 Bacteria 1465
81 Ga0111539_11432747 3300009094 Bacteria 801
82 Ga0105245_10005719 3300009098 Bacteria 10920
83 Ga0105245_10011967 3300009098 Bacteria 7543
84 Ga0114129_10003533 3300009147 Bacteria 21989
85 Ga0114129_10079822 3300009147 Bacteria 4549
86 Ga0105242_11107617 3300009176 Bacteria 806
87 Ga0105248_10377717 3300009177 Bacteria 1595
88 Ga0105238_10522437 3300009551 Bacteria 1190
89 Ga0105249_10004101 3300009553 Bacteria 12579
90 Ga0105239_10011796 3300010375 Bacteria 9752
91 Ga0105239_10329921 3300010375 Bacteria 1721
92 Ga0105246_10093253 3300011119 Bacteria 2175
93 Ga0157374_10028190 3300013296 Bacteria 5071
94 Ga0163162_10082139 3300013306 Bacteria 3294
95 Ga0157372_10053582 3300013307 Bacteria 4497
96 Ga0157372_10787288 3300013307 Bacteria 1105
97 Ga0163163_10020096 3300014325 Bacteria 6286
98 Ga0163163_10139699 3300014325 Bacteria 2464
99 Ga0157380_10067916 3300014326 Bacteria 2872
100 Ga0157380_10199540 3300014326 Bacteria 1774
101 Ga0157380_10866090 3300014326 Bacteria 926
102 Ga0157377_10014314 3300014745 Bacteria 4034
103 Ga0213876_10010594 3300021384 Bacteria 4939
104 Ga0213876_10017251 3300021384 Bacteria 3812
105 Ga0213876_10031594 3300021384 Bacteria 2793
106 Ga0213876_10051711 3300021384 Bacteria 2171
107 Ga0213875_10000059 3300021388 Bacteria 135414
108 Ga0213875_10015096 3300021388 Bacteria 3761
109 Ga0213875_10021495 3300021388 Bacteria 3090
110 Ga0213875_10034469 3300021388 Bacteria 2390
111 Ga0213875_10134390 3300021388 Bacteria 1157
112 Ga0207653_10114471 3300025885 Bacteria 966
113 Ga0207688_10001384 3300025901 Bacteria 12592
114 Ga0207643_10423239 3300025908 Bacteria 844
115 Ga0207693_10083524 3300025915 Bacteria 2502
116 Ga0207663_10568605 3300025916 Bacteria 888
117 Ga0207649_10125615 3300025920 Bacteria 1736
118 Ga0207681_10226650 3300025923 Bacteria 1449
119 Ga0207650_10564891 3300025925 Bacteria 955
120 Ga0207659_10026586 3300025926 Bacteria 3906
121 Ga0207700_10039422 3300025928 Bacteria 3439
122 Ga0207700_10042615 3300025928 Bacteria 3329
123 Ga0207700_10133519 3300025928 Bacteria 2030
124 Ga0207664_10016343 3300025929 Bacteria 5413
125 Ga0207644_10267324 3300025931 Bacteria 1369
126 Ga0207690_10280429 3300025932 Bacteria 1298
127 Ga0207706_10104325 3300025933 Bacteria 2494
128 Ga0207670_10274222 3300025936 Bacteria 1312
129 Ga0207670_10525653 3300025936 Bacteria 964
130 Ga0207669_10195863 3300025937 Bacteria 1462
131 Ga0207704_10080302 3300025938 Bacteria 2105
132 Ga0207691_10458087 3300025940 Bacteria 1085
133 Ga0207711_10181799 3300025941 Bacteria 1913
134 Ga0207689_10030182 3300025942 Bacteria 4517
135 Ga0207661_10056648 3300025944 Bacteria 3147
136 Ga0207679_10128063 3300025945 Bacteria 2032
137 Ga0207668_10204079 3300025972 Bacteria 1576
138 Ga0207640_10064380 3300025981 Bacteria 2441
139 Ga0207640_10321234 3300025981 Bacteria 1233
140 Ga0207677_10095826 3300026023 Bacteria 2170
141 Ga0207639_10312863 3300026041 Bacteria 1392
142 Ga0207708_10004680 3300026075 Bacteria 10066
143 Ga0207708_10082791 3300026075 Bacteria 2467
144 Ga0207708_10109088 3300026075 Bacteria 2147
145 Ga0207702_10006173 3300026078 Bacteria 10364
146 Ga0207702_10094116 3300026078 Bacteria 2629
147 Ga0207648_10095944 3300026089 Bacteria 2595
148 Ga0207676_10069510 3300026095 Bacteria 2820
149 Ga0207675_100045763 3300026118 Bacteria 4088
150 Ga0207675_100067604 3300026118 Bacteria 3340
151 Ga0207683_10110163 3300026121 Bacteria 2465
152 Ga0207698_10357116 3300026142 Bacteria 1382
153 Ga0207428_10074612 3300027907 Bacteria 2660
154 Ga0268265_10381454 3300028380 Bacteria 1297
155 Ga0268264_10181969 3300028381 Bacteria 1909
156 Ga0265319_1000296 3300028563 Bacteria 37027
157 Ga0265319_1027200 3300028563 Bacteria 2030
158 Ga0265319_1051678 3300028563 Bacteria 1355
159 Ga0265334_10065772 3300028573 Bacteria 1359
160 Ga0265318_10017123 3300028577 Bacteria 2980
161 Ga0265338_10014310 3300028800 Bacteria 8837
162 Ga0265320_10131820 3300031240 Bacteria 1135
163 Ga0265320_10147716 3300031240 Bacteria 1062
164 Ga0307408_100427281 3300031548 Bacteria 1144
165 Ga0265313_10034173 3300031595 Bacteria 2574
166 Ga0307405_10474672 3300031731 Bacteria 997
167 Ga0307406_10102856 3300031901 Bacteria 1950
168 Ga0307406_10785038 3300031901 Bacteria 802
169 Ga0307409_100041670 3300031995 Bacteria 3431
170 Ga0307409_100043138 3300031995 Bacteria 3384
171 Ga0307416_100623381 3300032002 Bacteria 1161
172 Ga0307414_10267268 3300032004 Bacteria 1430
173 Ga0307415_100189475 3300032126 Bacteria 1622
174 Ga0307415_100606326 3300032126 Bacteria 975
175 Ga0373939_0147958 3300035114 Bacteria 852
176 Ga0373941_0167457 3300035115 Bacteria 817
177 Ga0373961_0075251 3300035241 Bacteria 1052
178 Ga0373962_0020814 3300035242 Bacteria 1726
179 Ga0373937_0855144 3300036401 Bacteria 858
180 Ga0395900_0070944 3300037418 Bacteria 3581
181 Ga0395900_0211917 3300037418 Bacteria 1956
182 Ga0395898_0127704 3300037466 Bacteria 2436
183 Ga0395898_0198983 3300037466 Bacteria 1913
184 Ga0395898_0237799 3300037466 Bacteria 1737
185 Ga0395898_0368872 3300037466 Bacteria 1369
186 Ga0395905_0654605 3300037471 Bacteria 952
187 Ga0436364_0061082 3300037853 Bacteria 1550
188 Ga0436364_0082088 3300037853 Bacteria 178031
189 Ga0436364_0174758 3300037853 Bacteria 2625
190 Ga0436364_0668940 3300037853 Bacteria 41832
191 Ga0436364_1210338 3300037853 Bacteria 16436
192 Ga0395901_0002001 3300038443 Bacteria 20971
193 Ga0395901_0051881 3300038443 Bacteria 4264
194 Ga0395901_0103469 3300038443 Bacteria 2987
195 Ga0395901_0819491 3300038443 Bacteria 918
196 Ga0395901_1201438 3300038443 Bacteria 724
197 Ga0436365_0194503 3300039437 Bacteria 8631
198 Ga0436365_0457869 3300039437 Bacteria 20822
199 Ga0436365_1124121 3300039437 Bacteria 24917
200 Ga0436365_1645792 3300039437 Bacteria 3530
201 Ga0436365_1701609 3300039437 Bacteria 2544
202 Ga0436365_1934001 3300039437 Bacteria 8501
203 Ga0436363_0041949 3300039450 Bacteria 677
204 Ga0436363_0626044 3300039450 Bacteria 654
205 Ga0436363_1042894 3300039450 Unclassified 727
206 Ga0436362_0453823 3300039453 Bacteria 2072
207 Ga0466969_0007479 3300044656 Bacteria 5808
208 Ga0466965_0170125 3300044683 Bacteria 1146
209 Ga0466966_0031398 3300044684 Bacteria 3445
210 Ga0466966_0354350 3300044684 Bacteria 882
211 Ga0466966_0380463 3300044684 Bacteria 848
212 Ga0466961_0033850 3300044693 Bacteria 3283
213 Ga0466963_0019177 3300044694 Bacteria 4285
214 Ga0466963_0027856 3300044694 Bacteria 3622
215 Ga0466963_0067738 3300044694 Bacteria 2396
216 Ga0466963_0088622 3300044694 Bacteria 2105
217 Ga0466963_0253626 3300044694 Bacteria 1235
218 Ga0466971_0032560 3300044719 Bacteria 2336
219 Ga0466971_0048412 3300044719 Bacteria 1911
220 Ga0466971_0297006 3300044719 Bacteria 775
221 Ga0466968_0019518 3300044735 Bacteria 2728
222 Ga0466968_0070601 3300044735 Bacteria 1520
223 Ga0466970_0014281 3300044765 Bacteria 4074
224 Ga0466970_0037573 3300044765 Bacteria 2567
225 Ga0466970_0331842 3300044765 Bacteria 861
226 Ga0466957_0002360 3300044842 Bacteria 10130
227 Ga0466957_0078251 3300044842 Bacteria 2056
228 Ga0466957_0278851 3300044842 Bacteria 1118
229 Ga0466960_0009875 3300044901 Bacteria 3947
230 Ga0466960_0420039 3300044901 Bacteria 773
231 Ga0466959_0032049 3300045049 Bacteria 3889
232 Ga0466959_0080173 3300045049 Bacteria 2353
233 Ga0466959_0082662 3300045049 Bacteria 2313
234 Ga0466959_0150086 3300045049 Bacteria 1643
235 Ga0466959_0306683 3300045049 Unclassified 1087
236 Ga0466959_0616949 3300045049 Bacteria 729
237 Ga0466958_0008580 3300045836 Bacteria 5673
238 Ga0466958_0012580 3300045836 Bacteria 4796
239 Ga0466958_0031140 3300045836 Bacteria 3170
240 Ga0466958_0056061 3300045836 Bacteria 2393
241 Ga0466958_0112215 3300045836 Bacteria 1702
242 Ga0466967_0000235 3300045976 Bacteria 24059
243 Ga0466967_0033951 3300045976 Bacteria 4324
244 Ga0466967_0151609 3300045976 Bacteria 2167
245 Ga0495664_0114159 3300046477 Bacteria 1632
246 Ga0495628_0355823 3300046516 Bacteria 1076
247 Ga0495631_0124186 3300046518 Bacteria 1110
248 Ga0495640_0300643 3300046533 Bacteria 997
249 Ga0495645_0148016 3300046543 Bacteria 1634
250 Ga0495589_0234484 3300046794 Bacteria 860
251 Ga0496100_0007643 3300048903 Bacteria 5979
252 Ga0496104_0047288 3300048907 Bacteria 4055
253 Ga0496105_0063959 3300048908 Bacteria 3035
254 Ga0496106_0020509 3300048909 Bacteria 4906
255 Ga0496108_0042911 3300048911 Bacteria 3776
256 Ga0496109_0002144 3300048912 Bacteria 16418
257 Ga0496109_0010682 3300048912 Bacteria 7854
258 Ga0496109_0048824 3300048912 Bacteria 3851
259 Ga0496110_0014315 3300048913 Bacteria 6582
260 Ga0496111_0005849 3300048914 Bacteria 7932
261 Ga0496112_0133953 3300048915 Bacteria 2448
262 Ga0496113_0016733 3300048916 Bacteria 5071
263 Ga0496114_0295339 3300048917 Bacteria 1430
264 Ga0496121_0001564 3300048924 Bacteria 38212
265 Ga0496121_0004416 3300048924 Bacteria 18941
266 Ga0501032_0411560 3300049569 Bacteria 868
267 Ga0501034_0003181 3300049571 Bacteria 18889
268 Ga0501036_0105112 3300049572 Bacteria 2388
269 Ga0501039_0553834 3300049575 Bacteria 902
270 Ga0501040_0678793 3300049576 Bacteria 745
271 Ga0501047_0005987 3300049581 Bacteria 11430
272 Ga0501047_0036098 3300049581 Bacteria 4776
273 Ga0501071_0065955 3300049587 Bacteria 2630
274 Ga0501072_0473643 3300049588 Bacteria 991
275 Ga0501075_0066380 3300049591 Bacteria 2723
276 Ga0501076_0110694 3300049592 Bacteria 2220
277 Ga0501076_1122301 3300049592 Bacteria 647
278 Ga0501249_068641 3300049679 Bacteria 827
279 Ga0501079_0198648 3300049741 Bacteria 1566
280 Ga0501079_0246158 3300049741 Bacteria 1397
281 Ga0501035_0246741 3300049822 Bacteria 1517
282 Ga0501035_0270389 3300049822 Bacteria 1439
283 Ga0501044_0071872 3300049823 Bacteria 3518
284 Ga0501045_0462936 3300049824 Bacteria 942
285 nmdc:mga03n38_15261_c1 3300050490 Bacteria 2962
286 nmdc:mga00v17_367304_c1 3300050491 Bacteria 936
287 nmdc:mga0yw44_409333_c1 3300050492 Bacteria 917
288 nmdc:mga05p37_2070_c1 3300050507 Bacteria 23400
289 nmdc:mga05p37_322439_c1 3300050507 Bacteria 1828
290 nmdc:mga0qj67_36147_c1 3300050509 Bacteria 3864
291 nmdc:mga0qj67_396748_c1 3300050509 Bacteria 1113
292 nmdc:mga0qj67_421903_c1 3300050509 Bacteria 1075
293 nmdc:mga06r32_1123640_c1 3300050510 Bacteria 734
294 nmdc:mga06r32_93921_c1 3300050510 Bacteria 2935
295 nmdc:mga08y16_11083_c1 3300050511 Bacteria 9465
296 nmdc:mga08y16_351409_c1 3300050511 Bacteria 1514
297 nmdc:mga08y16_375504_c1 3300050511 Bacteria 1458
298 nmdc:mga0n895_274009_c1 3300050512 Bacteria 1711
299 nmdc:mga0n895_48333_c1 3300050512 Bacteria 4164
300 nmdc:mga08x19_114099_c1 3300050514 Bacteria 1805
301 nmdc:mga0a205_69181_c1 3300050515 Bacteria 3409
302 nmdc:mga0a205_83071_c1 3300050515 Bacteria 3094
303 Ga0495655_0012610 3300053083 Bacteria 1727
304 Ga0466962_0006661 3300061719 Bacteria 5542
305 Ga0466962_0018732 3300061719 Bacteria 3328
306 Ga0466962_0030478 3300061719 Bacteria 2584
307 Ga0466962_0046779 3300061719 Bacteria 2067
308 Ga0466962_0079242 3300061719 Bacteria 1570

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10017251 Ga0213876_100172515 172
2 3300044765 Ga0466970_0331842 Ga0466970_0331842_165_782 176
3 3300044901 Ga0466960_0420039 Ga0466960_0420039_197_745 177
4 3300044683 Ga0466965_0170125 Ga0466965_0170125_131_748 178
5 3300044735 Ga0466968_0070601 Ga0466968_0070601_275_892 178
6 3300005985 Ga0081539_10255248 Ga0081539_102552482 182
7 3300044656 Ga0466969_0007479 Ga0466969_0007479_4704_5291 183
8 3300044684 Ga0466966_0354350 Ga0466966_0354350_155_742 183
9 3300044765 Ga0466970_0037573 Ga0466970_0037573_304_891 183
10 3300045049 Ga0466959_0032049 Ga0466959_0032049_104_691 183
11 3300045836 Ga0466958_0031140 Ga0466958_0031140_146_733 183
12 3300050509 nmdc:mga0qj67_396748_c1 nmdc:mga0qj67_396748_c1_325_906 183
13 3300014326 Ga0157380_10866090 Ga0157380_108660902 184
14 3300025908 Ga0207643_10423239 Ga0207643_104232392 184
15 3300037853 Ga0436364_0061082 Ga0436364_0061082_771_1352 187
16 3300037418 Ga0395900_0070944 Ga0395900_0070944_626_1234 188
17 3300037418 Ga0395900_0211917 Ga0395900_0211917_316_942 188
18 3300038443 Ga0395901_0103469 Ga0395901_0103469_1429_2037 188
19 3300038443 Ga0395901_0819491 Ga0395901_0819491_16_624 191
20 3300039450 Ga0436363_0626044 Ga0436363_0626044_14_595 192
21 3300053083 Ga0495655_0012610 Ga0495655_0012610_60_683 192
22 3300021384 Ga0213876_10051711 Ga0213876_100517112 193
23 3300021388 Ga0213875_10015096 Ga0213875_100150962 193
24 3300021388 Ga0213875_10134390 Ga0213875_101343902 193
25 3300044694 Ga0466963_0019177 Ga0466963_0019177_1856_2506 193
26 3300044719 Ga0466971_0297006 Ga0466971_0297006_163_744 193
27 3300044735 Ga0466968_0019518 Ga0466968_0019518_1781_2431 193
28 3300044842 Ga0466957_0002360 Ga0466957_0002360_7005_7655 193
29 3300045049 Ga0466959_0080173 Ga0466959_0080173_1392_2042 193
30 3300045836 Ga0466958_0012580 Ga0466958_0012580_3928_4578 193
31 3300061719 Ga0466962_0030478 Ga0466962_0030478_1739_2389 193
32 3300005341 Ga0070691_10012024 Ga0070691_100120246 194
33 3300005347 Ga0070668_100282037 Ga0070668_1002820371 194
34 3300005366 Ga0070659_100246228 Ga0070659_1002462282 194
35 3300005441 Ga0070700_100134990 Ga0070700_1001349901 194
36 3300005545 Ga0070695_100138785 Ga0070695_1001387852 194
37 3300005615 Ga0070702_100396505 Ga0070702_1003965051 194
38 3300005719 Ga0068861_100028955 Ga0068861_1000289555 194
39 3300005981 Ga0081538_10016239 Ga0081538_100162397 194
40 3300005981 Ga0081538_10026993 Ga0081538_100269936 194
41 3300006844 Ga0075428_100007055 Ga0075428_1000070559 194
42 3300006846 Ga0075430_100035941 Ga0075430_1000359415 194
43 3300006852 Ga0075433_10135546 Ga0075433_101355464 194
44 3300006880 Ga0075429_100047565 Ga0075429_1000475654 194
45 3300009094 Ga0111539_10082291 Ga0111539_100822915 194
46 3300009098 Ga0105245_10011967 Ga0105245_1001196710 194
47 3300009147 Ga0114129_10003533 Ga0114129_1000353315 194
48 3300009553 Ga0105249_10004101 Ga0105249_1000410113 194
49 3300010375 Ga0105239_10329921 Ga0105239_103299213 194
50 3300013306 Ga0163162_10082139 Ga0163162_100821395 194
51 3300013307 Ga0157372_10787288 Ga0157372_107872882 194
52 3300025923 Ga0207681_10226650 Ga0207681_102266502 194
53 3300025932 Ga0207690_10280429 Ga0207690_102804291 194
54 3300025972 Ga0207668_10204079 Ga0207668_102040793 194
55 3300025981 Ga0207640_10321234 Ga0207640_103212342 194
56 3300026075 Ga0207708_10109088 Ga0207708_101090882 194
57 3300026118 Ga0207675_100067604 Ga0207675_1000676041 194
58 3300031731 Ga0307405_10474672 Ga0307405_104746722 194
59 3300031901 Ga0307406_10102856 Ga0307406_101028562 194
60 3300031995 Ga0307409_100043138 Ga0307409_1000431384 194
61 3300032002 Ga0307416_100623381 Ga0307416_1006233812 194
62 3300032126 Ga0307415_100189475 Ga0307415_1001894751 194
63 3300032126 Ga0307415_100606326 Ga0307415_1006063262 194
64 3300035114 Ga0373939_0147958 Ga0373939_0147958_147_752 194
65 3300035115 Ga0373941_0167457 Ga0373941_0167457_11_616 194
66 3300035241 Ga0373961_0075251 Ga0373961_0075251_273_878 194
67 3300035242 Ga0373962_0020814 Ga0373962_0020814_700_1305 194
68 3300038443 Ga0395901_0051881 Ga0395901_0051881_1471_2076 194
69 3300039437 Ga0436365_0194503 Ga0436365_0194503_3491_4183 194
70 3300044694 Ga0466963_0253626 Ga0466963_0253626_564_1172 194
71 3300044901 Ga0466960_0009875 Ga0466960_0009875_2568_3173 194
72 3300045976 Ga0466967_0151609 Ga0466967_0151609_1081_1689 194
73 3300046518 Ga0495631_0124186 Ga0495631_0124186_276_881 194
74 3300046794 Ga0495589_0234484 Ga0495589_0234484_118_723 194
75 3300049572 Ga0501036_0105112 Ga0501036_0105112_108_713 194
76 3300049587 Ga0501071_0065955 Ga0501071_0065955_328_933 194
77 3300049588 Ga0501072_0473643 Ga0501072_0473643_247_852 194
78 3300049591 Ga0501075_0066380 Ga0501075_0066380_1075_1680 194
79 3300049592 Ga0501076_0110694 Ga0501076_0110694_685_1290 194
80 3300049741 Ga0501079_0198648 Ga0501079_0198648_746_1351 194
81 3300049822 Ga0501035_0270389 Ga0501035_0270389_375_980 194
82 3300049824 Ga0501045_0462936 Ga0501045_0462936_44_649 194
83 3300050492 nmdc:mga0yw44_409333_c1 nmdc:mga0yw44_409333_c1_302_904 194
84 3300050507 nmdc:mga05p37_2070_c1 nmdc:mga05p37_2070_c1_16740_17345 194
85 3300050507 nmdc:mga05p37_322439_c1 nmdc:mga05p37_322439_c1_831_1436 194
86 3300050509 nmdc:mga0qj67_36147_c1 nmdc:mga0qj67_36147_c1_311_916 194
87 3300050509 nmdc:mga0qj67_421903_c1 nmdc:mga0qj67_421903_c1_276_881 194
88 3300050510 nmdc:mga06r32_1123640_c1 nmdc:mga06r32_1123640_c1_72_677 194
89 3300050511 nmdc:mga08y16_351409_c1 nmdc:mga08y16_351409_c1_53_658 194
90 3300050512 nmdc:mga0n895_274009_c1 nmdc:mga0n895_274009_c1_241_846 194
91 3300050515 nmdc:mga0a205_69181_c1 nmdc:mga0a205_69181_c1_2713_3318 194
92 3300061719 Ga0466962_0006661 Ga0466962_0006661_2455_3060 194
93 3300021384 Ga0213876_10010594 Ga0213876_100105945 195
94 3300037466 Ga0395898_0237799 Ga0395898_0237799_598_1224 195
95 3300037466 Ga0395898_0368872 Ga0395898_0368872_207_833 195
96 3300037471 Ga0395905_0654605 Ga0395905_0654605_204_830 195
97 3300038443 Ga0395901_0002001 Ga0395901_0002001_14510_15136 195
98 3300039437 Ga0436365_1124121 Ga0436365_1124121_1119_1715 195
99 3300045049 Ga0466959_0616949 Ga0466959_0616949_70_657 195
100 3300049575 Ga0501039_0553834 Ga0501039_0553834_83_688 195
101 3300049576 Ga0501040_0678793 Ga0501040_0678793_91_696 195
102 3300049592 Ga0501076_1122301 Ga0501076_1122301_13_618 195
103 3300049741 Ga0501079_0246158 Ga0501079_0246158_252_857 195
104 3300009094 Ga0111539_11432747 Ga0111539_114327471 196
105 3300009176 Ga0105242_11107617 Ga0105242_111076172 196
106 3300003373 JGI25407J50210_10049965 JGI25407J50210_100499652 197
107 3300005937 Ga0081455_10049022 Ga0081455_100490225 197
108 3300005981 Ga0081538_10000128 Ga0081538_1000012821 197
109 3300005981 Ga0081538_10000698 Ga0081538_1000069819 197
110 3300021384 Ga0213876_10031594 Ga0213876_100315942 197
111 3300037466 Ga0395898_0127704 Ga0395898_0127704_1265_1873 197
112 3300039437 Ga0436365_1934001 Ga0436365_1934001_2087_2698 197
113 3300005436 Ga0070713_100030057 Ga0070713_1000300574 198
114 3300005436 Ga0070713_100055881 Ga0070713_1000558812 198
115 3300005441 Ga0070700_100067813 Ga0070700_1000678132 198
116 3300005985 Ga0081539_10029368 Ga0081539_100293682 198
117 3300006038 Ga0075365_10415676 Ga0075365_104156762 198
118 3300006048 Ga0075363_100020417 Ga0075363_1000204173 198
119 3300006178 Ga0075367_10397976 Ga0075367_103979762 198
120 3300009551 Ga0105238_10522437 Ga0105238_105224372 198
121 3300014325 Ga0163163_10139699 Ga0163163_101396992 198
122 3300014326 Ga0157380_10199540 Ga0157380_101995402 198
123 3300025928 Ga0207700_10039422 Ga0207700_100394223 198
124 3300025928 Ga0207700_10042615 Ga0207700_100426153 198
125 3300025936 Ga0207670_10525653 Ga0207670_105256531 198
126 3300026075 Ga0207708_10082791 Ga0207708_100827912 198
127 3300028563 Ga0265319_1000296 Ga0265319_10002969 198
128 3300028563 Ga0265319_1027200 Ga0265319_10272002 198
129 3300028563 Ga0265319_1051678 Ga0265319_10516782 198
130 3300028573 Ga0265334_10065772 Ga0265334_100657721 198
131 3300028577 Ga0265318_10017123 Ga0265318_100171231 198
132 3300028800 Ga0265338_10014310 Ga0265338_100143104 198
133 3300031240 Ga0265320_10131820 Ga0265320_101318202 198
134 3300031240 Ga0265320_10147716 Ga0265320_101477161 198
135 3300031548 Ga0307408_100427281 Ga0307408_1004272812 198
136 3300031595 Ga0265313_10034173 Ga0265313_100341733 198
137 3300031901 Ga0307406_10785038 Ga0307406_107850382 198
138 3300031995 Ga0307409_100041670 Ga0307409_1000416702 198
139 3300032004 Ga0307414_10267268 Ga0307414_102672682 198
140 3300048912 Ga0496109_0002144 Ga0496109_0002144_12925_13602 198
141 3300048912 Ga0496109_0048824 Ga0496109_0048824_645_1268 198
142 3300048924 Ga0496121_0001564 Ga0496121_0001564_16810_17442 198
143 3300048924 Ga0496121_0004416 Ga0496121_0004416_15493_16125 198
144 3300049679 Ga0501249_068641 Ga0501249_068641_122_757 198
145 3300050490 nmdc:mga03n38_15261_c1 nmdc:mga03n38_15261_c1_1660_2313 198
146 3300050491 nmdc:mga00v17_367304_c1 nmdc:mga00v17_367304_c1_259_900 198
147 3300002073 JGI24745J21846_1019416 JGI24745J21846_10194162 199
148 3300002074 JGI24748J21848_1021104 JGI24748J21848_10211042 199
149 3300005329 Ga0070683_100021169 Ga0070683_1000211697 199
150 3300005331 Ga0070670_100714954 Ga0070670_1007149542 199
151 3300005334 Ga0068869_100051664 Ga0068869_1000516642 199
152 3300005337 Ga0070682_100012653 Ga0070682_1000126534 199
153 3300005338 Ga0068868_100034344 Ga0068868_1000343442 199
154 3300005340 Ga0070689_100118712 Ga0070689_1001187122 199
155 3300005341 Ga0070691_10028563 Ga0070691_100285633 199
156 3300005344 Ga0070661_100120756 Ga0070661_1001207562 199
157 3300005345 Ga0070692_10063297 Ga0070692_100632972 199
158 3300005347 Ga0070668_100112529 Ga0070668_1001125292 199
159 3300005354 Ga0070675_100157557 Ga0070675_1001575572 199
160 3300005355 Ga0070671_100312711 Ga0070671_1003127112 199
161 3300005356 Ga0070674_100190342 Ga0070674_1001903422 199
162 3300005406 Ga0070703_10036252 Ga0070703_100362522 199
163 3300005435 Ga0070714_100008517 Ga0070714_1000085174 199
164 3300005436 Ga0070713_100071456 Ga0070713_1000714564 199
165 3300005437 Ga0070710_10051389 Ga0070710_100513892 199
166 3300005440 Ga0070705_100166432 Ga0070705_1001664322 199
167 3300005441 Ga0070700_100004700 Ga0070700_1000047008 199
168 3300005455 Ga0070663_100113695 Ga0070663_1001136953 199
169 3300005456 Ga0070678_100054934 Ga0070678_1000549342 199
170 3300005457 Ga0070662_100035181 Ga0070662_1000351813 199
171 3300005459 Ga0068867_100073018 Ga0068867_1000730183 199
172 3300005466 Ga0070685_10036774 Ga0070685_100367744 199
173 3300005539 Ga0068853_100138947 Ga0068853_1001389473 199
174 3300005549 Ga0070704_100018579 Ga0070704_1000185792 199
175 3300005564 Ga0070664_100027263 Ga0070664_1000272633 199
176 3300005614 Ga0068856_100046731 Ga0068856_1000467312 199
177 3300005615 Ga0070702_100037266 Ga0070702_1000372662 199
178 3300005616 Ga0068852_100008989 Ga0068852_1000089898 199
179 3300005617 Ga0068859_100270311 Ga0068859_1002703112 199
180 3300005618 Ga0068864_100008830 Ga0068864_1000088308 199
181 3300005719 Ga0068861_100066857 Ga0068861_1000668573 199
182 3300005841 Ga0068863_100048952 Ga0068863_1000489524 199
183 3300005843 Ga0068860_100272385 Ga0068860_1002723852 199
184 3300005844 Ga0068862_100083258 Ga0068862_1000832582 199
185 3300006028 Ga0070717_10009444 Ga0070717_100094446 199
186 3300006028 Ga0070717_10218983 Ga0070717_102189832 199
187 3300006048 Ga0075363_100182107 Ga0075363_1001821071 199
188 3300006058 Ga0075432_10062382 Ga0075432_100623822 199
189 3300006175 Ga0070712_100058502 Ga0070712_1000585023 199
190 3300006178 Ga0075367_10021086 Ga0075367_100210863 199
191 3300006844 Ga0075428_100141706 Ga0075428_1001417063 199
192 3300006852 Ga0075433_10091136 Ga0075433_100911363 199
193 3300006871 Ga0075434_100008053 Ga0075434_10000805311 199
194 3300006881 Ga0068865_100110161 Ga0068865_1001101612 199
195 3300006914 Ga0075436_100113329 Ga0075436_1001133292 199
196 3300006931 Ga0097620_100270280 Ga0097620_1002702802 199
197 3300007076 Ga0075435_100060734 Ga0075435_1000607343 199
198 3300009093 Ga0105240_10699499 Ga0105240_106994992 199
199 3300009094 Ga0111539_10030486 Ga0111539_100304865 199
200 3300009094 Ga0111539_10469367 Ga0111539_104693671 199
201 3300009098 Ga0105245_10005719 Ga0105245_1000571911 199
202 3300009147 Ga0114129_10079822 Ga0114129_100798227 199
203 3300009177 Ga0105248_10377717 Ga0105248_103777172 199
204 3300010375 Ga0105239_10011796 Ga0105239_1001179611 199
205 3300011119 Ga0105246_10093253 Ga0105246_100932532 199
206 3300013296 Ga0157374_10028190 Ga0157374_100281905 199
207 3300013307 Ga0157372_10053582 Ga0157372_100535822 199
208 3300014325 Ga0163163_10020096 Ga0163163_100200964 199
209 3300014326 Ga0157380_10067916 Ga0157380_100679162 199
210 3300014745 Ga0157377_10014314 Ga0157377_100143142 199
211 3300021388 Ga0213875_10000059 Ga0213875_100000595 199
212 3300021388 Ga0213875_10021495 Ga0213875_100214953 199
213 3300021388 Ga0213875_10034469 Ga0213875_100344692 199
214 3300025885 Ga0207653_10114471 Ga0207653_101144712 199
215 3300025901 Ga0207688_10001384 Ga0207688_100013844 199
216 3300025915 Ga0207693_10083524 Ga0207693_100835242 199
217 3300025916 Ga0207663_10568605 Ga0207663_105686051 199
218 3300025920 Ga0207649_10125615 Ga0207649_101256152 199
219 3300025925 Ga0207650_10564891 Ga0207650_105648912 199
220 3300025926 Ga0207659_10026586 Ga0207659_100265862 199
221 3300025928 Ga0207700_10133519 Ga0207700_101335192 199
222 3300025929 Ga0207664_10016343 Ga0207664_100163434 199
223 3300025931 Ga0207644_10267324 Ga0207644_102673242 199
224 3300025933 Ga0207706_10104325 Ga0207706_101043252 199
225 3300025936 Ga0207670_10274222 Ga0207670_102742222 199
226 3300025937 Ga0207669_10195863 Ga0207669_101958631 199
227 3300025938 Ga0207704_10080302 Ga0207704_100803022 199
228 3300025940 Ga0207691_10458087 Ga0207691_104580872 199
229 3300025941 Ga0207711_10181799 Ga0207711_101817992 199
230 3300025942 Ga0207689_10030182 Ga0207689_100301823 199
231 3300025944 Ga0207661_10056648 Ga0207661_100566484 199
232 3300025945 Ga0207679_10128063 Ga0207679_101280632 199
233 3300025981 Ga0207640_10064380 Ga0207640_100643802 199
234 3300026023 Ga0207677_10095826 Ga0207677_100958262 199
235 3300026041 Ga0207639_10312863 Ga0207639_103128632 199
236 3300026075 Ga0207708_10004680 Ga0207708_1000468010 199
237 3300026078 Ga0207702_10006173 Ga0207702_100061735 199
238 3300026078 Ga0207702_10094116 Ga0207702_100941162 199
239 3300026089 Ga0207648_10095944 Ga0207648_100959443 199
240 3300026095 Ga0207676_10069510 Ga0207676_100695102 199
241 3300026118 Ga0207675_100045763 Ga0207675_1000457632 199
242 3300026121 Ga0207683_10110163 Ga0207683_101101632 199
243 3300026142 Ga0207698_10357116 Ga0207698_103571162 199
244 3300027907 Ga0207428_10074612 Ga0207428_100746124 199
245 3300028380 Ga0268265_10381454 Ga0268265_103814542 199
246 3300028381 Ga0268264_10181969 Ga0268264_101819692 199
247 3300036401 Ga0373937_0855144 Ga0373937_0855144_121_747 199
248 3300037466 Ga0395898_0198983 Ga0395898_0198983_1223_1858 199
249 3300037853 Ga0436364_0082088 Ga0436364_0082088_47806_48459 199
250 3300037853 Ga0436364_0174758 Ga0436364_0174758_1680_2297 199
251 3300037853 Ga0436364_0668940 Ga0436364_0668940_14892_15509 199
252 3300037853 Ga0436364_1210338 Ga0436364_1210338_8842_9459 199
253 3300038443 Ga0395901_1201438 Ga0395901_1201438_64_663 199
254 3300039437 Ga0436365_0457869 Ga0436365_0457869_5137_5754 199
255 3300039437 Ga0436365_1645792 Ga0436365_1645792_2745_3404 199
256 3300039437 Ga0436365_1701609 Ga0436365_1701609_849_1466 199
257 3300039450 Ga0436363_0041949 Ga0436363_0041949_30_647 199
258 3300039450 Ga0436363_1042894 Ga0436363_1042894_41_691 199
259 3300039453 Ga0436362_0453823 Ga0436362_0453823_32_649 199
260 3300044684 Ga0466966_0031398 Ga0466966_0031398_2316_2948 199
261 3300044684 Ga0466966_0380463 Ga0466966_0380463_90_707 199
262 3300044693 Ga0466961_0033850 Ga0466961_0033850_353_973 199
263 3300044694 Ga0466963_0027856 Ga0466963_0027856_535_1170 199
264 3300044694 Ga0466963_0067738 Ga0466963_0067738_353_967 199
265 3300044694 Ga0466963_0088622 Ga0466963_0088622_224_841 199
266 3300044719 Ga0466971_0032560 Ga0466971_0032560_1070_1687 199
267 3300044719 Ga0466971_0048412 Ga0466971_0048412_264_881 199
268 3300044765 Ga0466970_0014281 Ga0466970_0014281_2304_2924 199
269 3300044842 Ga0466957_0078251 Ga0466957_0078251_127_762 199
270 3300044842 Ga0466957_0278851 Ga0466957_0278851_229_846 199
271 3300045049 Ga0466959_0082662 Ga0466959_0082662_1460_2077 199
272 3300045049 Ga0466959_0150086 Ga0466959_0150086_239_871 199
273 3300045049 Ga0466959_0306683 Ga0466959_0306683_59_682 199
274 3300045836 Ga0466958_0008580 Ga0466958_0008580_593_1213 199
275 3300045836 Ga0466958_0056061 Ga0466958_0056061_657_1274 199
276 3300045836 Ga0466958_0112215 Ga0466958_0112215_265_882 199
277 3300045976 Ga0466967_0000235 Ga0466967_0000235_11287_11907 199
278 3300045976 Ga0466967_0033951 Ga0466967_0033951_272_895 199
279 3300046477 Ga0495664_0114159 Ga0495664_0114159_592_1209 199
280 3300046516 Ga0495628_0355823 Ga0495628_0355823_50_667 199
281 3300046533 Ga0495640_0300643 Ga0495640_0300643_322_951 199
282 3300046543 Ga0495645_0148016 Ga0495645_0148016_61_678 199
283 3300048903 Ga0496100_0007643 Ga0496100_0007643_3444_4043 199
284 3300048907 Ga0496104_0047288 Ga0496104_0047288_1215_1814 199
285 3300048908 Ga0496105_0063959 Ga0496105_0063959_916_1515 199
286 3300048909 Ga0496106_0020509 Ga0496106_0020509_1913_2512 199
287 3300048911 Ga0496108_0042911 Ga0496108_0042911_2455_3054 199
288 3300048912 Ga0496109_0010682 Ga0496109_0010682_1353_1952 199
289 3300048913 Ga0496110_0014315 Ga0496110_0014315_5173_5772 199
290 3300048914 Ga0496111_0005849 Ga0496111_0005849_1117_1716 199
291 3300048915 Ga0496112_0133953 Ga0496112_0133953_750_1349 199
292 3300048916 Ga0496113_0016733 Ga0496113_0016733_1338_1937 199
293 3300048917 Ga0496114_0295339 Ga0496114_0295339_28_627 199
294 3300049569 Ga0501032_0411560 Ga0501032_0411560_175_780 199
295 3300049571 Ga0501034_0003181 Ga0501034_0003181_10073_10678 199
296 3300049581 Ga0501047_0005987 Ga0501047_0005987_3670_4275 199
297 3300049581 Ga0501047_0036098 Ga0501047_0036098_1158_1763 199
298 3300049822 Ga0501035_0246741 Ga0501035_0246741_900_1505 199
299 3300049823 Ga0501044_0071872 Ga0501044_0071872_691_1296 199
300 3300050510 nmdc:mga06r32_93921_c1 nmdc:mga06r32_93921_c1_1315_1914 199
301 3300050511 nmdc:mga08y16_11083_c1 nmdc:mga08y16_11083_c1_6789_7388 199
302 3300050511 nmdc:mga08y16_375504_c1 nmdc:mga08y16_375504_c1_845_1444 199
303 3300050512 nmdc:mga0n895_48333_c1 nmdc:mga0n895_48333_c1_963_1562 199
304 3300050514 nmdc:mga08x19_114099_c1 nmdc:mga08x19_114099_c1_108_707 199
305 3300050515 nmdc:mga0a205_83071_c1 nmdc:mga0a205_83071_c1_524_1123 199
306 3300061719 Ga0466962_0018732 Ga0466962_0018732_395_1015 199
307 3300061719 Ga0466962_0046779 Ga0466962_0046779_1319_1954 199
308 3300061719 Ga0466962_0079242 Ga0466962_0079242_162_779 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

162

218

0.97

PF00072

Response_reg

Response regulator receiver domain

33

144

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9777 138 193
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9706 138 197
6ide-assembly1.cif.gz_A crystal structure of the vibrio cholera vqma-ligand-dna complex provides molecular mechanisms for drug design 0.955 138 197
3qp5-assembly1.cif.gz_B crystal structure of cvir bound to antagonist chlorolactone (cl) 0.9547 138 194
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9539 135 199
ID Description Score Start End Superfamily
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9777 138 193 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.973 138 194 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9644 138 193 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.96 138 193 1.10.10.10
1fseC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9539 135 199 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9J7Q6-F1-model_v4 DNA-binding response regulator 0.9391 3 125 GO:0000160
GO:0003677
AF-A0A538FES5-F1-model_v4 Response regulator transcription factor 0.9379 1 122 GO:0000160
GO:0003677
AF-A0A0T2ICE2-F1-model_v4 Response regulatory domain-containing protein 0.9369 2 118 GO:0000160
GO:0003677
AF-A0A7K0A0K9-F1-model_v4 Response regulator 0.9347 3 122 GO:0000160
AF-A0A7Y9RSK6-F1-model_v4 DNA-binding NarL/FixJ family response regulator 0.9298 4 122 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
92.4 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map