F399876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 308 | 197 | 308 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300048912|Ga0496109_0002144|Ga0496109_0002144_12925_13602 |
| Length | 225 |
| Sequence | MAQRPPVRERGTDHAAPRGSPRMMEGSERRLRVLVVDDHDVVHWGFRLMLTQQAWVDRCLSARNADEAVELTRRYEPHVAVVDLFIGEESGAAVSAQLREAWAGVKVLLVSGAGQISPRAAAAAGAAGFVSKDMPAADIARAVRMVGLGHNVFPNQPDESGVILTGREREVLELVRSGATNREIAAALHLSPHTIKEHASGLYRKLDARNRAEAVDRAQRLGLLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 77 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 78 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 120 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 128 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 131 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 138 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 139 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 140 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 145 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 146 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 147 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 148 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 149 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 182 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 187 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 188 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 189 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.6 |
| Nodule | 0 |
| Rhizoplane | 4.22 |
| Rhizosphere | 85.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1019416 | 3300002073 | Bacteria | 794 |
| 2 | JGI24748J21848_1021104 | 3300002074 | Bacteria | 786 |
| 3 | JGI25407J50210_10049965 | 3300003373 | Bacteria | 1061 |
| 4 | Ga0070683_100021169 | 3300005329 | Bacteria | 5799 |
| 5 | Ga0070670_100714954 | 3300005331 | Bacteria | 901 |
| 6 | Ga0068869_100051664 | 3300005334 | Bacteria | 2982 |
| 7 | Ga0070682_100012653 | 3300005337 | Bacteria | 4841 |
| 8 | Ga0068868_100034344 | 3300005338 | Bacteria | 3915 |
| 9 | Ga0070689_100118712 | 3300005340 | Bacteria | 2111 |
| 10 | Ga0070691_10012024 | 3300005341 | Bacteria | 3963 |
| 11 | Ga0070691_10028563 | 3300005341 | Bacteria | 2607 |
| 12 | Ga0070661_100120756 | 3300005344 | Bacteria | 1963 |
| 13 | Ga0070692_10063297 | 3300005345 | Bacteria | 1954 |
| 14 | Ga0070668_100112529 | 3300005347 | Bacteria | 2168 |
| 15 | Ga0070668_100282037 | 3300005347 | Bacteria | 1388 |
| 16 | Ga0070675_100157557 | 3300005354 | Bacteria | 1950 |
| 17 | Ga0070671_100312711 | 3300005355 | Bacteria | 1338 |
| 18 | Ga0070674_100190342 | 3300005356 | Bacteria | 1578 |
| 19 | Ga0070659_100246228 | 3300005366 | Bacteria | 1481 |
| 20 | Ga0070703_10036252 | 3300005406 | Bacteria | 1514 |
| 21 | Ga0070714_100008517 | 3300005435 | Bacteria | 8016 |
| 22 | Ga0070713_100030057 | 3300005436 | Bacteria | 4310 |
| 23 | Ga0070713_100055881 | 3300005436 | Bacteria | 3282 |
| 24 | Ga0070713_100071456 | 3300005436 | Bacteria | 2932 |
| 25 | Ga0070710_10051389 | 3300005437 | Bacteria | 2314 |
| 26 | Ga0070705_100166432 | 3300005440 | Bacteria | 1479 |
| 27 | Ga0070700_100004700 | 3300005441 | Bacteria | 7159 |
| 28 | Ga0070700_100067813 | 3300005441 | Bacteria | 2267 |
| 29 | Ga0070700_100134990 | 3300005441 | Bacteria | 1670 |
| 30 | Ga0070663_100113695 | 3300005455 | Bacteria | 2038 |
| 31 | Ga0070678_100054934 | 3300005456 | Bacteria | 2905 |
| 32 | Ga0070662_100035181 | 3300005457 | Bacteria | 3536 |
| 33 | Ga0068867_100073018 | 3300005459 | Bacteria | 2569 |
| 34 | Ga0070685_10036774 | 3300005466 | Bacteria | 2769 |
| 35 | Ga0068853_100138947 | 3300005539 | Bacteria | 2180 |
| 36 | Ga0070695_100138785 | 3300005545 | Bacteria | 1683 |
| 37 | Ga0070704_100018579 | 3300005549 | Bacteria | 4449 |
| 38 | Ga0070664_100027263 | 3300005564 | Bacteria | 4746 |
| 39 | Ga0068856_100046731 | 3300005614 | Bacteria | 4263 |
| 40 | Ga0070702_100037266 | 3300005615 | Bacteria | 2700 |
| 41 | Ga0070702_100396505 | 3300005615 | Bacteria | 986 |
| 42 | Ga0068852_100008989 | 3300005616 | Bacteria | 7396 |
| 43 | Ga0068859_100270311 | 3300005617 | Bacteria | 1792 |
| 44 | Ga0068864_100008830 | 3300005618 | Bacteria | 8309 |
| 45 | Ga0068861_100028955 | 3300005719 | Bacteria | 4045 |
| 46 | Ga0068861_100066857 | 3300005719 | Bacteria | 2772 |
| 47 | Ga0068863_100048952 | 3300005841 | Bacteria | 4008 |
| 48 | Ga0068860_100272385 | 3300005843 | Bacteria | 1652 |
| 49 | Ga0068862_100083258 | 3300005844 | Bacteria | 2778 |
| 50 | Ga0081455_10049022 | 3300005937 | Bacteria | 3643 |
| 51 | Ga0081538_10000128 | 3300005981 | Bacteria | 77546 |
| 52 | Ga0081538_10000698 | 3300005981 | Bacteria | 36881 |
| 53 | Ga0081538_10016239 | 3300005981 | Bacteria | 5721 |
| 54 | Ga0081538_10026993 | 3300005981 | Bacteria | 3995 |
| 55 | Ga0081539_10029368 | 3300005985 | Bacteria | 3436 |
| 56 | Ga0081539_10255248 | 3300005985 | Bacteria | 777 |
| 57 | Ga0070717_10009444 | 3300006028 | Bacteria | 7330 |
| 58 | Ga0070717_10218983 | 3300006028 | Bacteria | 1673 |
| 59 | Ga0075365_10415676 | 3300006038 | Bacteria | 949 |
| 60 | Ga0075363_100020417 | 3300006048 | Bacteria | 3322 |
| 61 | Ga0075363_100182107 | 3300006048 | Bacteria | 1196 |
| 62 | Ga0075432_10062382 | 3300006058 | Bacteria | 1329 |
| 63 | Ga0070712_100058502 | 3300006175 | Bacteria | 2711 |
| 64 | Ga0075367_10021086 | 3300006178 | Bacteria | 3638 |
| 65 | Ga0075367_10397976 | 3300006178 | Bacteria | 871 |
| 66 | Ga0075428_100007055 | 3300006844 | Bacteria | 12450 |
| 67 | Ga0075428_100141706 | 3300006844 | Bacteria | 2613 |
| 68 | Ga0075430_100035941 | 3300006846 | Bacteria | 4201 |
| 69 | Ga0075433_10091136 | 3300006852 | Bacteria | 2695 |
| 70 | Ga0075433_10135546 | 3300006852 | Bacteria | 2188 |
| 71 | Ga0075434_100008053 | 3300006871 | Bacteria | 9774 |
| 72 | Ga0075429_100047565 | 3300006880 | Bacteria | 3732 |
| 73 | Ga0068865_100110161 | 3300006881 | Bacteria | 2030 |
| 74 | Ga0075436_100113329 | 3300006914 | Bacteria | 1893 |
| 75 | Ga0097620_100270280 | 3300006931 | Bacteria | 1792 |
| 76 | Ga0075435_100060734 | 3300007076 | Bacteria | 3065 |
| 77 | Ga0105240_10699499 | 3300009093 | Bacteria | 1106 |
| 78 | Ga0111539_10030486 | 3300009094 | Bacteria | 6555 |
| 79 | Ga0111539_10082291 | 3300009094 | Bacteria | 3786 |
| 80 | Ga0111539_10469367 | 3300009094 | Bacteria | 1465 |
| 81 | Ga0111539_11432747 | 3300009094 | Bacteria | 801 |
| 82 | Ga0105245_10005719 | 3300009098 | Bacteria | 10920 |
| 83 | Ga0105245_10011967 | 3300009098 | Bacteria | 7543 |
| 84 | Ga0114129_10003533 | 3300009147 | Bacteria | 21989 |
| 85 | Ga0114129_10079822 | 3300009147 | Bacteria | 4549 |
| 86 | Ga0105242_11107617 | 3300009176 | Bacteria | 806 |
| 87 | Ga0105248_10377717 | 3300009177 | Bacteria | 1595 |
| 88 | Ga0105238_10522437 | 3300009551 | Bacteria | 1190 |
| 89 | Ga0105249_10004101 | 3300009553 | Bacteria | 12579 |
| 90 | Ga0105239_10011796 | 3300010375 | Bacteria | 9752 |
| 91 | Ga0105239_10329921 | 3300010375 | Bacteria | 1721 |
| 92 | Ga0105246_10093253 | 3300011119 | Bacteria | 2175 |
| 93 | Ga0157374_10028190 | 3300013296 | Bacteria | 5071 |
| 94 | Ga0163162_10082139 | 3300013306 | Bacteria | 3294 |
| 95 | Ga0157372_10053582 | 3300013307 | Bacteria | 4497 |
| 96 | Ga0157372_10787288 | 3300013307 | Bacteria | 1105 |
| 97 | Ga0163163_10020096 | 3300014325 | Bacteria | 6286 |
| 98 | Ga0163163_10139699 | 3300014325 | Bacteria | 2464 |
| 99 | Ga0157380_10067916 | 3300014326 | Bacteria | 2872 |
| 100 | Ga0157380_10199540 | 3300014326 | Bacteria | 1774 |
| 101 | Ga0157380_10866090 | 3300014326 | Bacteria | 926 |
| 102 | Ga0157377_10014314 | 3300014745 | Bacteria | 4034 |
| 103 | Ga0213876_10010594 | 3300021384 | Bacteria | 4939 |
| 104 | Ga0213876_10017251 | 3300021384 | Bacteria | 3812 |
| 105 | Ga0213876_10031594 | 3300021384 | Bacteria | 2793 |
| 106 | Ga0213876_10051711 | 3300021384 | Bacteria | 2171 |
| 107 | Ga0213875_10000059 | 3300021388 | Bacteria | 135414 |
| 108 | Ga0213875_10015096 | 3300021388 | Bacteria | 3761 |
| 109 | Ga0213875_10021495 | 3300021388 | Bacteria | 3090 |
| 110 | Ga0213875_10034469 | 3300021388 | Bacteria | 2390 |
| 111 | Ga0213875_10134390 | 3300021388 | Bacteria | 1157 |
| 112 | Ga0207653_10114471 | 3300025885 | Bacteria | 966 |
| 113 | Ga0207688_10001384 | 3300025901 | Bacteria | 12592 |
| 114 | Ga0207643_10423239 | 3300025908 | Bacteria | 844 |
| 115 | Ga0207693_10083524 | 3300025915 | Bacteria | 2502 |
| 116 | Ga0207663_10568605 | 3300025916 | Bacteria | 888 |
| 117 | Ga0207649_10125615 | 3300025920 | Bacteria | 1736 |
| 118 | Ga0207681_10226650 | 3300025923 | Bacteria | 1449 |
| 119 | Ga0207650_10564891 | 3300025925 | Bacteria | 955 |
| 120 | Ga0207659_10026586 | 3300025926 | Bacteria | 3906 |
| 121 | Ga0207700_10039422 | 3300025928 | Bacteria | 3439 |
| 122 | Ga0207700_10042615 | 3300025928 | Bacteria | 3329 |
| 123 | Ga0207700_10133519 | 3300025928 | Bacteria | 2030 |
| 124 | Ga0207664_10016343 | 3300025929 | Bacteria | 5413 |
| 125 | Ga0207644_10267324 | 3300025931 | Bacteria | 1369 |
| 126 | Ga0207690_10280429 | 3300025932 | Bacteria | 1298 |
| 127 | Ga0207706_10104325 | 3300025933 | Bacteria | 2494 |
| 128 | Ga0207670_10274222 | 3300025936 | Bacteria | 1312 |
| 129 | Ga0207670_10525653 | 3300025936 | Bacteria | 964 |
| 130 | Ga0207669_10195863 | 3300025937 | Bacteria | 1462 |
| 131 | Ga0207704_10080302 | 3300025938 | Bacteria | 2105 |
| 132 | Ga0207691_10458087 | 3300025940 | Bacteria | 1085 |
| 133 | Ga0207711_10181799 | 3300025941 | Bacteria | 1913 |
| 134 | Ga0207689_10030182 | 3300025942 | Bacteria | 4517 |
| 135 | Ga0207661_10056648 | 3300025944 | Bacteria | 3147 |
| 136 | Ga0207679_10128063 | 3300025945 | Bacteria | 2032 |
| 137 | Ga0207668_10204079 | 3300025972 | Bacteria | 1576 |
| 138 | Ga0207640_10064380 | 3300025981 | Bacteria | 2441 |
| 139 | Ga0207640_10321234 | 3300025981 | Bacteria | 1233 |
| 140 | Ga0207677_10095826 | 3300026023 | Bacteria | 2170 |
| 141 | Ga0207639_10312863 | 3300026041 | Bacteria | 1392 |
| 142 | Ga0207708_10004680 | 3300026075 | Bacteria | 10066 |
| 143 | Ga0207708_10082791 | 3300026075 | Bacteria | 2467 |
| 144 | Ga0207708_10109088 | 3300026075 | Bacteria | 2147 |
| 145 | Ga0207702_10006173 | 3300026078 | Bacteria | 10364 |
| 146 | Ga0207702_10094116 | 3300026078 | Bacteria | 2629 |
| 147 | Ga0207648_10095944 | 3300026089 | Bacteria | 2595 |
| 148 | Ga0207676_10069510 | 3300026095 | Bacteria | 2820 |
| 149 | Ga0207675_100045763 | 3300026118 | Bacteria | 4088 |
| 150 | Ga0207675_100067604 | 3300026118 | Bacteria | 3340 |
| 151 | Ga0207683_10110163 | 3300026121 | Bacteria | 2465 |
| 152 | Ga0207698_10357116 | 3300026142 | Bacteria | 1382 |
| 153 | Ga0207428_10074612 | 3300027907 | Bacteria | 2660 |
| 154 | Ga0268265_10381454 | 3300028380 | Bacteria | 1297 |
| 155 | Ga0268264_10181969 | 3300028381 | Bacteria | 1909 |
| 156 | Ga0265319_1000296 | 3300028563 | Bacteria | 37027 |
| 157 | Ga0265319_1027200 | 3300028563 | Bacteria | 2030 |
| 158 | Ga0265319_1051678 | 3300028563 | Bacteria | 1355 |
| 159 | Ga0265334_10065772 | 3300028573 | Bacteria | 1359 |
| 160 | Ga0265318_10017123 | 3300028577 | Bacteria | 2980 |
| 161 | Ga0265338_10014310 | 3300028800 | Bacteria | 8837 |
| 162 | Ga0265320_10131820 | 3300031240 | Bacteria | 1135 |
| 163 | Ga0265320_10147716 | 3300031240 | Bacteria | 1062 |
| 164 | Ga0307408_100427281 | 3300031548 | Bacteria | 1144 |
| 165 | Ga0265313_10034173 | 3300031595 | Bacteria | 2574 |
| 166 | Ga0307405_10474672 | 3300031731 | Bacteria | 997 |
| 167 | Ga0307406_10102856 | 3300031901 | Bacteria | 1950 |
| 168 | Ga0307406_10785038 | 3300031901 | Bacteria | 802 |
| 169 | Ga0307409_100041670 | 3300031995 | Bacteria | 3431 |
| 170 | Ga0307409_100043138 | 3300031995 | Bacteria | 3384 |
| 171 | Ga0307416_100623381 | 3300032002 | Bacteria | 1161 |
| 172 | Ga0307414_10267268 | 3300032004 | Bacteria | 1430 |
| 173 | Ga0307415_100189475 | 3300032126 | Bacteria | 1622 |
| 174 | Ga0307415_100606326 | 3300032126 | Bacteria | 975 |
| 175 | Ga0373939_0147958 | 3300035114 | Bacteria | 852 |
| 176 | Ga0373941_0167457 | 3300035115 | Bacteria | 817 |
| 177 | Ga0373961_0075251 | 3300035241 | Bacteria | 1052 |
| 178 | Ga0373962_0020814 | 3300035242 | Bacteria | 1726 |
| 179 | Ga0373937_0855144 | 3300036401 | Bacteria | 858 |
| 180 | Ga0395900_0070944 | 3300037418 | Bacteria | 3581 |
| 181 | Ga0395900_0211917 | 3300037418 | Bacteria | 1956 |
| 182 | Ga0395898_0127704 | 3300037466 | Bacteria | 2436 |
| 183 | Ga0395898_0198983 | 3300037466 | Bacteria | 1913 |
| 184 | Ga0395898_0237799 | 3300037466 | Bacteria | 1737 |
| 185 | Ga0395898_0368872 | 3300037466 | Bacteria | 1369 |
| 186 | Ga0395905_0654605 | 3300037471 | Bacteria | 952 |
| 187 | Ga0436364_0061082 | 3300037853 | Bacteria | 1550 |
| 188 | Ga0436364_0082088 | 3300037853 | Bacteria | 178031 |
| 189 | Ga0436364_0174758 | 3300037853 | Bacteria | 2625 |
| 190 | Ga0436364_0668940 | 3300037853 | Bacteria | 41832 |
| 191 | Ga0436364_1210338 | 3300037853 | Bacteria | 16436 |
| 192 | Ga0395901_0002001 | 3300038443 | Bacteria | 20971 |
| 193 | Ga0395901_0051881 | 3300038443 | Bacteria | 4264 |
| 194 | Ga0395901_0103469 | 3300038443 | Bacteria | 2987 |
| 195 | Ga0395901_0819491 | 3300038443 | Bacteria | 918 |
| 196 | Ga0395901_1201438 | 3300038443 | Bacteria | 724 |
| 197 | Ga0436365_0194503 | 3300039437 | Bacteria | 8631 |
| 198 | Ga0436365_0457869 | 3300039437 | Bacteria | 20822 |
| 199 | Ga0436365_1124121 | 3300039437 | Bacteria | 24917 |
| 200 | Ga0436365_1645792 | 3300039437 | Bacteria | 3530 |
| 201 | Ga0436365_1701609 | 3300039437 | Bacteria | 2544 |
| 202 | Ga0436365_1934001 | 3300039437 | Bacteria | 8501 |
| 203 | Ga0436363_0041949 | 3300039450 | Bacteria | 677 |
| 204 | Ga0436363_0626044 | 3300039450 | Bacteria | 654 |
| 205 | Ga0436363_1042894 | 3300039450 | Unclassified | 727 |
| 206 | Ga0436362_0453823 | 3300039453 | Bacteria | 2072 |
| 207 | Ga0466969_0007479 | 3300044656 | Bacteria | 5808 |
| 208 | Ga0466965_0170125 | 3300044683 | Bacteria | 1146 |
| 209 | Ga0466966_0031398 | 3300044684 | Bacteria | 3445 |
| 210 | Ga0466966_0354350 | 3300044684 | Bacteria | 882 |
| 211 | Ga0466966_0380463 | 3300044684 | Bacteria | 848 |
| 212 | Ga0466961_0033850 | 3300044693 | Bacteria | 3283 |
| 213 | Ga0466963_0019177 | 3300044694 | Bacteria | 4285 |
| 214 | Ga0466963_0027856 | 3300044694 | Bacteria | 3622 |
| 215 | Ga0466963_0067738 | 3300044694 | Bacteria | 2396 |
| 216 | Ga0466963_0088622 | 3300044694 | Bacteria | 2105 |
| 217 | Ga0466963_0253626 | 3300044694 | Bacteria | 1235 |
| 218 | Ga0466971_0032560 | 3300044719 | Bacteria | 2336 |
| 219 | Ga0466971_0048412 | 3300044719 | Bacteria | 1911 |
| 220 | Ga0466971_0297006 | 3300044719 | Bacteria | 775 |
| 221 | Ga0466968_0019518 | 3300044735 | Bacteria | 2728 |
| 222 | Ga0466968_0070601 | 3300044735 | Bacteria | 1520 |
| 223 | Ga0466970_0014281 | 3300044765 | Bacteria | 4074 |
| 224 | Ga0466970_0037573 | 3300044765 | Bacteria | 2567 |
| 225 | Ga0466970_0331842 | 3300044765 | Bacteria | 861 |
| 226 | Ga0466957_0002360 | 3300044842 | Bacteria | 10130 |
| 227 | Ga0466957_0078251 | 3300044842 | Bacteria | 2056 |
| 228 | Ga0466957_0278851 | 3300044842 | Bacteria | 1118 |
| 229 | Ga0466960_0009875 | 3300044901 | Bacteria | 3947 |
| 230 | Ga0466960_0420039 | 3300044901 | Bacteria | 773 |
| 231 | Ga0466959_0032049 | 3300045049 | Bacteria | 3889 |
| 232 | Ga0466959_0080173 | 3300045049 | Bacteria | 2353 |
| 233 | Ga0466959_0082662 | 3300045049 | Bacteria | 2313 |
| 234 | Ga0466959_0150086 | 3300045049 | Bacteria | 1643 |
| 235 | Ga0466959_0306683 | 3300045049 | Unclassified | 1087 |
| 236 | Ga0466959_0616949 | 3300045049 | Bacteria | 729 |
| 237 | Ga0466958_0008580 | 3300045836 | Bacteria | 5673 |
| 238 | Ga0466958_0012580 | 3300045836 | Bacteria | 4796 |
| 239 | Ga0466958_0031140 | 3300045836 | Bacteria | 3170 |
| 240 | Ga0466958_0056061 | 3300045836 | Bacteria | 2393 |
| 241 | Ga0466958_0112215 | 3300045836 | Bacteria | 1702 |
| 242 | Ga0466967_0000235 | 3300045976 | Bacteria | 24059 |
| 243 | Ga0466967_0033951 | 3300045976 | Bacteria | 4324 |
| 244 | Ga0466967_0151609 | 3300045976 | Bacteria | 2167 |
| 245 | Ga0495664_0114159 | 3300046477 | Bacteria | 1632 |
| 246 | Ga0495628_0355823 | 3300046516 | Bacteria | 1076 |
| 247 | Ga0495631_0124186 | 3300046518 | Bacteria | 1110 |
| 248 | Ga0495640_0300643 | 3300046533 | Bacteria | 997 |
| 249 | Ga0495645_0148016 | 3300046543 | Bacteria | 1634 |
| 250 | Ga0495589_0234484 | 3300046794 | Bacteria | 860 |
| 251 | Ga0496100_0007643 | 3300048903 | Bacteria | 5979 |
| 252 | Ga0496104_0047288 | 3300048907 | Bacteria | 4055 |
| 253 | Ga0496105_0063959 | 3300048908 | Bacteria | 3035 |
| 254 | Ga0496106_0020509 | 3300048909 | Bacteria | 4906 |
| 255 | Ga0496108_0042911 | 3300048911 | Bacteria | 3776 |
| 256 | Ga0496109_0002144 | 3300048912 | Bacteria | 16418 |
| 257 | Ga0496109_0010682 | 3300048912 | Bacteria | 7854 |
| 258 | Ga0496109_0048824 | 3300048912 | Bacteria | 3851 |
| 259 | Ga0496110_0014315 | 3300048913 | Bacteria | 6582 |
| 260 | Ga0496111_0005849 | 3300048914 | Bacteria | 7932 |
| 261 | Ga0496112_0133953 | 3300048915 | Bacteria | 2448 |
| 262 | Ga0496113_0016733 | 3300048916 | Bacteria | 5071 |
| 263 | Ga0496114_0295339 | 3300048917 | Bacteria | 1430 |
| 264 | Ga0496121_0001564 | 3300048924 | Bacteria | 38212 |
| 265 | Ga0496121_0004416 | 3300048924 | Bacteria | 18941 |
| 266 | Ga0501032_0411560 | 3300049569 | Bacteria | 868 |
| 267 | Ga0501034_0003181 | 3300049571 | Bacteria | 18889 |
| 268 | Ga0501036_0105112 | 3300049572 | Bacteria | 2388 |
| 269 | Ga0501039_0553834 | 3300049575 | Bacteria | 902 |
| 270 | Ga0501040_0678793 | 3300049576 | Bacteria | 745 |
| 271 | Ga0501047_0005987 | 3300049581 | Bacteria | 11430 |
| 272 | Ga0501047_0036098 | 3300049581 | Bacteria | 4776 |
| 273 | Ga0501071_0065955 | 3300049587 | Bacteria | 2630 |
| 274 | Ga0501072_0473643 | 3300049588 | Bacteria | 991 |
| 275 | Ga0501075_0066380 | 3300049591 | Bacteria | 2723 |
| 276 | Ga0501076_0110694 | 3300049592 | Bacteria | 2220 |
| 277 | Ga0501076_1122301 | 3300049592 | Bacteria | 647 |
| 278 | Ga0501249_068641 | 3300049679 | Bacteria | 827 |
| 279 | Ga0501079_0198648 | 3300049741 | Bacteria | 1566 |
| 280 | Ga0501079_0246158 | 3300049741 | Bacteria | 1397 |
| 281 | Ga0501035_0246741 | 3300049822 | Bacteria | 1517 |
| 282 | Ga0501035_0270389 | 3300049822 | Bacteria | 1439 |
| 283 | Ga0501044_0071872 | 3300049823 | Bacteria | 3518 |
| 284 | Ga0501045_0462936 | 3300049824 | Bacteria | 942 |
| 285 | nmdc:mga03n38_15261_c1 | 3300050490 | Bacteria | 2962 |
| 286 | nmdc:mga00v17_367304_c1 | 3300050491 | Bacteria | 936 |
| 287 | nmdc:mga0yw44_409333_c1 | 3300050492 | Bacteria | 917 |
| 288 | nmdc:mga05p37_2070_c1 | 3300050507 | Bacteria | 23400 |
| 289 | nmdc:mga05p37_322439_c1 | 3300050507 | Bacteria | 1828 |
| 290 | nmdc:mga0qj67_36147_c1 | 3300050509 | Bacteria | 3864 |
| 291 | nmdc:mga0qj67_396748_c1 | 3300050509 | Bacteria | 1113 |
| 292 | nmdc:mga0qj67_421903_c1 | 3300050509 | Bacteria | 1075 |
| 293 | nmdc:mga06r32_1123640_c1 | 3300050510 | Bacteria | 734 |
| 294 | nmdc:mga06r32_93921_c1 | 3300050510 | Bacteria | 2935 |
| 295 | nmdc:mga08y16_11083_c1 | 3300050511 | Bacteria | 9465 |
| 296 | nmdc:mga08y16_351409_c1 | 3300050511 | Bacteria | 1514 |
| 297 | nmdc:mga08y16_375504_c1 | 3300050511 | Bacteria | 1458 |
| 298 | nmdc:mga0n895_274009_c1 | 3300050512 | Bacteria | 1711 |
| 299 | nmdc:mga0n895_48333_c1 | 3300050512 | Bacteria | 4164 |
| 300 | nmdc:mga08x19_114099_c1 | 3300050514 | Bacteria | 1805 |
| 301 | nmdc:mga0a205_69181_c1 | 3300050515 | Bacteria | 3409 |
| 302 | nmdc:mga0a205_83071_c1 | 3300050515 | Bacteria | 3094 |
| 303 | Ga0495655_0012610 | 3300053083 | Bacteria | 1727 |
| 304 | Ga0466962_0006661 | 3300061719 | Bacteria | 5542 |
| 305 | Ga0466962_0018732 | 3300061719 | Bacteria | 3328 |
| 306 | Ga0466962_0030478 | 3300061719 | Bacteria | 2584 |
| 307 | Ga0466962_0046779 | 3300061719 | Bacteria | 2067 |
| 308 | Ga0466962_0079242 | 3300061719 | Bacteria | 1570 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021384 | Ga0213876_10017251 | Ga0213876_100172515 | 172 |
| 2 | 3300044765 | Ga0466970_0331842 | Ga0466970_0331842_165_782 | 176 |
| 3 | 3300044901 | Ga0466960_0420039 | Ga0466960_0420039_197_745 | 177 |
| 4 | 3300044683 | Ga0466965_0170125 | Ga0466965_0170125_131_748 | 178 |
| 5 | 3300044735 | Ga0466968_0070601 | Ga0466968_0070601_275_892 | 178 |
| 6 | 3300005985 | Ga0081539_10255248 | Ga0081539_102552482 | 182 |
| 7 | 3300044656 | Ga0466969_0007479 | Ga0466969_0007479_4704_5291 | 183 |
| 8 | 3300044684 | Ga0466966_0354350 | Ga0466966_0354350_155_742 | 183 |
| 9 | 3300044765 | Ga0466970_0037573 | Ga0466970_0037573_304_891 | 183 |
| 10 | 3300045049 | Ga0466959_0032049 | Ga0466959_0032049_104_691 | 183 |
| 11 | 3300045836 | Ga0466958_0031140 | Ga0466958_0031140_146_733 | 183 |
| 12 | 3300050509 | nmdc:mga0qj67_396748_c1 | nmdc:mga0qj67_396748_c1_325_906 | 183 |
| 13 | 3300014326 | Ga0157380_10866090 | Ga0157380_108660902 | 184 |
| 14 | 3300025908 | Ga0207643_10423239 | Ga0207643_104232392 | 184 |
| 15 | 3300037853 | Ga0436364_0061082 | Ga0436364_0061082_771_1352 | 187 |
| 16 | 3300037418 | Ga0395900_0070944 | Ga0395900_0070944_626_1234 | 188 |
| 17 | 3300037418 | Ga0395900_0211917 | Ga0395900_0211917_316_942 | 188 |
| 18 | 3300038443 | Ga0395901_0103469 | Ga0395901_0103469_1429_2037 | 188 |
| 19 | 3300038443 | Ga0395901_0819491 | Ga0395901_0819491_16_624 | 191 |
| 20 | 3300039450 | Ga0436363_0626044 | Ga0436363_0626044_14_595 | 192 |
| 21 | 3300053083 | Ga0495655_0012610 | Ga0495655_0012610_60_683 | 192 |
| 22 | 3300021384 | Ga0213876_10051711 | Ga0213876_100517112 | 193 |
| 23 | 3300021388 | Ga0213875_10015096 | Ga0213875_100150962 | 193 |
| 24 | 3300021388 | Ga0213875_10134390 | Ga0213875_101343902 | 193 |
| 25 | 3300044694 | Ga0466963_0019177 | Ga0466963_0019177_1856_2506 | 193 |
| 26 | 3300044719 | Ga0466971_0297006 | Ga0466971_0297006_163_744 | 193 |
| 27 | 3300044735 | Ga0466968_0019518 | Ga0466968_0019518_1781_2431 | 193 |
| 28 | 3300044842 | Ga0466957_0002360 | Ga0466957_0002360_7005_7655 | 193 |
| 29 | 3300045049 | Ga0466959_0080173 | Ga0466959_0080173_1392_2042 | 193 |
| 30 | 3300045836 | Ga0466958_0012580 | Ga0466958_0012580_3928_4578 | 193 |
| 31 | 3300061719 | Ga0466962_0030478 | Ga0466962_0030478_1739_2389 | 193 |
| 32 | 3300005341 | Ga0070691_10012024 | Ga0070691_100120246 | 194 |
| 33 | 3300005347 | Ga0070668_100282037 | Ga0070668_1002820371 | 194 |
| 34 | 3300005366 | Ga0070659_100246228 | Ga0070659_1002462282 | 194 |
| 35 | 3300005441 | Ga0070700_100134990 | Ga0070700_1001349901 | 194 |
| 36 | 3300005545 | Ga0070695_100138785 | Ga0070695_1001387852 | 194 |
| 37 | 3300005615 | Ga0070702_100396505 | Ga0070702_1003965051 | 194 |
| 38 | 3300005719 | Ga0068861_100028955 | Ga0068861_1000289555 | 194 |
| 39 | 3300005981 | Ga0081538_10016239 | Ga0081538_100162397 | 194 |
| 40 | 3300005981 | Ga0081538_10026993 | Ga0081538_100269936 | 194 |
| 41 | 3300006844 | Ga0075428_100007055 | Ga0075428_1000070559 | 194 |
| 42 | 3300006846 | Ga0075430_100035941 | Ga0075430_1000359415 | 194 |
| 43 | 3300006852 | Ga0075433_10135546 | Ga0075433_101355464 | 194 |
| 44 | 3300006880 | Ga0075429_100047565 | Ga0075429_1000475654 | 194 |
| 45 | 3300009094 | Ga0111539_10082291 | Ga0111539_100822915 | 194 |
| 46 | 3300009098 | Ga0105245_10011967 | Ga0105245_1001196710 | 194 |
| 47 | 3300009147 | Ga0114129_10003533 | Ga0114129_1000353315 | 194 |
| 48 | 3300009553 | Ga0105249_10004101 | Ga0105249_1000410113 | 194 |
| 49 | 3300010375 | Ga0105239_10329921 | Ga0105239_103299213 | 194 |
| 50 | 3300013306 | Ga0163162_10082139 | Ga0163162_100821395 | 194 |
| 51 | 3300013307 | Ga0157372_10787288 | Ga0157372_107872882 | 194 |
| 52 | 3300025923 | Ga0207681_10226650 | Ga0207681_102266502 | 194 |
| 53 | 3300025932 | Ga0207690_10280429 | Ga0207690_102804291 | 194 |
| 54 | 3300025972 | Ga0207668_10204079 | Ga0207668_102040793 | 194 |
| 55 | 3300025981 | Ga0207640_10321234 | Ga0207640_103212342 | 194 |
| 56 | 3300026075 | Ga0207708_10109088 | Ga0207708_101090882 | 194 |
| 57 | 3300026118 | Ga0207675_100067604 | Ga0207675_1000676041 | 194 |
| 58 | 3300031731 | Ga0307405_10474672 | Ga0307405_104746722 | 194 |
| 59 | 3300031901 | Ga0307406_10102856 | Ga0307406_101028562 | 194 |
| 60 | 3300031995 | Ga0307409_100043138 | Ga0307409_1000431384 | 194 |
| 61 | 3300032002 | Ga0307416_100623381 | Ga0307416_1006233812 | 194 |
| 62 | 3300032126 | Ga0307415_100189475 | Ga0307415_1001894751 | 194 |
| 63 | 3300032126 | Ga0307415_100606326 | Ga0307415_1006063262 | 194 |
| 64 | 3300035114 | Ga0373939_0147958 | Ga0373939_0147958_147_752 | 194 |
| 65 | 3300035115 | Ga0373941_0167457 | Ga0373941_0167457_11_616 | 194 |
| 66 | 3300035241 | Ga0373961_0075251 | Ga0373961_0075251_273_878 | 194 |
| 67 | 3300035242 | Ga0373962_0020814 | Ga0373962_0020814_700_1305 | 194 |
| 68 | 3300038443 | Ga0395901_0051881 | Ga0395901_0051881_1471_2076 | 194 |
| 69 | 3300039437 | Ga0436365_0194503 | Ga0436365_0194503_3491_4183 | 194 |
| 70 | 3300044694 | Ga0466963_0253626 | Ga0466963_0253626_564_1172 | 194 |
| 71 | 3300044901 | Ga0466960_0009875 | Ga0466960_0009875_2568_3173 | 194 |
| 72 | 3300045976 | Ga0466967_0151609 | Ga0466967_0151609_1081_1689 | 194 |
| 73 | 3300046518 | Ga0495631_0124186 | Ga0495631_0124186_276_881 | 194 |
| 74 | 3300046794 | Ga0495589_0234484 | Ga0495589_0234484_118_723 | 194 |
| 75 | 3300049572 | Ga0501036_0105112 | Ga0501036_0105112_108_713 | 194 |
| 76 | 3300049587 | Ga0501071_0065955 | Ga0501071_0065955_328_933 | 194 |
| 77 | 3300049588 | Ga0501072_0473643 | Ga0501072_0473643_247_852 | 194 |
| 78 | 3300049591 | Ga0501075_0066380 | Ga0501075_0066380_1075_1680 | 194 |
| 79 | 3300049592 | Ga0501076_0110694 | Ga0501076_0110694_685_1290 | 194 |
| 80 | 3300049741 | Ga0501079_0198648 | Ga0501079_0198648_746_1351 | 194 |
| 81 | 3300049822 | Ga0501035_0270389 | Ga0501035_0270389_375_980 | 194 |
| 82 | 3300049824 | Ga0501045_0462936 | Ga0501045_0462936_44_649 | 194 |
| 83 | 3300050492 | nmdc:mga0yw44_409333_c1 | nmdc:mga0yw44_409333_c1_302_904 | 194 |
| 84 | 3300050507 | nmdc:mga05p37_2070_c1 | nmdc:mga05p37_2070_c1_16740_17345 | 194 |
| 85 | 3300050507 | nmdc:mga05p37_322439_c1 | nmdc:mga05p37_322439_c1_831_1436 | 194 |
| 86 | 3300050509 | nmdc:mga0qj67_36147_c1 | nmdc:mga0qj67_36147_c1_311_916 | 194 |
| 87 | 3300050509 | nmdc:mga0qj67_421903_c1 | nmdc:mga0qj67_421903_c1_276_881 | 194 |
| 88 | 3300050510 | nmdc:mga06r32_1123640_c1 | nmdc:mga06r32_1123640_c1_72_677 | 194 |
| 89 | 3300050511 | nmdc:mga08y16_351409_c1 | nmdc:mga08y16_351409_c1_53_658 | 194 |
| 90 | 3300050512 | nmdc:mga0n895_274009_c1 | nmdc:mga0n895_274009_c1_241_846 | 194 |
| 91 | 3300050515 | nmdc:mga0a205_69181_c1 | nmdc:mga0a205_69181_c1_2713_3318 | 194 |
| 92 | 3300061719 | Ga0466962_0006661 | Ga0466962_0006661_2455_3060 | 194 |
| 93 | 3300021384 | Ga0213876_10010594 | Ga0213876_100105945 | 195 |
| 94 | 3300037466 | Ga0395898_0237799 | Ga0395898_0237799_598_1224 | 195 |
| 95 | 3300037466 | Ga0395898_0368872 | Ga0395898_0368872_207_833 | 195 |
| 96 | 3300037471 | Ga0395905_0654605 | Ga0395905_0654605_204_830 | 195 |
| 97 | 3300038443 | Ga0395901_0002001 | Ga0395901_0002001_14510_15136 | 195 |
| 98 | 3300039437 | Ga0436365_1124121 | Ga0436365_1124121_1119_1715 | 195 |
| 99 | 3300045049 | Ga0466959_0616949 | Ga0466959_0616949_70_657 | 195 |
| 100 | 3300049575 | Ga0501039_0553834 | Ga0501039_0553834_83_688 | 195 |
| 101 | 3300049576 | Ga0501040_0678793 | Ga0501040_0678793_91_696 | 195 |
| 102 | 3300049592 | Ga0501076_1122301 | Ga0501076_1122301_13_618 | 195 |
| 103 | 3300049741 | Ga0501079_0246158 | Ga0501079_0246158_252_857 | 195 |
| 104 | 3300009094 | Ga0111539_11432747 | Ga0111539_114327471 | 196 |
| 105 | 3300009176 | Ga0105242_11107617 | Ga0105242_111076172 | 196 |
| 106 | 3300003373 | JGI25407J50210_10049965 | JGI25407J50210_100499652 | 197 |
| 107 | 3300005937 | Ga0081455_10049022 | Ga0081455_100490225 | 197 |
| 108 | 3300005981 | Ga0081538_10000128 | Ga0081538_1000012821 | 197 |
| 109 | 3300005981 | Ga0081538_10000698 | Ga0081538_1000069819 | 197 |
| 110 | 3300021384 | Ga0213876_10031594 | Ga0213876_100315942 | 197 |
| 111 | 3300037466 | Ga0395898_0127704 | Ga0395898_0127704_1265_1873 | 197 |
| 112 | 3300039437 | Ga0436365_1934001 | Ga0436365_1934001_2087_2698 | 197 |
| 113 | 3300005436 | Ga0070713_100030057 | Ga0070713_1000300574 | 198 |
| 114 | 3300005436 | Ga0070713_100055881 | Ga0070713_1000558812 | 198 |
| 115 | 3300005441 | Ga0070700_100067813 | Ga0070700_1000678132 | 198 |
| 116 | 3300005985 | Ga0081539_10029368 | Ga0081539_100293682 | 198 |
| 117 | 3300006038 | Ga0075365_10415676 | Ga0075365_104156762 | 198 |
| 118 | 3300006048 | Ga0075363_100020417 | Ga0075363_1000204173 | 198 |
| 119 | 3300006178 | Ga0075367_10397976 | Ga0075367_103979762 | 198 |
| 120 | 3300009551 | Ga0105238_10522437 | Ga0105238_105224372 | 198 |
| 121 | 3300014325 | Ga0163163_10139699 | Ga0163163_101396992 | 198 |
| 122 | 3300014326 | Ga0157380_10199540 | Ga0157380_101995402 | 198 |
| 123 | 3300025928 | Ga0207700_10039422 | Ga0207700_100394223 | 198 |
| 124 | 3300025928 | Ga0207700_10042615 | Ga0207700_100426153 | 198 |
| 125 | 3300025936 | Ga0207670_10525653 | Ga0207670_105256531 | 198 |
| 126 | 3300026075 | Ga0207708_10082791 | Ga0207708_100827912 | 198 |
| 127 | 3300028563 | Ga0265319_1000296 | Ga0265319_10002969 | 198 |
| 128 | 3300028563 | Ga0265319_1027200 | Ga0265319_10272002 | 198 |
| 129 | 3300028563 | Ga0265319_1051678 | Ga0265319_10516782 | 198 |
| 130 | 3300028573 | Ga0265334_10065772 | Ga0265334_100657721 | 198 |
| 131 | 3300028577 | Ga0265318_10017123 | Ga0265318_100171231 | 198 |
| 132 | 3300028800 | Ga0265338_10014310 | Ga0265338_100143104 | 198 |
| 133 | 3300031240 | Ga0265320_10131820 | Ga0265320_101318202 | 198 |
| 134 | 3300031240 | Ga0265320_10147716 | Ga0265320_101477161 | 198 |
| 135 | 3300031548 | Ga0307408_100427281 | Ga0307408_1004272812 | 198 |
| 136 | 3300031595 | Ga0265313_10034173 | Ga0265313_100341733 | 198 |
| 137 | 3300031901 | Ga0307406_10785038 | Ga0307406_107850382 | 198 |
| 138 | 3300031995 | Ga0307409_100041670 | Ga0307409_1000416702 | 198 |
| 139 | 3300032004 | Ga0307414_10267268 | Ga0307414_102672682 | 198 |
| 140 | 3300048912 | Ga0496109_0002144 | Ga0496109_0002144_12925_13602 | 198 |
| 141 | 3300048912 | Ga0496109_0048824 | Ga0496109_0048824_645_1268 | 198 |
| 142 | 3300048924 | Ga0496121_0001564 | Ga0496121_0001564_16810_17442 | 198 |
| 143 | 3300048924 | Ga0496121_0004416 | Ga0496121_0004416_15493_16125 | 198 |
| 144 | 3300049679 | Ga0501249_068641 | Ga0501249_068641_122_757 | 198 |
| 145 | 3300050490 | nmdc:mga03n38_15261_c1 | nmdc:mga03n38_15261_c1_1660_2313 | 198 |
| 146 | 3300050491 | nmdc:mga00v17_367304_c1 | nmdc:mga00v17_367304_c1_259_900 | 198 |
| 147 | 3300002073 | JGI24745J21846_1019416 | JGI24745J21846_10194162 | 199 |
| 148 | 3300002074 | JGI24748J21848_1021104 | JGI24748J21848_10211042 | 199 |
| 149 | 3300005329 | Ga0070683_100021169 | Ga0070683_1000211697 | 199 |
| 150 | 3300005331 | Ga0070670_100714954 | Ga0070670_1007149542 | 199 |
| 151 | 3300005334 | Ga0068869_100051664 | Ga0068869_1000516642 | 199 |
| 152 | 3300005337 | Ga0070682_100012653 | Ga0070682_1000126534 | 199 |
| 153 | 3300005338 | Ga0068868_100034344 | Ga0068868_1000343442 | 199 |
| 154 | 3300005340 | Ga0070689_100118712 | Ga0070689_1001187122 | 199 |
| 155 | 3300005341 | Ga0070691_10028563 | Ga0070691_100285633 | 199 |
| 156 | 3300005344 | Ga0070661_100120756 | Ga0070661_1001207562 | 199 |
| 157 | 3300005345 | Ga0070692_10063297 | Ga0070692_100632972 | 199 |
| 158 | 3300005347 | Ga0070668_100112529 | Ga0070668_1001125292 | 199 |
| 159 | 3300005354 | Ga0070675_100157557 | Ga0070675_1001575572 | 199 |
| 160 | 3300005355 | Ga0070671_100312711 | Ga0070671_1003127112 | 199 |
| 161 | 3300005356 | Ga0070674_100190342 | Ga0070674_1001903422 | 199 |
| 162 | 3300005406 | Ga0070703_10036252 | Ga0070703_100362522 | 199 |
| 163 | 3300005435 | Ga0070714_100008517 | Ga0070714_1000085174 | 199 |
| 164 | 3300005436 | Ga0070713_100071456 | Ga0070713_1000714564 | 199 |
| 165 | 3300005437 | Ga0070710_10051389 | Ga0070710_100513892 | 199 |
| 166 | 3300005440 | Ga0070705_100166432 | Ga0070705_1001664322 | 199 |
| 167 | 3300005441 | Ga0070700_100004700 | Ga0070700_1000047008 | 199 |
| 168 | 3300005455 | Ga0070663_100113695 | Ga0070663_1001136953 | 199 |
| 169 | 3300005456 | Ga0070678_100054934 | Ga0070678_1000549342 | 199 |
| 170 | 3300005457 | Ga0070662_100035181 | Ga0070662_1000351813 | 199 |
| 171 | 3300005459 | Ga0068867_100073018 | Ga0068867_1000730183 | 199 |
| 172 | 3300005466 | Ga0070685_10036774 | Ga0070685_100367744 | 199 |
| 173 | 3300005539 | Ga0068853_100138947 | Ga0068853_1001389473 | 199 |
| 174 | 3300005549 | Ga0070704_100018579 | Ga0070704_1000185792 | 199 |
| 175 | 3300005564 | Ga0070664_100027263 | Ga0070664_1000272633 | 199 |
| 176 | 3300005614 | Ga0068856_100046731 | Ga0068856_1000467312 | 199 |
| 177 | 3300005615 | Ga0070702_100037266 | Ga0070702_1000372662 | 199 |
| 178 | 3300005616 | Ga0068852_100008989 | Ga0068852_1000089898 | 199 |
| 179 | 3300005617 | Ga0068859_100270311 | Ga0068859_1002703112 | 199 |
| 180 | 3300005618 | Ga0068864_100008830 | Ga0068864_1000088308 | 199 |
| 181 | 3300005719 | Ga0068861_100066857 | Ga0068861_1000668573 | 199 |
| 182 | 3300005841 | Ga0068863_100048952 | Ga0068863_1000489524 | 199 |
| 183 | 3300005843 | Ga0068860_100272385 | Ga0068860_1002723852 | 199 |
| 184 | 3300005844 | Ga0068862_100083258 | Ga0068862_1000832582 | 199 |
| 185 | 3300006028 | Ga0070717_10009444 | Ga0070717_100094446 | 199 |
| 186 | 3300006028 | Ga0070717_10218983 | Ga0070717_102189832 | 199 |
| 187 | 3300006048 | Ga0075363_100182107 | Ga0075363_1001821071 | 199 |
| 188 | 3300006058 | Ga0075432_10062382 | Ga0075432_100623822 | 199 |
| 189 | 3300006175 | Ga0070712_100058502 | Ga0070712_1000585023 | 199 |
| 190 | 3300006178 | Ga0075367_10021086 | Ga0075367_100210863 | 199 |
| 191 | 3300006844 | Ga0075428_100141706 | Ga0075428_1001417063 | 199 |
| 192 | 3300006852 | Ga0075433_10091136 | Ga0075433_100911363 | 199 |
| 193 | 3300006871 | Ga0075434_100008053 | Ga0075434_10000805311 | 199 |
| 194 | 3300006881 | Ga0068865_100110161 | Ga0068865_1001101612 | 199 |
| 195 | 3300006914 | Ga0075436_100113329 | Ga0075436_1001133292 | 199 |
| 196 | 3300006931 | Ga0097620_100270280 | Ga0097620_1002702802 | 199 |
| 197 | 3300007076 | Ga0075435_100060734 | Ga0075435_1000607343 | 199 |
| 198 | 3300009093 | Ga0105240_10699499 | Ga0105240_106994992 | 199 |
| 199 | 3300009094 | Ga0111539_10030486 | Ga0111539_100304865 | 199 |
| 200 | 3300009094 | Ga0111539_10469367 | Ga0111539_104693671 | 199 |
| 201 | 3300009098 | Ga0105245_10005719 | Ga0105245_1000571911 | 199 |
| 202 | 3300009147 | Ga0114129_10079822 | Ga0114129_100798227 | 199 |
| 203 | 3300009177 | Ga0105248_10377717 | Ga0105248_103777172 | 199 |
| 204 | 3300010375 | Ga0105239_10011796 | Ga0105239_1001179611 | 199 |
| 205 | 3300011119 | Ga0105246_10093253 | Ga0105246_100932532 | 199 |
| 206 | 3300013296 | Ga0157374_10028190 | Ga0157374_100281905 | 199 |
| 207 | 3300013307 | Ga0157372_10053582 | Ga0157372_100535822 | 199 |
| 208 | 3300014325 | Ga0163163_10020096 | Ga0163163_100200964 | 199 |
| 209 | 3300014326 | Ga0157380_10067916 | Ga0157380_100679162 | 199 |
| 210 | 3300014745 | Ga0157377_10014314 | Ga0157377_100143142 | 199 |
| 211 | 3300021388 | Ga0213875_10000059 | Ga0213875_100000595 | 199 |
| 212 | 3300021388 | Ga0213875_10021495 | Ga0213875_100214953 | 199 |
| 213 | 3300021388 | Ga0213875_10034469 | Ga0213875_100344692 | 199 |
| 214 | 3300025885 | Ga0207653_10114471 | Ga0207653_101144712 | 199 |
| 215 | 3300025901 | Ga0207688_10001384 | Ga0207688_100013844 | 199 |
| 216 | 3300025915 | Ga0207693_10083524 | Ga0207693_100835242 | 199 |
| 217 | 3300025916 | Ga0207663_10568605 | Ga0207663_105686051 | 199 |
| 218 | 3300025920 | Ga0207649_10125615 | Ga0207649_101256152 | 199 |
| 219 | 3300025925 | Ga0207650_10564891 | Ga0207650_105648912 | 199 |
| 220 | 3300025926 | Ga0207659_10026586 | Ga0207659_100265862 | 199 |
| 221 | 3300025928 | Ga0207700_10133519 | Ga0207700_101335192 | 199 |
| 222 | 3300025929 | Ga0207664_10016343 | Ga0207664_100163434 | 199 |
| 223 | 3300025931 | Ga0207644_10267324 | Ga0207644_102673242 | 199 |
| 224 | 3300025933 | Ga0207706_10104325 | Ga0207706_101043252 | 199 |
| 225 | 3300025936 | Ga0207670_10274222 | Ga0207670_102742222 | 199 |
| 226 | 3300025937 | Ga0207669_10195863 | Ga0207669_101958631 | 199 |
| 227 | 3300025938 | Ga0207704_10080302 | Ga0207704_100803022 | 199 |
| 228 | 3300025940 | Ga0207691_10458087 | Ga0207691_104580872 | 199 |
| 229 | 3300025941 | Ga0207711_10181799 | Ga0207711_101817992 | 199 |
| 230 | 3300025942 | Ga0207689_10030182 | Ga0207689_100301823 | 199 |
| 231 | 3300025944 | Ga0207661_10056648 | Ga0207661_100566484 | 199 |
| 232 | 3300025945 | Ga0207679_10128063 | Ga0207679_101280632 | 199 |
| 233 | 3300025981 | Ga0207640_10064380 | Ga0207640_100643802 | 199 |
| 234 | 3300026023 | Ga0207677_10095826 | Ga0207677_100958262 | 199 |
| 235 | 3300026041 | Ga0207639_10312863 | Ga0207639_103128632 | 199 |
| 236 | 3300026075 | Ga0207708_10004680 | Ga0207708_1000468010 | 199 |
| 237 | 3300026078 | Ga0207702_10006173 | Ga0207702_100061735 | 199 |
| 238 | 3300026078 | Ga0207702_10094116 | Ga0207702_100941162 | 199 |
| 239 | 3300026089 | Ga0207648_10095944 | Ga0207648_100959443 | 199 |
| 240 | 3300026095 | Ga0207676_10069510 | Ga0207676_100695102 | 199 |
| 241 | 3300026118 | Ga0207675_100045763 | Ga0207675_1000457632 | 199 |
| 242 | 3300026121 | Ga0207683_10110163 | Ga0207683_101101632 | 199 |
| 243 | 3300026142 | Ga0207698_10357116 | Ga0207698_103571162 | 199 |
| 244 | 3300027907 | Ga0207428_10074612 | Ga0207428_100746124 | 199 |
| 245 | 3300028380 | Ga0268265_10381454 | Ga0268265_103814542 | 199 |
| 246 | 3300028381 | Ga0268264_10181969 | Ga0268264_101819692 | 199 |
| 247 | 3300036401 | Ga0373937_0855144 | Ga0373937_0855144_121_747 | 199 |
| 248 | 3300037466 | Ga0395898_0198983 | Ga0395898_0198983_1223_1858 | 199 |
| 249 | 3300037853 | Ga0436364_0082088 | Ga0436364_0082088_47806_48459 | 199 |
| 250 | 3300037853 | Ga0436364_0174758 | Ga0436364_0174758_1680_2297 | 199 |
| 251 | 3300037853 | Ga0436364_0668940 | Ga0436364_0668940_14892_15509 | 199 |
| 252 | 3300037853 | Ga0436364_1210338 | Ga0436364_1210338_8842_9459 | 199 |
| 253 | 3300038443 | Ga0395901_1201438 | Ga0395901_1201438_64_663 | 199 |
| 254 | 3300039437 | Ga0436365_0457869 | Ga0436365_0457869_5137_5754 | 199 |
| 255 | 3300039437 | Ga0436365_1645792 | Ga0436365_1645792_2745_3404 | 199 |
| 256 | 3300039437 | Ga0436365_1701609 | Ga0436365_1701609_849_1466 | 199 |
| 257 | 3300039450 | Ga0436363_0041949 | Ga0436363_0041949_30_647 | 199 |
| 258 | 3300039450 | Ga0436363_1042894 | Ga0436363_1042894_41_691 | 199 |
| 259 | 3300039453 | Ga0436362_0453823 | Ga0436362_0453823_32_649 | 199 |
| 260 | 3300044684 | Ga0466966_0031398 | Ga0466966_0031398_2316_2948 | 199 |
| 261 | 3300044684 | Ga0466966_0380463 | Ga0466966_0380463_90_707 | 199 |
| 262 | 3300044693 | Ga0466961_0033850 | Ga0466961_0033850_353_973 | 199 |
| 263 | 3300044694 | Ga0466963_0027856 | Ga0466963_0027856_535_1170 | 199 |
| 264 | 3300044694 | Ga0466963_0067738 | Ga0466963_0067738_353_967 | 199 |
| 265 | 3300044694 | Ga0466963_0088622 | Ga0466963_0088622_224_841 | 199 |
| 266 | 3300044719 | Ga0466971_0032560 | Ga0466971_0032560_1070_1687 | 199 |
| 267 | 3300044719 | Ga0466971_0048412 | Ga0466971_0048412_264_881 | 199 |
| 268 | 3300044765 | Ga0466970_0014281 | Ga0466970_0014281_2304_2924 | 199 |
| 269 | 3300044842 | Ga0466957_0078251 | Ga0466957_0078251_127_762 | 199 |
| 270 | 3300044842 | Ga0466957_0278851 | Ga0466957_0278851_229_846 | 199 |
| 271 | 3300045049 | Ga0466959_0082662 | Ga0466959_0082662_1460_2077 | 199 |
| 272 | 3300045049 | Ga0466959_0150086 | Ga0466959_0150086_239_871 | 199 |
| 273 | 3300045049 | Ga0466959_0306683 | Ga0466959_0306683_59_682 | 199 |
| 274 | 3300045836 | Ga0466958_0008580 | Ga0466958_0008580_593_1213 | 199 |
| 275 | 3300045836 | Ga0466958_0056061 | Ga0466958_0056061_657_1274 | 199 |
| 276 | 3300045836 | Ga0466958_0112215 | Ga0466958_0112215_265_882 | 199 |
| 277 | 3300045976 | Ga0466967_0000235 | Ga0466967_0000235_11287_11907 | 199 |
| 278 | 3300045976 | Ga0466967_0033951 | Ga0466967_0033951_272_895 | 199 |
| 279 | 3300046477 | Ga0495664_0114159 | Ga0495664_0114159_592_1209 | 199 |
| 280 | 3300046516 | Ga0495628_0355823 | Ga0495628_0355823_50_667 | 199 |
| 281 | 3300046533 | Ga0495640_0300643 | Ga0495640_0300643_322_951 | 199 |
| 282 | 3300046543 | Ga0495645_0148016 | Ga0495645_0148016_61_678 | 199 |
| 283 | 3300048903 | Ga0496100_0007643 | Ga0496100_0007643_3444_4043 | 199 |
| 284 | 3300048907 | Ga0496104_0047288 | Ga0496104_0047288_1215_1814 | 199 |
| 285 | 3300048908 | Ga0496105_0063959 | Ga0496105_0063959_916_1515 | 199 |
| 286 | 3300048909 | Ga0496106_0020509 | Ga0496106_0020509_1913_2512 | 199 |
| 287 | 3300048911 | Ga0496108_0042911 | Ga0496108_0042911_2455_3054 | 199 |
| 288 | 3300048912 | Ga0496109_0010682 | Ga0496109_0010682_1353_1952 | 199 |
| 289 | 3300048913 | Ga0496110_0014315 | Ga0496110_0014315_5173_5772 | 199 |
| 290 | 3300048914 | Ga0496111_0005849 | Ga0496111_0005849_1117_1716 | 199 |
| 291 | 3300048915 | Ga0496112_0133953 | Ga0496112_0133953_750_1349 | 199 |
| 292 | 3300048916 | Ga0496113_0016733 | Ga0496113_0016733_1338_1937 | 199 |
| 293 | 3300048917 | Ga0496114_0295339 | Ga0496114_0295339_28_627 | 199 |
| 294 | 3300049569 | Ga0501032_0411560 | Ga0501032_0411560_175_780 | 199 |
| 295 | 3300049571 | Ga0501034_0003181 | Ga0501034_0003181_10073_10678 | 199 |
| 296 | 3300049581 | Ga0501047_0005987 | Ga0501047_0005987_3670_4275 | 199 |
| 297 | 3300049581 | Ga0501047_0036098 | Ga0501047_0036098_1158_1763 | 199 |
| 298 | 3300049822 | Ga0501035_0246741 | Ga0501035_0246741_900_1505 | 199 |
| 299 | 3300049823 | Ga0501044_0071872 | Ga0501044_0071872_691_1296 | 199 |
| 300 | 3300050510 | nmdc:mga06r32_93921_c1 | nmdc:mga06r32_93921_c1_1315_1914 | 199 |
| 301 | 3300050511 | nmdc:mga08y16_11083_c1 | nmdc:mga08y16_11083_c1_6789_7388 | 199 |
| 302 | 3300050511 | nmdc:mga08y16_375504_c1 | nmdc:mga08y16_375504_c1_845_1444 | 199 |
| 303 | 3300050512 | nmdc:mga0n895_48333_c1 | nmdc:mga0n895_48333_c1_963_1562 | 199 |
| 304 | 3300050514 | nmdc:mga08x19_114099_c1 | nmdc:mga08x19_114099_c1_108_707 | 199 |
| 305 | 3300050515 | nmdc:mga0a205_83071_c1 | nmdc:mga0a205_83071_c1_524_1123 | 199 |
| 306 | 3300061719 | Ga0466962_0018732 | Ga0466962_0018732_395_1015 | 199 |
| 307 | 3300061719 | Ga0466962_0046779 | Ga0466962_0046779_1319_1954 | 199 |
| 308 | 3300061719 | Ga0466962_0079242 | Ga0466962_0079242_162_779 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.9777 | 138 | 193 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9706 | 138 | 197 |
| 6ide-assembly1.cif.gz_A | crystal structure of the vibrio cholera vqma-ligand-dna complex provides molecular mechanisms for drug design | 0.955 | 138 | 197 |
| 3qp5-assembly1.cif.gz_B | crystal structure of cvir bound to antagonist chlorolactone (cl) | 0.9547 | 138 | 194 |
| 1fse-assembly2.cif.gz_C | crystal structure of the bacillus subtilis regulatory protein gere | 0.9539 | 135 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9777 | 138 | 193 | 1.10.10.10 |
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.973 | 138 | 194 | 1.10.10.10 |
| 3cloC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9644 | 138 | 193 | 1.10.10.10 |
| 3cloA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.96 | 138 | 193 | 1.10.10.10 |
| 1fseC00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9539 | 135 | 199 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9J7Q6-F1-model_v4 | DNA-binding response regulator | 0.9391 | 3 | 125 |
GO:0000160
GO:0003677 |
| AF-A0A538FES5-F1-model_v4 | Response regulator transcription factor | 0.9379 | 1 | 122 |
GO:0000160
GO:0003677 |
| AF-A0A0T2ICE2-F1-model_v4 | Response regulatory domain-containing protein | 0.9369 | 2 | 118 |
GO:0000160
GO:0003677 |
| AF-A0A7K0A0K9-F1-model_v4 | Response regulator | 0.9347 | 3 | 122 |
GO:0000160
|
| AF-A0A7Y9RSK6-F1-model_v4 | DNA-binding NarL/FixJ family response regulator | 0.9298 | 4 | 122 |
GO:0000160
GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar