F399790

General Info

Members Datasets Scaffolds Average Seq Length
308 184 616 111

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1113323|Ga0436365_1113323_295_690
Length 124
Sequence MQELAIARRRARVYSGAMPPKRNPLNLLTLLQELARVVGKPASGDTIEGLAITELPHPHGDHFHLGEAVVAAKDATGLRNPAVWAALERKGLIRPKLPEAVILTLLGQQYDTGLREAILHRAAH

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.3
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 19.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1113323 3300039437 Bacteria 1663
2 JGI25153J46596_10000755 3300003215 Bacteria 19791
3 rootH1_10029659 3300003323 Bacteria 3443
4 Ga0070658_10428910 3300005327 Bacteria 1138
5 Ga0070683_100650494 3300005329 Bacteria 1009
6 Ga0070683_101092933 3300005329 Unclassified 766
7 Ga0070690_100276574 3300005330 Bacteria 1196
8 Ga0070680_100000505 3300005336 Bacteria 26838
9 Ga0070680_100170113 3300005336 Bacteria 1833
10 Ga0070680_100356111 3300005336 Bacteria 1245
11 Ga0070660_100153626 3300005339 Bacteria 1852
12 Ga0070691_10055515 3300005341 Bacteria 1897
13 Ga0070661_100955790 3300005344 Unclassified 709
14 Ga0070661_101623704 3300005344 Bacteria 547
15 Ga0070692_10079370 3300005345 Bacteria 1764
16 Ga0070669_101043888 3300005353 Bacteria 702
17 Ga0070675_100339032 3300005354 Bacteria 1331
18 Ga0070671_100093519 3300005355 Bacteria 2519
19 Ga0070671_100737478 3300005355 Bacteria 856
20 Ga0070671_101465308 3300005355 Bacteria 604
21 Ga0070673_100733889 3300005364 Bacteria 909
22 Ga0070688_100149345 3300005365 Bacteria 1596
23 Ga0070659_100027825 3300005366 Bacteria 4358
24 Ga0070667_100561968 3300005367 Unclassified 1049
25 Ga0070709_10128924 3300005434 Bacteria 1724
26 Ga0070709_10463587 3300005434 Bacteria 956
27 Ga0070709_10541589 3300005434 Bacteria 889
28 Ga0070709_10834479 3300005434 Bacteria 725
29 Ga0070714_100309299 3300005435 Bacteria 1475
30 Ga0070714_100662371 3300005435 Bacteria 1005
31 Ga0070714_100911075 3300005435 Unclassified 854
32 Ga0070714_100945479 3300005435 Bacteria 837
33 Ga0070713_100118739 3300005436 Bacteria 2316
34 Ga0070713_100195944 3300005436 Bacteria 1822
35 Ga0070713_100868958 3300005436 Bacteria 866
36 Ga0070710_10094444 3300005437 Bacteria 1770
37 Ga0070711_100167273 3300005439 Bacteria 1673
38 Ga0070711_101216379 3300005439 Bacteria 652
39 Ga0070694_101784074 3300005444 Unclassified 524
40 Ga0070708_100370728 3300005445 Bacteria 1350
41 Ga0070678_101121267 3300005456 Bacteria 727
42 Ga0070681_10000003 3300005458 Bacteria 252785
43 Ga0070681_10159063 3300005458 Bacteria 2183
44 Ga0070681_10272601 3300005458 Bacteria 1603
45 Ga0070681_11021174 3300005458 Unclassified 747
46 Ga0070681_11102331 3300005458 Bacteria 715
47 Ga0068867_102138280 3300005459 Bacteria 530
48 Ga0070706_100028637 3300005467 Bacteria 5129
49 Ga0070706_101104777 3300005467 Bacteria 730
50 Ga0070707_100049595 3300005468 Bacteria 4024
51 Ga0070698_100041796 3300005471 Bacteria 4706
52 Ga0070679_100000063 3300005530 Bacteria 79786
53 Ga0070679_100092988 3300005530 Bacteria 3003
54 Ga0070679_100133896 3300005530 Bacteria 2460
55 Ga0070679_100340522 3300005530 Bacteria 1448
56 Ga0070679_100352195 3300005530 Bacteria 1420
57 Ga0070684_100134540 3300005535 Bacteria 2232
58 Ga0070684_100396491 3300005535 Bacteria 1272
59 Ga0070684_101140953 3300005535 Unclassified 733
60 Ga0070686_100635110 3300005544 Bacteria 845
61 Ga0070696_100154963 3300005546 Bacteria 1684
62 Ga0070693_101526117 3300005547 Bacteria 523
63 Ga0068855_100644117 3300005563 Unclassified 1139
64 Ga0068855_100838003 3300005563 Bacteria 975
65 Ga0070664_101209007 3300005564 Unclassified 713
66 Ga0068857_100123279 3300005577 Bacteria 2335
67 Ga0068856_100649156 3300005614 Bacteria 1076
68 Ga0068856_101139000 3300005614 Bacteria 797
69 Ga0068856_101891213 3300005614 Bacteria 608
70 Ga0068858_101511205 3300005842 Bacteria 662
71 Ga0070717_10158598 3300006028 Bacteria 1962
72 Ga0070716_100553724 3300006173 Bacteria 858
73 Ga0070716_100908174 3300006173 Unclassified 690
74 Ga0070712_100000318 3300006175 Bacteria 27164
75 Ga0068871_101674815 3300006358 Bacteria 603
76 Ga0075431_100186046 3300006847 Unclassified 2130
77 Ga0075433_11666595 3300006852 Bacteria 549
78 Ga0075434_102055883 3300006871 Unclassified 576
79 Ga0075429_101248678 3300006880 Bacteria 648
80 Ga0075436_100057329 3300006914 Bacteria 2690
81 Ga0075435_100167702 3300007076 Bacteria 1852
82 Ga0099794_10594721 3300007265 Bacteria 586
83 Ga0099795_10003461 3300007788 Bacteria 3909
84 Ga0105240_10286598 3300009093 Bacteria 1890
85 Ga0105240_10709945 3300009093 Bacteria 1097
86 Ga0105240_11314237 3300009093 Bacteria 762
87 Ga0111539_10051896 3300009094 Bacteria 4883
88 Ga0111539_10136695 3300009094 Bacteria 2870
89 Ga0111539_12649844 3300009094 Bacteria 581
90 Ga0105241_10710136 3300009174 Bacteria 919
91 Ga0105248_11393087 3300009177 Bacteria 793
92 Ga0105248_12003006 3300009177 Bacteria 658
93 Ga0105237_10262311 3300009545 Bacteria 1730
94 Ga0105238_11347096 3300009551 Unclassified 740
95 Ga0105249_10263009 3300009553 Bacteria 1715
96 Ga0099796_10000538 3300010159 Bacteria 6477
97 Ga0099796_10001246 3300010159 Bacteria 4984
98 Ga0105239_10050606 3300010375 Bacteria 4556
99 Ga0105239_11762953 3300010375 Unclassified 717
100 Ga0105239_12090094 3300010375 Bacteria 658
101 Ga0157373_11032972 3300013100 Bacteria 614
102 Ga0157370_10277457 3300013104 Bacteria 1549
103 Ga0157369_10028419 3300013105 Bacteria 6189
104 Ga0157369_10443575 3300013105 Bacteria 1344
105 Ga0157369_10533365 3300013105 Bacteria 1214
106 Ga0157369_11331232 3300013105 Unclassified 732
107 Ga0163162_10930842 3300013306 Unclassified 981
108 Ga0157372_10882504 3300013307 Bacteria 1038
109 Ga0163163_13173643 3300014325 Bacteria 513
110 Ga0182008_10038185 3300014497 Bacteria 2402
111 Ga0182008_10049908 3300014497 Bacteria 2077
112 Ga0157379_11650386 3300014968 Bacteria 627
113 Ga0157379_12407142 3300014968 Bacteria 525
114 Ga0157376_10251128 3300014969 Bacteria 1652
115 Ga0182007_10107556 3300015262 Bacteria 926
116 Ga0182007_10222693 3300015262 Unclassified 667
117 Ga0213873_10063401 3300021358 Bacteria 1005
118 Ga0213872_10028309 3300021361 Bacteria 2570
119 Ga0213872_10187344 3300021361 Bacteria 892
120 Ga0213875_10004294 3300021388 Bacteria 7849
121 Ga0213871_10026363 3300021441 Bacteria 1487
122 Ga0209758_1000008 3300025297 Bacteria 1215263
123 Ga0207697_10392988 3300025315 Unclassified 616
124 Ga0207692_10512410 3300025898 Bacteria 762
125 Ga0207699_10150482 3300025906 Bacteria 1539
126 Ga0207699_10200676 3300025906 Bacteria 1351
127 Ga0207699_10508067 3300025906 Bacteria 871
128 Ga0207684_10183825 3300025910 Bacteria 1803
129 Ga0207707_10000001 3300025912 Bacteria 1212482
130 Ga0207707_10210126 3300025912 Bacteria 1695
131 Ga0207707_10363384 3300025912 Bacteria 1246
132 Ga0207695_10176038 3300025913 Bacteria 2062
133 Ga0207695_10733588 3300025913 Bacteria 868
134 Ga0207693_10000025 3300025915 Bacteria 124008
135 Ga0207693_10150113 3300025915 Bacteria 1833
136 Ga0207693_10850335 3300025915 Bacteria 702
137 Ga0207663_10161745 3300025916 Bacteria 1581
138 Ga0207663_10324167 3300025916 Bacteria 1158
139 Ga0207663_11320945 3300025916 Bacteria 581
140 Ga0207660_10000081 3300025917 Bacteria 50936
141 Ga0207660_10113841 3300025917 Bacteria 2040
142 Ga0207660_10470171 3300025917 Bacteria 1018
143 Ga0207649_10777725 3300025920 Bacteria 746
144 Ga0207652_10000413 3300025921 Bacteria 44358
145 Ga0207652_10175191 3300025921 Bacteria 1926
146 Ga0207652_10270251 3300025921 Bacteria 1533
147 Ga0207652_10335606 3300025921 Bacteria 1365
148 Ga0207652_10340602 3300025921 Bacteria 1354
149 Ga0207652_11069732 3300025921 Unclassified 707
150 Ga0207646_10018221 3300025922 Bacteria 6553
151 Ga0207646_11089953 3300025922 Unclassified 703
152 Ga0207681_10997862 3300025923 Bacteria 702
153 Ga0207694_10708707 3300025924 Bacteria 849
154 Ga0207650_11631886 3300025925 Unclassified 547
155 Ga0207700_10103501 3300025928 Bacteria 2276
156 Ga0207700_10181312 3300025928 Bacteria 1763
157 Ga0207700_10546281 3300025928 Bacteria 1028
158 Ga0207700_10855868 3300025928 Bacteria 813
159 Ga0207700_11605064 3300025928 Bacteria 575
160 Ga0207664_10058881 3300025929 Bacteria 3058
161 Ga0207664_10561618 3300025929 Bacteria 1024
162 Ga0207664_10724875 3300025929 Bacteria 894
163 Ga0207644_10210964 3300025931 Bacteria 1535
164 Ga0207644_11502304 3300025931 Unclassified 565
165 Ga0207690_10020116 3300025932 Bacteria 4119
166 Ga0207670_10256138 3300025936 Bacteria 1354
167 Ga0207665_10056435 3300025939 Bacteria 2651
168 Ga0207691_10253851 3300025940 Bacteria 1517
169 Ga0207661_10407486 3300025944 Bacteria 1234
170 Ga0207661_10839070 3300025944 Unclassified 846
171 Ga0207679_10180515 3300025945 Bacteria 1746
172 Ga0207667_10884462 3300025949 Bacteria 886
173 Ga0207667_11824360 3300025949 Unclassified 572
174 Ga0207651_10466505 3300025960 Bacteria 1086
175 Ga0207712_11203958 3300025961 Bacteria 676
176 Ga0207703_11312699 3300026035 Bacteria 696
177 Ga0207703_11863590 3300026035 Bacteria 577
178 Ga0207708_11966828 3300026075 Unclassified 512
179 Ga0207702_10013031 3300026078 Bacteria 6914
180 Ga0207702_10614440 3300026078 Bacteria 1067
181 Ga0207702_11675304 3300026078 Bacteria 629
182 Ga0207641_11390431 3300026088 Unclassified 703
183 Ga0207674_10126519 3300026116 Bacteria 2521
184 Ga0209179_1036355 3300027512 Unclassified 1026
185 Ga0207428_10373901 3300027907 Bacteria 1046
186 Ga0265334_10311712 3300028573 Bacteria 538
187 Ga0265318_10027274 3300028577 Bacteria 2246
188 Ga0265318_10291743 3300028577 Unclassified 595
189 Ga0265338_10055493 3300028800 Bacteria 3523
190 Ga0265328_10129333 3300031239 Bacteria 945
191 Ga0265325_10000083 3300031241 Bacteria 66086
192 Ga0265329_10345954 3300031242 Unclassified 508
193 Ga0265339_10003023 3300031249 Bacteria 11860
194 Ga0265316_10037216 3300031344 Bacteria 3929
195 Ga0265313_10002245 3300031595 Bacteria 16985
196 Ga0265313_10004749 3300031595 Bacteria 10244
197 Ga0265314_10240836 3300031711 Unclassified 1044
198 Ga0373926_0092472 3300035083 Bacteria 1126
199 Ga0373926_0108666 3300035083 Bacteria 1041
200 Ga0373926_0151336 3300035083 Bacteria 883
201 Ga0373929_0083134 3300035085 Bacteria 783
202 Ga0373934_0242070 3300035086 Unclassified 745
203 Ga0373934_0243610 3300035086 Unclassified 743
204 Ga0373923_0082226 3300035111 Bacteria 1398
205 Ga0373923_0307016 3300035111 Bacteria 752
206 Ga0373936_0037071 3300035113 Bacteria 1946
207 Ga0373936_0223916 3300035113 Unclassified 835
208 Ga0373941_0007446 3300035115 Bacteria 2678
209 Ga0373945_0126957 3300035116 Bacteria 1019
210 Ga0373945_0225668 3300035116 Unclassified 785
211 Ga0373945_0306917 3300035116 Bacteria 681
212 Ga0373953_0144781 3300035117 Unclassified 1017
213 Ga0373954_0248564 3300035118 Unclassified 875
214 Ga0373956_0277807 3300035119 Unclassified 797
215 Ga0373957_0305549 3300035120 Bacteria 675
216 Ga0373943_0177637 3300035170 Bacteria 1169
217 Ga0373943_0241894 3300035170 Bacteria 1011
218 Ga0373943_0918381 3300035170 Bacteria 523
219 Ga0373955_0318084 3300035172 Bacteria 940
220 Ga0373955_0360176 3300035172 Bacteria 882
221 Ga0373955_0458234 3300035172 Unclassified 777
222 Ga0373931_0617675 3300035691 Bacteria 710
223 Ga0373935_0524494 3300035692 Bacteria 862
224 Ga0373935_0553824 3300035692 Bacteria 838
225 Ga0373927_0053458 3300035695 Bacteria 2613
226 Ga0373933_0008146 3300035724 Bacteria 5718
227 Ga0373933_0160501 3300035724 Bacteria 1427
228 Ga0373933_0289902 3300035724 Unclassified 1058
229 Ga0373947_0035894 3300035725 Bacteria 2937
230 Ga0373947_0399138 3300035725 Bacteria 927
231 Ga0373947_0423893 3300035725 Bacteria 899
232 Ga0373947_0495150 3300035725 Bacteria 830
233 Ga0373937_0009966 3300036401 Bacteria 8286
234 Ga0373937_0015429 3300036401 Bacteria 6754
235 Ga0373937_0119524 3300036401 Bacteria 2455
236 Ga0373937_0170624 3300036401 Bacteria 2041
237 Ga0373937_0495454 3300036401 Bacteria 1161
238 Ga0373937_1277169 3300036401 Unclassified 682
239 Ga0373925_0041851 3300037068 Bacteria 3398
240 Ga0373925_0527422 3300037068 Bacteria 970
241 Ga0373925_0612977 3300037068 Bacteria 896
242 Ga0373925_1208795 3300037068 Unclassified 621
243 Ga0373925_1489739 3300037068 Unclassified 554
244 Ga0436364_0194315 3300037853 Bacteria 17361
245 Ga0436364_0443629 3300037853 Unclassified 714
246 Ga0436364_0464756 3300037853 Bacteria 866
247 Ga0436364_0536158 3300037853 Unclassified 885
248 Ga0436364_1402115 3300037853 Unclassified 688
249 Ga0395901_2148578 3300038443 Unclassified 503
250 Ga0436365_0683304 3300039437 Bacteria 508
251 Ga0436365_1787291 3300039437 Unclassified 2071
252 Ga0436365_1886055 3300039437 Bacteria 984
253 Ga0436360_1076313 3300039438 Unclassified 3439
254 Ga0436360_1175532 3300039438 Bacteria 725
255 Ga0436361_0149614 3300039447 Bacteria 2020
256 Ga0436361_0284398 3300039447 Unclassified 3643
257 Ga0436361_0768186 3300039447 Bacteria 1514
258 Ga0436361_1114573 3300039447 Bacteria 5732
259 Ga0436363_0865841 3300039450 Bacteria 2035
260 Ga0436362_0284843 3300039453 Unclassified 2444
261 Ga0436362_0538164 3300039453 Unclassified 781
262 Ga0436362_1286681 3300039453 Unclassified 2951
263 Ga0466963_0029062 3300044694 Bacteria 3555
264 Ga0466963_1035099 3300044694 Unclassified 578
265 Ga0466957_0662935 3300044842 Bacteria 734
266 Ga0466958_0852813 3300045836 Bacteria 594
267 Ga0495592_0054744 3300046454 Bacteria 2954
268 Ga0495629_0133976 3300046459 Bacteria 1725
269 Ga0495580_0025345 3300046472 Bacteria 4335
270 Ga0495580_0078432 3300046472 Bacteria 2304
271 Ga0495639_0200789 3300046475 Bacteria 976
272 Ga0495664_0230858 3300046477 Bacteria 1120
273 Ga0495628_0437595 3300046516 Bacteria 951
274 Ga0495628_0579624 3300046516 Bacteria 803
275 Ga0495640_0320464 3300046533 Archaea 960
276 Ga0495586_0017542 3300046535 Bacteria 3806
277 Ga0495586_0092489 3300046535 Bacteria 1672
278 Ga0495667_0015051 3300046559 Bacteria 5222
279 Ga0495634_0039005 3300046642 Bacteria 3237
280 Ga0495635_0087542 3300046663 Bacteria 2131
281 Ga0495599_0066988 3300046678 Bacteria 2243
282 Ga0495623_0315576 3300046679 Unclassified 860
283 Ga0495658_0956924 3300046683 Bacteria 547
284 Ga0495680_0150663 3300047322 Bacteria 1696
285 Ga0495675_0681947 3300047444 Unclassified 577
286 Ga0495602_0195221 3300048088 Bacteria 1549
287 Ga0496104_1681481 3300048907 Bacteria 537
288 Ga0496112_0119526 3300048915 Bacteria 2605
289 Ga0496112_1724858 3300048915 Bacteria 539
290 Ga0496113_0095137 3300048916 Bacteria 2302
291 Ga0501047_0757180 3300049581 Bacteria 787
292 Ga0501070_0113058 3300049586 Bacteria 2244
293 Ga0501080_0794205 3300049742 Bacteria 830
294 Ga0501083_0956819 3300049744 Bacteria 557
295 Ga0501044_0120766 3300049823 Bacteria 2621
296 nmdc:mga0qj67_256643_c1 3300050509 Unclassified 1418
297 nmdc:mga08y16_382792_c1 3300050511 Bacteria 1442
298 nmdc:mga08y16_40637_c1 3300050511 Bacteria 4873
299 nmdc:mga08y16_776842_c1 3300050511 Bacteria 952
300 nmdc:mga0n895_1734633_c1 3300050512 Unclassified 586
301 nmdc:mga0n895_1776646_c1 3300050512 Unclassified 578
302 nmdc:mga0n895_726920_c1 3300050512 Bacteria 987
303 nmdc:mga0rr50_12184_c1 3300050513 Bacteria 5543
304 nmdc:mga08x19_20120_c1 3300050514 Bacteria 4108
305 nmdc:mga0a205_689878_c1 3300050515 Unclassified 871
306 Ga0495595_0072661 3300053084 Bacteria 1628
307 Ga0495619_0228400 3300053085 Bacteria 1289
308 Ga0501084_0607233 3300054114 Bacteria 924
309 Ga0436365_1113323
310 JGI25153J46596_10000755
311 rootH1_10029659
312 Ga0070658_10428910
313 Ga0070683_100650494
314 Ga0070683_101092933
315 Ga0070690_100276574
316 Ga0070680_100000505
317 Ga0070680_100170113
318 Ga0070680_100356111
319 Ga0070660_100153626
320 Ga0070691_10055515
321 Ga0070661_100955790
322 Ga0070661_101623704
323 Ga0070692_10079370
324 Ga0070669_101043888
325 Ga0070675_100339032
326 Ga0070671_100093519
327 Ga0070671_100737478
328 Ga0070671_101465308
329 Ga0070673_100733889
330 Ga0070688_100149345
331 Ga0070659_100027825
332 Ga0070667_100561968
333 Ga0070709_10128924
334 Ga0070709_10463587
335 Ga0070709_10541589
336 Ga0070709_10834479
337 Ga0070714_100309299
338 Ga0070714_100662371
339 Ga0070714_100911075
340 Ga0070714_100945479
341 Ga0070713_100118739
342 Ga0070713_100195944
343 Ga0070713_100868958
344 Ga0070710_10094444
345 Ga0070711_100167273
346 Ga0070711_101216379
347 Ga0070694_101784074
348 Ga0070708_100370728
349 Ga0070678_101121267
350 Ga0070681_10000003
351 Ga0070681_10159063
352 Ga0070681_10272601
353 Ga0070681_11021174
354 Ga0070681_11102331
355 Ga0068867_102138280
356 Ga0070706_100028637
357 Ga0070706_101104777
358 Ga0070707_100049595
359 Ga0070698_100041796
360 Ga0070679_100000063
361 Ga0070679_100092988
362 Ga0070679_100133896
363 Ga0070679_100340522
364 Ga0070679_100352195
365 Ga0070684_100134540
366 Ga0070684_100396491
367 Ga0070684_101140953
368 Ga0070686_100635110
369 Ga0070696_100154963
370 Ga0070693_101526117
371 Ga0068855_100644117
372 Ga0068855_100838003
373 Ga0070664_101209007
374 Ga0068857_100123279
375 Ga0068856_100649156
376 Ga0068856_101139000
377 Ga0068856_101891213
378 Ga0068858_101511205
379 Ga0070717_10158598
380 Ga0070716_100553724
381 Ga0070716_100908174
382 Ga0070712_100000318
383 Ga0068871_101674815
384 Ga0075431_100186046
385 Ga0075433_11666595
386 Ga0075434_102055883
387 Ga0075429_101248678
388 Ga0075436_100057329
389 Ga0075435_100167702
390 Ga0099794_10594721
391 Ga0099795_10003461
392 Ga0105240_10286598
393 Ga0105240_10709945
394 Ga0105240_11314237
395 Ga0111539_10051896
396 Ga0111539_10136695
397 Ga0111539_12649844
398 Ga0105241_10710136
399 Ga0105248_11393087
400 Ga0105248_12003006
401 Ga0105237_10262311
402 Ga0105238_11347096
403 Ga0105249_10263009
404 Ga0099796_10000538
405 Ga0099796_10001246
406 Ga0105239_10050606
407 Ga0105239_11762953
408 Ga0105239_12090094
409 Ga0157373_11032972
410 Ga0157370_10277457
411 Ga0157369_10028419
412 Ga0157369_10443575
413 Ga0157369_10533365
414 Ga0157369_11331232
415 Ga0163162_10930842
416 Ga0157372_10882504
417 Ga0163163_13173643
418 Ga0182008_10038185
419 Ga0182008_10049908
420 Ga0157379_11650386
421 Ga0157379_12407142
422 Ga0157376_10251128
423 Ga0182007_10107556
424 Ga0182007_10222693
425 Ga0213873_10063401
426 Ga0213872_10028309
427 Ga0213872_10187344
428 Ga0213875_10004294
429 Ga0213871_10026363
430 Ga0209758_1000008
431 Ga0207697_10392988
432 Ga0207692_10512410
433 Ga0207699_10150482
434 Ga0207699_10200676
435 Ga0207699_10508067
436 Ga0207684_10183825
437 Ga0207707_10000001
438 Ga0207707_10210126
439 Ga0207707_10363384
440 Ga0207695_10176038
441 Ga0207695_10733588
442 Ga0207693_10000025
443 Ga0207693_10150113
444 Ga0207693_10850335
445 Ga0207663_10161745
446 Ga0207663_10324167
447 Ga0207663_11320945
448 Ga0207660_10000081
449 Ga0207660_10113841
450 Ga0207660_10470171
451 Ga0207649_10777725
452 Ga0207652_10000413
453 Ga0207652_10175191
454 Ga0207652_10270251
455 Ga0207652_10335606
456 Ga0207652_10340602
457 Ga0207652_11069732
458 Ga0207646_10018221
459 Ga0207646_11089953
460 Ga0207681_10997862
461 Ga0207694_10708707
462 Ga0207650_11631886
463 Ga0207700_10103501
464 Ga0207700_10181312
465 Ga0207700_10546281
466 Ga0207700_10855868
467 Ga0207700_11605064
468 Ga0207664_10058881
469 Ga0207664_10561618
470 Ga0207664_10724875
471 Ga0207644_10210964
472 Ga0207644_11502304
473 Ga0207690_10020116
474 Ga0207670_10256138
475 Ga0207665_10056435
476 Ga0207691_10253851
477 Ga0207661_10407486
478 Ga0207661_10839070
479 Ga0207679_10180515
480 Ga0207667_10884462
481 Ga0207667_11824360
482 Ga0207651_10466505
483 Ga0207712_11203958
484 Ga0207703_11312699
485 Ga0207703_11863590
486 Ga0207708_11966828
487 Ga0207702_10013031
488 Ga0207702_10614440
489 Ga0207702_11675304
490 Ga0207641_11390431
491 Ga0207674_10126519
492 Ga0209179_1036355
493 Ga0207428_10373901
494 Ga0265334_10311712
495 Ga0265318_10027274
496 Ga0265318_10291743
497 Ga0265338_10055493
498 Ga0265328_10129333
499 Ga0265325_10000083
500 Ga0265329_10345954
501 Ga0265339_10003023
502 Ga0265316_10037216
503 Ga0265313_10002245
504 Ga0265313_10004749
505 Ga0265314_10240836
506 Ga0373926_0092472
507 Ga0373926_0108666
508 Ga0373926_0151336
509 Ga0373929_0083134
510 Ga0373934_0242070
511 Ga0373934_0243610
512 Ga0373923_0082226
513 Ga0373923_0307016
514 Ga0373936_0037071
515 Ga0373936_0223916
516 Ga0373941_0007446
517 Ga0373945_0126957
518 Ga0373945_0225668
519 Ga0373945_0306917
520 Ga0373953_0144781
521 Ga0373954_0248564
522 Ga0373956_0277807
523 Ga0373957_0305549
524 Ga0373943_0177637
525 Ga0373943_0241894
526 Ga0373943_0918381
527 Ga0373955_0318084
528 Ga0373955_0360176
529 Ga0373955_0458234
530 Ga0373931_0617675
531 Ga0373935_0524494
532 Ga0373935_0553824
533 Ga0373927_0053458
534 Ga0373933_0008146
535 Ga0373933_0160501
536 Ga0373933_0289902
537 Ga0373947_0035894
538 Ga0373947_0399138
539 Ga0373947_0423893
540 Ga0373947_0495150
541 Ga0373937_0009966
542 Ga0373937_0015429
543 Ga0373937_0119524
544 Ga0373937_0170624
545 Ga0373937_0495454
546 Ga0373937_1277169
547 Ga0373925_0041851
548 Ga0373925_0527422
549 Ga0373925_0612977
550 Ga0373925_1208795
551 Ga0373925_1489739
552 Ga0436364_0194315
553 Ga0436364_0443629
554 Ga0436364_0464756
555 Ga0436364_0536158
556 Ga0436364_1402115
557 Ga0395901_2148578
558 Ga0436365_0683304
559 Ga0436365_1787291
560 Ga0436365_1886055
561 Ga0436360_1076313
562 Ga0436360_1175532
563 Ga0436361_0149614
564 Ga0436361_0284398
565 Ga0436361_0768186
566 Ga0436361_1114573
567 Ga0436363_0865841
568 Ga0436362_0284843
569 Ga0436362_0538164
570 Ga0436362_1286681
571 Ga0466963_0029062
572 Ga0466963_1035099
573 Ga0466957_0662935
574 Ga0466958_0852813
575 Ga0495592_0054744
576 Ga0495629_0133976
577 Ga0495580_0025345
578 Ga0495580_0078432
579 Ga0495639_0200789
580 Ga0495664_0230858
581 Ga0495628_0437595
582 Ga0495628_0579624
583 Ga0495640_0320464
584 Ga0495586_0017542
585 Ga0495586_0092489
586 Ga0495667_0015051
587 Ga0495634_0039005
588 Ga0495635_0087542
589 Ga0495599_0066988
590 Ga0495623_0315576
591 Ga0495658_0956924
592 Ga0495680_0150663
593 Ga0495675_0681947
594 Ga0495602_0195221
595 Ga0496104_1681481
596 Ga0496112_0119526
597 Ga0496112_1724858
598 Ga0496113_0095137
599 Ga0501047_0757180
600 Ga0501070_0113058
601 Ga0501080_0794205
602 Ga0501083_0956819
603 Ga0501044_0120766
604 nmdc:mga0qj67_256643_c1
605 nmdc:mga08y16_382792_c1
606 nmdc:mga08y16_40637_c1
607 nmdc:mga08y16_776842_c1
608 nmdc:mga0n895_1734633_c1
609 nmdc:mga0n895_1776646_c1
610 nmdc:mga0n895_726920_c1
611 nmdc:mga0rr50_12184_c1
612 nmdc:mga08x19_20120_c1
613 nmdc:mga0a205_689878_c1
614 Ga0495595_0072661
615 Ga0495619_0228400
616 Ga0501084_0607233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.8737 57 84
5hs9-assembly1.cif.gz_B crystal structure of the quinone-bound yodb from b. subtilis 0.8666 57 84
2pfb-assembly1.cif.gz_B structure of oxidized ohrr from xanthamonas campestris 0.8665 57 84
1lnw-assembly3.cif.gz_F crystal structure of the mexr repressor of the mexab-oprm multidrug efflux operon of pseudomonas aeruginosa 0.8615 57 84
7oyk-assembly1.cif.gz_AAA dna-binding domain of cggr in complex with the dna operator 0.8494 56 84
ID Description Score Start End Superfamily
af_Q4D4M2_794_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8842 57 85 1.10.10.10
2pexB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8836 57 84 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8737 57 84 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8666 57 84 1.10.10.10
1lnwF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8615 57 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A524HXM8-F1-model_v4 Uncharacterized protein 0.9232 7 99
AF-A0A2E7QUD5-F1-model_v4 Uncharacterized protein 0.9225 32 96
AF-A0A5C9EYP7-F1-model_v4 Transcriptional regulator MntR 0.9201 57 84 GO:0003677
GO:0003700
GO:0046914
GO:0046983
AF-A0A2E4Y101-F1-model_v4 Uncharacterized protein 0.9102 7 83
AF-A0A2E1CW91-F1-model_v4 Uncharacterized protein 0.9092 7 99

Map