F399786

General Info

Members Datasets Scaffolds Average Seq Length
308 195 305 88

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1269393|Ga0436364_1269393_985_1251
Length 88
Sequence VAHKKGLGSSRNGRDSHAKRLGVKVFAGEAVTGGEIIVRQRGTRFKPGDGVGIGKDDTIYAESAGTVQFTRGRRGRVISVAPVSDSEA

Samples

Sample ID Description Type Environment
1 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
2 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
3 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
120 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300030886 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
138 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
144 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
145 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
157 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
169 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
180 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
183 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
189 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.36
Metatranscriptomes 12.66
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.52
Nodule 0
Rhizoplane 4.22
Rhizosphere 84.42
Stem 0
Stem Tuber 0
Unclassified 5.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10054627 3300002077 Bacteria 734
2 rootH2_10047594 3300003320 Bacteria 7211
3 rootH1_10018570 3300003323 Bacteria 21878
4 JGI25160J50197_1016846 3300003354 Bacteria 2338
5 Ga0065704_10211291 3300005289 Bacteria 1108
6 Ga0070658_10410991 3300005327 Unclassified 1163
7 Ga0070676_10565569 3300005328 Bacteria 816
8 Ga0070676_11575129 3300005328 Bacteria 507
9 Ga0070690_100124595 3300005330 Bacteria 1733
10 Ga0070690_100385029 3300005330 Bacteria 1026
11 Ga0070690_100679589 3300005330 Bacteria 789
12 Ga0070670_100019667 3300005331 Bacteria 5797
13 Ga0070670_100052209 3300005331 Bacteria 3511
14 Ga0068869_100084462 3300005334 Bacteria 2376
15 Ga0068869_100221748 3300005334 Bacteria 1499
16 Ga0070666_10258703 3300005335 Unclassified 1234
17 Ga0070666_10258787 3300005335 Bacteria 1233
18 Ga0070666_10375627 3300005335 Bacteria 1020
19 Ga0070682_100000173 3300005337 Bacteria 47981
20 Ga0070682_100074103 3300005337 Bacteria 2185
21 Ga0070682_100596244 3300005337 Bacteria 872
22 Ga0068868_100021904 3300005338 Bacteria 4818
23 Ga0068868_101427784 3300005338 Bacteria 646
24 Ga0070671_100049586 3300005355 Bacteria 3493
25 Ga0070671_100057320 3300005355 Bacteria 3241
26 Ga0070671_100973651 3300005355 Unclassified 743
27 Ga0070671_101426712 3300005355 Bacteria 612
28 Ga0070674_100959802 3300005356 Bacteria 748
29 Ga0070688_100081722 3300005365 Bacteria 2093
30 Ga0070667_100002475 3300005367 Bacteria 16121
31 Ga0070667_100013727 3300005367 Bacteria 6696
32 Ga0070667_100083326 3300005367 Bacteria 2739
33 Ga0070667_101516153 3300005367 Bacteria 630
34 Ga0070678_101464572 3300005456 Unclassified 639
35 Ga0068867_100007221 3300005459 Bacteria 7855
36 Ga0068867_100166195 3300005459 Bacteria 1743
37 Ga0068867_100290291 3300005459 Bacteria 1344
38 Ga0070685_10121622 3300005466 Bacteria 1622
39 Ga0068853_100052240 3300005539 Bacteria 3521
40 Ga0068853_100221561 3300005539 Bacteria 1728
41 Ga0068853_100275242 3300005539 Bacteria 1551
42 Ga0070672_100045783 3300005543 Bacteria 3387
43 Ga0070672_101146190 3300005543 Bacteria 692
44 Ga0070686_100284819 3300005544 Bacteria 1220
45 Ga0068855_100083595 3300005563 Bacteria 3698
46 Ga0068852_100031101 3300005616 Bacteria 4401
47 Ga0068859_100000037 3300005617 Bacteria 165480
48 Ga0068859_100085764 3300005617 Bacteria 3195
49 Ga0068864_100009784 3300005618 Bacteria 7905
50 Ga0068864_102499146 3300005618 Bacteria 523
51 Ga0068866_10131711 3300005718 Bacteria 1423
52 Ga0068866_10184429 3300005718 Bacteria 1235
53 Ga0068866_10465010 3300005718 Unclassified 830
54 Ga0068851_10016956 3300005834 Bacteria 3492
55 Ga0068863_100059599 3300005841 Bacteria 3611
56 Ga0068863_100098061 3300005841 Bacteria 2783
57 Ga0068863_100437911 3300005841 Bacteria 1282
58 Ga0068858_100002078 3300005842 Bacteria 20367
59 Ga0068858_100446090 3300005842 Bacteria 1247
60 Ga0068860_100002052 3300005843 Bacteria 21230
61 Ga0068860_100008452 3300005843 Bacteria 10253
62 Ga0068860_100739384 3300005843 Bacteria 995
63 Ga0068862_100103788 3300005844 Bacteria 2490
64 Ga0068862_100715959 3300005844 Bacteria 971
65 Ga0070717_10200903 3300006028 Bacteria 1746
66 Ga0097621_100000254 3300006237 Bacteria 36129
67 Ga0097621_100089922 3300006237 Bacteria 2568
68 Ga0068871_100013263 3300006358 Bacteria 6112
69 Ga0068871_100014168 3300006358 Bacteria 5934
70 Ga0068871_100800652 3300006358 Bacteria 869
71 Ga0075434_100523584 3300006871 Bacteria 1206
72 Ga0068865_100262991 3300006881 Bacteria 1367
73 Ga0068865_100494924 3300006881 Unclassified 1018
74 Ga0068865_102102705 3300006881 Bacteria 513
75 Ga0097620_100000037 3300006931 Bacteria 165480
76 Ga0097620_100085763 3300006931 Bacteria 3195
77 Ga0105240_10039925 3300009093 Bacteria 6007
78 Ga0105240_10153983 3300009093 Bacteria 2736
79 Ga0105247_10005742 3300009101 Bacteria 7769
80 Ga0105247_10328046 3300009101 Bacteria 1070
81 Ga0105243_12051360 3300009148 Bacteria 607
82 Ga0105241_10000159 3300009174 Bacteria 49102
83 Ga0105241_10207286 3300009174 Bacteria 1641
84 Ga0105242_10280800 3300009176 Bacteria 1512
85 Ga0105242_12721322 3300009176 Bacteria 544
86 Ga0105248_11994409 3300009177 Bacteria 659
87 Ga0105237_10045357 3300009545 Bacteria 4425
88 Ga0105237_10056469 3300009545 Bacteria 3930
89 Ga0105237_10109394 3300009545 Bacteria 2756
90 Ga0105238_10177757 3300009551 Bacteria 2105
91 Ga0105249_10023164 3300009553 Bacteria 5569
92 Ga0105239_10001895 3300010375 Bacteria 27349
93 Ga0105239_10056538 3300010375 Bacteria 4304
94 Ga0105239_10139970 3300010375 Bacteria 2696
95 Ga0105239_12364292 3300010375 Bacteria 619
96 Ga0105239_12381243 3300010375 Bacteria 617
97 Ga0105246_10087440 3300011119 Bacteria 2237
98 Ga0157346_1029755 3300012480 Bacteria 526
99 Ga0157370_10853015 3300013104 Bacteria 828
100 Ga0157374_10000004 3300013296 Bacteria 759774
101 Ga0157374_10018319 3300013296 Bacteria 6177
102 Ga0157374_10049898 3300013296 Bacteria 3888
103 Ga0157374_10634730 3300013296 Bacteria 1079
104 Ga0157378_10010095 3300013297 Bacteria 8232
105 Ga0157378_10541760 3300013297 Bacteria 1168
106 Ga0157378_11166366 3300013297 Bacteria 809
107 Ga0163162_10000118 3300013306 Bacteria 69834
108 Ga0163162_10018015 3300013306 Bacteria 6910
109 Ga0163162_10049491 3300013306 Bacteria 4212
110 Ga0163162_11153514 3300013306 Bacteria 879
111 Ga0163162_11957560 3300013306 Bacteria 671
112 Ga0163162_12966728 3300013306 Bacteria 545
113 Ga0157372_10004225 3300013307 Bacteria 15360
114 Ga0157375_10005268 3300013308 Bacteria 11232
115 Ga0157375_11844688 3300013308 Bacteria 717
116 Ga0157375_11861181 3300013308 Bacteria 714
117 Ga0157375_13258281 3300013308 Bacteria 541
118 Ga0163163_10003221 3300014325 Bacteria 13829
119 Ga0163163_10130922 3300014325 Bacteria 2549
120 Ga0163163_10136831 3300014325 Bacteria 2491
121 Ga0163163_11267080 3300014325 Bacteria 799
122 Ga0157380_10280353 3300014326 Bacteria 1525
123 Ga0157380_10440579 3300014326 Bacteria 1248
124 Ga0157380_12365986 3300014326 Bacteria 596
125 Ga0157379_10048721 3300014968 Bacteria 3782
126 Ga0157379_10063068 3300014968 Bacteria 3314
127 Ga0157379_10663367 3300014968 Bacteria 977
128 Ga0157376_10005827 3300014969 Bacteria 8638
129 Ga0157376_10015222 3300014969 Bacteria 5803
130 Ga0157376_10171658 3300014969 Unclassified 1975
131 Ga0163161_10044609 3300017792 Bacteria 3194
132 Ga0163161_10190857 3300017792 Bacteria 1575
133 Ga0184594_123780 3300019181 Bacteria 640
134 Ga0197907_10563666 3300020069 Bacteria 666
135 Ga0206356_11600678 3300020070 Bacteria 773
136 Ga0206350_10009649 3300020080 Bacteria 647
137 Ga0256744_119513 3300023309 Bacteria 533
138 Ga0209436_107080 3300025208 Bacteria 2386
139 Ga0209436_133680 3300025208 Bacteria 522
140 Ga0209130_1001419 3300025284 Bacteria 15964
141 Ga0209050_1004094 3300025298 Bacteria 10188
142 Ga0207426_1000412 3300025302 Bacteria 71401
143 Ga0207656_10105206 3300025321 Bacteria 1298
144 Ga0207642_10365609 3300025899 Bacteria 855
145 Ga0207710_10069215 3300025900 Bacteria 1615
146 Ga0207680_10007673 3300025903 Bacteria 5272
147 Ga0207680_10812533 3300025903 Unclassified 670
148 Ga0207680_11137601 3300025903 Bacteria 557
149 Ga0207647_10021126 3300025904 Bacteria 4350
150 Ga0207645_10770022 3300025907 Bacteria 654
151 Ga0207705_10096111 3300025909 Unclassified 2175
152 Ga0207654_10234651 3300025911 Bacteria 1223
153 Ga0207695_10000027 3300025913 Bacteria 612456
154 Ga0207695_10112141 3300025913 Bacteria 2705
155 Ga0207671_10008616 3300025914 Bacteria 8619
156 Ga0207671_10062482 3300025914 Bacteria 2765
157 Ga0207671_10079437 3300025914 Bacteria 2458
158 Ga0207662_10670990 3300025918 Bacteria 725
159 Ga0207681_10897809 3300025923 Bacteria 742
160 Ga0207700_11674307 3300025928 Bacteria 561
161 Ga0207664_10846544 3300025929 Bacteria 822
162 Ga0207644_10004150 3300025931 Bacteria 9397
163 Ga0207644_10335793 3300025931 Bacteria 1224
164 Ga0207706_10300007 3300025933 Bacteria 1400
165 Ga0207686_10029800 3300025934 Bacteria 3224
166 Ga0207709_10919052 3300025935 Bacteria 712
167 Ga0207669_10278342 3300025937 Bacteria 1261
168 Ga0207704_10127677 3300025938 Bacteria 1754
169 Ga0207691_10049458 3300025940 Bacteria 3852
170 Ga0207691_10957726 3300025940 Bacteria 715
171 Ga0207711_10162990 3300025941 Bacteria 2019
172 Ga0207689_10001469 3300025942 Bacteria 22581
173 Ga0207689_10958588 3300025942 Bacteria 722
174 Ga0207667_10071573 3300025949 Bacteria 3605
175 Ga0207651_10574768 3300025960 Bacteria 982
176 Ga0207712_10049301 3300025961 Bacteria 2933
177 Ga0207640_11773609 3300025981 Bacteria 558
178 Ga0207658_10004542 3300025986 Bacteria 9637
179 Ga0207658_10014123 3300025986 Bacteria 5470
180 Ga0207658_10635066 3300025986 Bacteria 961
181 Ga0207677_11344718 3300026023 Bacteria 657
182 Ga0207703_10004216 3300026035 Bacteria 11850
183 Ga0207703_10432855 3300026035 Bacteria 1226
184 Ga0207639_10062281 3300026041 Bacteria 2884
185 Ga0207639_10155236 3300026041 Bacteria 1922
186 Ga0207678_11747809 3300026067 Bacteria 545
187 Ga0207702_10811666 3300026078 Bacteria 925
188 Ga0207641_10000121 3300026088 Bacteria 114943
189 Ga0207641_10097114 3300026088 Bacteria 2589
190 Ga0207641_10125269 3300026088 Bacteria 2299
191 Ga0207648_10013767 3300026089 Bacteria 7507
192 Ga0207648_10063868 3300026089 Bacteria 3209
193 Ga0207648_10075546 3300026089 Bacteria 2937
194 Ga0207676_10065439 3300026095 Bacteria 2894
195 Ga0207676_10308199 3300026095 Bacteria 1448
196 Ga0207676_11727385 3300026095 Bacteria 624
197 Ga0207683_10629163 3300026121 Bacteria 994
198 Ga0207698_10013076 3300026142 Bacteria 5465
199 Ga0207698_11396587 3300026142 Bacteria 715
200 Ga0268265_10175096 3300028380 Bacteria 1838
201 Ga0268265_10358683 3300028380 Bacteria 1334
202 Ga0268264_10001235 3300028381 Bacteria 24523
203 Ga0268264_10001801 3300028381 Bacteria 19592
204 Ga0268264_10003428 3300028381 Bacteria 13678
205 Ga0268264_11544966 3300028381 Bacteria 674
206 Ga0307517_10233387 3300028786 Bacteria 1101
207 Ga0307515_10000001 3300028794 Bacteria 4259510
208 Ga0307515_10000469 3300028794 Bacteria 96345
209 Ga0265338_10049437 3300028800 Bacteria 3812
210 Ga0265324_10009259 3300029957 Bacteria 3854
211 Ga0307512_10129280 3300030522 Bacteria 1591
212 Ga0265767_106064 3300030836 Bacteria 746
213 Ga0265766_1016454 3300030863 Bacteria 580
214 Ga0265772_104204 3300030886 Bacteria 615
215 Ga0265328_10064078 3300031239 Bacteria 1350
216 Ga0265320_10051323 3300031240 Bacteria 2002
217 Ga0265327_10000046 3300031251 Bacteria 280722
218 Ga0265327_10000192 3300031251 Bacteria 129439
219 Ga0265327_10266181 3300031251 Unclassified 760
220 Ga0307513_10302034 3300031456 Bacteria 1367
221 Ga0307509_10399307 3300031507 Bacteria 1082
222 Ga0265313_10149312 3300031595 Bacteria 1000
223 Ga0307413_10208749 3300031824 Bacteria 1416
224 Ga0307409_101892143 3300031995 Bacteria 626
225 Ga0307416_101933580 3300032002 Bacteria 693
226 Ga0307507_10693777 3300033179 Bacteria 510
227 Ga0307510_10011551 3300033180 Bacteria 10480
228 Ga0316584_0562825 3300036712 Unclassified 794
229 Ga0436364_1269393 3300037853 Bacteria 5020
230 Ga0436361_0006659 3300039447 Bacteria 732
231 Ga0451789_0379272 3300041443 Bacteria 812
232 Ga0451790_25449 3300041444 Bacteria 653
233 Ga0451790_28362 3300041444 Bacteria 633
234 Ga0451790_49291 3300041444 Bacteria 655
235 Ga0451795_0022394 3300041456 Unclassified 602
236 Ga0451802_0322553 3300041460 Bacteria 742
237 Ga0451802_1237120 3300041460 Bacteria 509
238 Ga0451807_0654678 3300041486 Bacteria 506
239 Ga0451807_0854642 3300041486 Bacteria 1206
240 Ga0451807_1882086 3300041486 Bacteria 914
241 Ga0451833_0414409 3300041491 Bacteria 622
242 Ga0451837_0689436 3300041494 Bacteria 513
243 Ga0452268_13001 3300041907 Bacteria 648
244 Ga0439441_099387 3300042001 Bacteria 651
245 Ga0451577_0295931 3300042876 Unclassified 1467
246 Ga0466964_0880506 3300044706 Bacteria 511
247 Ga0451576_0760923 3300045051 Unclassified 1017
248 Ga0451576_2319363 3300045051 Bacteria 550
249 Ga0495590_0149616 3300046457 Bacteria 846
250 Ga0495638_0298906 3300046460 Bacteria 868
251 Ga0495580_0092266 3300046472 Bacteria 2108
252 Ga0495606_0019212 3300046507 Bacteria 5093
253 Ga0495640_0627336 3300046533 Bacteria 648
254 Ga0495668_0000878 3300046616 Bacteria 33873
255 Ga0495611_0000095 3300046648 Bacteria 61293
256 Ga0495686_0000424 3300047472 Bacteria 66338
257 Ga0495686_0071263 3300047472 Bacteria 2140
258 Ga0495686_0493301 3300047472 Bacteria 646
259 Ga0495615_0316378 3300048090 Bacteria 509
260 Ga0496101_0014418 3300048904 Bacteria 5312
261 Ga0496106_0212950 3300048909 Bacteria 1540
262 Ga0496114_0002425 3300048917 Bacteria 14224
263 Ga0496122_0622795 3300048925 Bacteria 501
264 Ga0496126_1123886 3300048929 Unclassified 582
265 Ga0501308_027865 3300049128 Bacteria 744
266 Ga0501343_002814 3300049132 Bacteria 1258
267 Ga0501305_037633 3300049161 Bacteria 777
268 Ga0501305_085403 3300049161 Bacteria 572
269 Ga0501307_063865 3300049162 Bacteria 576
270 Ga0501342_02649 3300049163 Bacteria 612
271 Ga0495678_119114 3300049459 Bacteria 889
272 Ga0501312_057004 3300049528 Bacteria 670
273 Ga0501314_006530 3300049530 Bacteria 1018
274 Ga0501314_007779 3300049530 Bacteria 957
275 Ga0501315_033706 3300049531 Bacteria 749
276 Ga0501315_088736 3300049531 Bacteria 533
277 Ga0501320_049166 3300049536 Bacteria 571
278 Ga0501324_037116 3300049540 Bacteria 548
279 Ga0501325_026827 3300049541 Bacteria 639
280 Ga0501335_013432 3300049551 Bacteria 819
281 Ga0501335_024945 3300049551 Bacteria 654
282 Ga0501335_035648 3300049551 Bacteria 574
283 Ga0501338_12585 3300049554 Bacteria 585
284 Ga0501338_17526 3300049554 Bacteria 521
285 Ga0501034_0001267 3300049571 Bacteria 34303
286 Ga0501076_0474843 3300049592 Bacteria 1030
287 Ga0500578_0030080 3300053086 Bacteria 3488
288 Ga0500646_0128814 3300053090 Bacteria 821
289 Ga0500641_0207025 3300053096 Bacteria 836
290 Ga0500650_0213343 3300053098 Bacteria 876
291 Ga0500554_054210 3300053102 Bacteria 1270
292 Ga0500556_0167858 3300053104 Bacteria 867
293 Ga0500572_119695 3300053111 Bacteria 852
294 Ga0500577_0404224 3300053142 Bacteria 597
295 Ga0500636_0119601 3300053177 Bacteria 1479
296 Ga0500637_0403521 3300053178 Bacteria 709
297 Ga0500637_0543049 3300053178 Bacteria 565
298 Ga0587084_132516 3300059477 Bacteria 534
299 Ga0587077_029918 3300059493 Bacteria 1030
300 Ga0587077_135795 3300059493 Unclassified 629
301 Ga0587076_024567 3300059645 Bacteria 1023
302 Ga0587107_114055 3300059652 Bacteria 550
303 Ga0587114_137041 3300059655 Bacteria 509
304 Ga0587081_08581 3300060246 Bacteria 714
305 Ga0587071_039692 3300060344 Bacteria 939

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100973651 Ga0070671_1009736512 80
2 3300031251 Ga0265327_10266181 Ga0265327_102661812 81
3 3300036712 Ga0316584_0562825 Ga0316584_0562825_422_673 81
4 3300048925 Ga0496122_0622795 Ga0496122_0622795_162_413 81
5 3300048929 Ga0496126_1123886 Ga0496126_1123886_218_469 81
6 3300049592 Ga0501076_0474843 Ga0501076_0474843_38_289 81
7 3300005337 Ga0070682_100074103 Ga0070682_1000741032 82
8 3300010375 Ga0105239_12364292 Ga0105239_123642922 82
9 3300012480 Ga0157346_1029755 Ga0157346_10297552 82
10 3300020080 Ga0206350_10009649 Ga0206350_100096492 82
11 3300031239 Ga0265328_10064078 Ga0265328_100640783 82
12 3300031240 Ga0265320_10051323 Ga0265320_100513232 82
13 3300032002 Ga0307416_101933580 Ga0307416_1019335802 82
14 3300041486 Ga0451807_0654678 Ga0451807_0654678_125_397 82
15 3300046457 Ga0495590_0149616 Ga0495590_0149616_68_325 82
16 3300047472 Ga0495686_0493301 Ga0495686_0493301_319_576 82
17 3300006028 Ga0070717_10200903 Ga0070717_102009032 83
18 3300025928 Ga0207700_11674307 Ga0207700_116743071 83
19 3300025929 Ga0207664_10846544 Ga0207664_108465442 83
20 iso_pu_bacteria 2643221699 2644551406 83
21 3300005844 Ga0068862_100103788 Ga0068862_1001037883 84
22 3300025298 Ga0209050_1004094 Ga0209050_100409410 84
23 3300028380 Ga0268265_10175096 Ga0268265_101750963 84
24 3300042876 Ga0451577_0295931 Ga0451577_0295931_618_878 84
25 3300045051 Ga0451576_0760923 Ga0451576_0760923_581_841 84
26 3300045051 Ga0451576_2319363 Ga0451576_2319363_70_339 84
27 3300049161 Ga0501305_085403 Ga0501305_085403_68_322 84
28 iso_pu_bacteria 2818991460 2819680425 84
29 iso_pu_bacteria 2896109856 2896115231 84
30 3300005328 Ga0070676_11575129 Ga0070676_115751291 85
31 3300005456 Ga0070678_101464572 Ga0070678_1014645722 85
32 3300005539 Ga0068853_100275242 Ga0068853_1002752421 85
33 3300005718 Ga0068866_10465010 Ga0068866_104650102 85
34 3300006881 Ga0068865_100494924 Ga0068865_1004949242 85
35 3300013296 Ga0157374_10018319 Ga0157374_100183193 85
36 3300014325 Ga0163163_11267080 Ga0163163_112670801 85
37 3300023309 Ga0256744_119513 Ga0256744_1195131 85
38 3300025208 Ga0209436_133680 Ga0209436_1336801 85
39 3300026041 Ga0207639_10155236 Ga0207639_101552364 85
40 3300049128 Ga0501308_027865 Ga0501308_027865_310_567 85
41 3300049161 Ga0501305_037633 Ga0501305_037633_321_578 85
42 3300049162 Ga0501307_063865 Ga0501307_063865_64_321 85
43 3300049163 Ga0501342_02649 Ga0501342_02649_154_411 85
44 3300049528 Ga0501312_057004 Ga0501312_057004_197_454 85
45 3300049530 Ga0501314_006530 Ga0501314_006530_298_555 85
46 3300049530 Ga0501314_007779 Ga0501314_007779_450_707 85
47 3300049531 Ga0501315_033706 Ga0501315_033706_147_404 85
48 3300049536 Ga0501320_049166 Ga0501320_049166_147_404 85
49 3300049540 Ga0501324_037116 Ga0501324_037116_35_292 85
50 3300049541 Ga0501325_026827 Ga0501325_026827_310_567 85
51 3300049551 Ga0501335_013432 Ga0501335_013432_227_484 85
52 3300049551 Ga0501335_024945 Ga0501335_024945_63_320 85
53 3300049551 Ga0501335_035648 Ga0501335_035648_15_272 85
54 3300049554 Ga0501338_12585 Ga0501338_12585_301_558 85
55 3300049554 Ga0501338_17526 Ga0501338_17526_28_285 85
56 3300053086 Ga0500578_0030080 Ga0500578_0030080_1498_1755 85
57 3300053098 Ga0500650_0213343 Ga0500650_0213343_88_345 85
58 3300053102 Ga0500554_054210 Ga0500554_054210_42_299 85
59 3300053111 Ga0500572_119695 Ga0500572_119695_496_753 85
60 3300053177 Ga0500636_0119601 Ga0500636_0119601_712_969 85
61 3300053178 Ga0500637_0543049 Ga0500637_0543049_139_396 85
62 3300059493 Ga0587077_029918 Ga0587077_029918_450_707 85
63 3300059645 Ga0587076_024567 Ga0587076_024567_447_704 85
64 3300059652 Ga0587107_114055 Ga0587107_114055_175_432 85
65 3300060246 Ga0587081_08581 Ga0587081_08581_438_695 85
66 3300014326 Ga0157380_10440579 Ga0157380_104405792 86
67 3300020069 Ga0197907_10563666 Ga0197907_105636662 86
68 3300041486 Ga0451807_1882086 Ga0451807_1882086_158_418 86
69 3300042001 Ga0439441_099387 Ga0439441_099387_340_600 86
70 3300006871 Ga0075434_100523584 Ga0075434_1005235842 87
71 3300014326 Ga0157380_12365986 Ga0157380_123659861 87
72 3300017792 Ga0163161_10190857 Ga0163161_101908572 87
73 3300026067 Ga0207678_11747809 Ga0207678_117478092 87
74 3300026078 Ga0207702_10811666 Ga0207702_108116662 87
75 3300028380 Ga0268265_10358683 Ga0268265_103586832 87
76 3300028800 Ga0265338_10049437 Ga0265338_100494373 87
77 3300029957 Ga0265324_10009259 Ga0265324_100092594 87
78 3300030522 Ga0307512_10129280 Ga0307512_101292802 87
79 3300031251 Ga0265327_10000046 Ga0265327_1000004670 87
80 3300031824 Ga0307413_10208749 Ga0307413_102087492 87
81 3300031995 Ga0307409_101892143 Ga0307409_1018921432 87
82 3300037853 Ga0436364_1269393 Ga0436364_1269393_985_1251 87
83 3300039447 Ga0436361_0006659 Ga0436361_0006659_399_668 87
84 3300041444 Ga0451790_28362 Ga0451790_28362_296_565 87
85 3300041460 Ga0451802_1237120 Ga0451802_1237120_171_443 87
86 3300046460 Ga0495638_0298906 Ga0495638_0298906_269_541 87
87 3300046533 Ga0495640_0627336 Ga0495640_0627336_43_327 87
88 3300048090 Ga0495615_0316378 Ga0495615_0316378_168_440 87
89 3300048917 Ga0496114_0002425 Ga0496114_0002425_11936_12199 87
90 3300053104 Ga0500556_0167858 Ga0500556_0167858_209_487 87
91 3300053178 Ga0500637_0403521 Ga0500637_0403521_377_649 87
92 3300059493 Ga0587077_135795 Ga0587077_135795_111_383 87
93 3300002077 JGI24744J21845_10054627 JGI24744J21845_100546271 88
94 3300003320 rootH2_10047594 rootH2_100475947 88
95 3300003323 rootH1_10018570 rootH1_1001857021 88
96 3300003354 JGI25160J50197_1016846 JGI25160J50197_10168464 88
97 3300005289 Ga0065704_10211291 Ga0065704_102112912 88
98 3300005327 Ga0070658_10410991 Ga0070658_104109913 88
99 3300005328 Ga0070676_10565569 Ga0070676_105655691 88
100 3300005330 Ga0070690_100124595 Ga0070690_1001245951 88
101 3300005330 Ga0070690_100385029 Ga0070690_1003850292 88
102 3300005330 Ga0070690_100679589 Ga0070690_1006795893 88
103 3300005331 Ga0070670_100019667 Ga0070670_1000196677 88
104 3300005331 Ga0070670_100052209 Ga0070670_1000522094 88
105 3300005334 Ga0068869_100084462 Ga0068869_1000844623 88
106 3300005334 Ga0068869_100221748 Ga0068869_1002217484 88
107 3300005335 Ga0070666_10258703 Ga0070666_102587033 88
108 3300005335 Ga0070666_10258787 Ga0070666_102587873 88
109 3300005335 Ga0070666_10375627 Ga0070666_103756272 88
110 3300005337 Ga0070682_100000173 Ga0070682_10000017317 88
111 3300005337 Ga0070682_100596244 Ga0070682_1005962442 88
112 3300005338 Ga0068868_100021904 Ga0068868_1000219043 88
113 3300005338 Ga0068868_101427784 Ga0068868_1014277842 88
114 3300005355 Ga0070671_100049586 Ga0070671_1000495863 88
115 3300005355 Ga0070671_100057320 Ga0070671_1000573203 88
116 3300005355 Ga0070671_101426712 Ga0070671_1014267121 88
117 3300005356 Ga0070674_100959802 Ga0070674_1009598021 88
118 3300005365 Ga0070688_100081722 Ga0070688_1000817223 88
119 3300005367 Ga0070667_100002475 Ga0070667_1000024756 88
120 3300005367 Ga0070667_100013727 Ga0070667_1000137273 88
121 3300005367 Ga0070667_100083326 Ga0070667_1000833262 88
122 3300005367 Ga0070667_101516153 Ga0070667_1015161531 88
123 3300005459 Ga0068867_100007221 Ga0068867_1000072214 88
124 3300005459 Ga0068867_100166195 Ga0068867_1001661951 88
125 3300005459 Ga0068867_100290291 Ga0068867_1002902912 88
126 3300005466 Ga0070685_10121622 Ga0070685_101216222 88
127 3300005539 Ga0068853_100052240 Ga0068853_1000522403 88
128 3300005539 Ga0068853_100221561 Ga0068853_1002215613 88
129 3300005543 Ga0070672_100045783 Ga0070672_1000457833 88
130 3300005543 Ga0070672_101146190 Ga0070672_1011461902 88
131 3300005544 Ga0070686_100284819 Ga0070686_1002848193 88
132 3300005563 Ga0068855_100083595 Ga0068855_1000835954 88
133 3300005616 Ga0068852_100031101 Ga0068852_1000311013 88
134 3300005617 Ga0068859_100000037 Ga0068859_10000003758 88
135 3300005617 Ga0068859_100085764 Ga0068859_1000857643 88
136 3300005618 Ga0068864_100009784 Ga0068864_1000097847 88
137 3300005618 Ga0068864_102499146 Ga0068864_1024991461 88
138 3300005718 Ga0068866_10131711 Ga0068866_101317113 88
139 3300005718 Ga0068866_10184429 Ga0068866_101844292 88
140 3300005834 Ga0068851_10016956 Ga0068851_100169564 88
141 3300005841 Ga0068863_100059599 Ga0068863_1000595993 88
142 3300005841 Ga0068863_100098061 Ga0068863_1000980612 88
143 3300005841 Ga0068863_100437911 Ga0068863_1004379113 88
144 3300005842 Ga0068858_100002078 Ga0068858_1000020783 88
145 3300005842 Ga0068858_100446090 Ga0068858_1004460902 88
146 3300005843 Ga0068860_100002052 Ga0068860_10000205214 88
147 3300005843 Ga0068860_100008452 Ga0068860_10000845210 88
148 3300005843 Ga0068860_100739384 Ga0068860_1007393843 88
149 3300005844 Ga0068862_100715959 Ga0068862_1007159593 88
150 3300006237 Ga0097621_100000254 Ga0097621_10000025423 88
151 3300006237 Ga0097621_100089922 Ga0097621_1000899223 88
152 3300006358 Ga0068871_100013263 Ga0068871_1000132632 88
153 3300006358 Ga0068871_100014168 Ga0068871_1000141685 88
154 3300006358 Ga0068871_100800652 Ga0068871_1008006522 88
155 3300006881 Ga0068865_100262991 Ga0068865_1002629912 88
156 3300006881 Ga0068865_102102705 Ga0068865_1021027052 88
157 3300006931 Ga0097620_100000037 Ga0097620_10000003758 88
158 3300006931 Ga0097620_100085763 Ga0097620_1000857633 88
159 3300009093 Ga0105240_10039925 Ga0105240_100399257 88
160 3300009093 Ga0105240_10153983 Ga0105240_101539834 88
161 3300009101 Ga0105247_10005742 Ga0105247_100057424 88
162 3300009101 Ga0105247_10328046 Ga0105247_103280462 88
163 3300009148 Ga0105243_12051360 Ga0105243_120513601 88
164 3300009174 Ga0105241_10000159 Ga0105241_1000015914 88
165 3300009174 Ga0105241_10207286 Ga0105241_102072864 88
166 3300009176 Ga0105242_10280800 Ga0105242_102808002 88
167 3300009176 Ga0105242_12721322 Ga0105242_127213222 88
168 3300009177 Ga0105248_11994409 Ga0105248_119944092 88
169 3300009545 Ga0105237_10045357 Ga0105237_100453573 88
170 3300009545 Ga0105237_10056469 Ga0105237_100564693 88
171 3300009545 Ga0105237_10109394 Ga0105237_101093944 88
172 3300009551 Ga0105238_10177757 Ga0105238_101777573 88
173 3300009553 Ga0105249_10023164 Ga0105249_100231643 88
174 3300010375 Ga0105239_10001895 Ga0105239_100018956 88
175 3300010375 Ga0105239_10056538 Ga0105239_100565384 88
176 3300010375 Ga0105239_10139970 Ga0105239_101399703 88
177 3300010375 Ga0105239_12381243 Ga0105239_123812431 88
178 3300011119 Ga0105246_10087440 Ga0105246_100874403 88
179 3300013104 Ga0157370_10853015 Ga0157370_108530152 88
180 3300013296 Ga0157374_10000004 Ga0157374_10000004562 88
181 3300013296 Ga0157374_10049898 Ga0157374_100498983 88
182 3300013296 Ga0157374_10634730 Ga0157374_106347301 88
183 3300013297 Ga0157378_10010095 Ga0157378_100100954 88
184 3300013297 Ga0157378_10541760 Ga0157378_105417602 88
185 3300013297 Ga0157378_11166366 Ga0157378_111663662 88
186 3300013306 Ga0163162_10000118 Ga0163162_100001184 88
187 3300013306 Ga0163162_10018015 Ga0163162_100180153 88
188 3300013306 Ga0163162_10049491 Ga0163162_100494913 88
189 3300013306 Ga0163162_11153514 Ga0163162_111535142 88
190 3300013306 Ga0163162_11957560 Ga0163162_119575602 88
191 3300013306 Ga0163162_12966728 Ga0163162_129667281 88
192 3300013307 Ga0157372_10004225 Ga0157372_100042255 88
193 3300013308 Ga0157375_10005268 Ga0157375_100052685 88
194 3300013308 Ga0157375_11844688 Ga0157375_118446883 88
195 3300013308 Ga0157375_11861181 Ga0157375_118611811 88
196 3300013308 Ga0157375_13258281 Ga0157375_132582811 88
197 3300014325 Ga0163163_10003221 Ga0163163_100032215 88
198 3300014325 Ga0163163_10130922 Ga0163163_101309223 88
199 3300014325 Ga0163163_10136831 Ga0163163_101368311 88
200 3300014326 Ga0157380_10280353 Ga0157380_102803532 88
201 3300014968 Ga0157379_10048721 Ga0157379_100487213 88
202 3300014968 Ga0157379_10063068 Ga0157379_100630683 88
203 3300014968 Ga0157379_10663367 Ga0157379_106633671 88
204 3300014969 Ga0157376_10005827 Ga0157376_100058274 88
205 3300014969 Ga0157376_10015222 Ga0157376_100152223 88
206 3300014969 Ga0157376_10171658 Ga0157376_101716583 88
207 3300017792 Ga0163161_10044609 Ga0163161_100446094 88
208 3300019181 Ga0184594_123780 Ga0184594_1237802 88
209 3300020070 Ga0206356_11600678 Ga0206356_116006781 88
210 3300025208 Ga0209436_107080 Ga0209436_1070802 88
211 3300025284 Ga0209130_1001419 Ga0209130_10014192 88
212 3300025302 Ga0207426_1000412 Ga0207426_10004122 88
213 3300025321 Ga0207656_10105206 Ga0207656_101052062 88
214 3300025899 Ga0207642_10365609 Ga0207642_103656093 88
215 3300025900 Ga0207710_10069215 Ga0207710_100692153 88
216 3300025903 Ga0207680_10007673 Ga0207680_100076731 88
217 3300025903 Ga0207680_10812533 Ga0207680_108125332 88
218 3300025903 Ga0207680_11137601 Ga0207680_111376012 88
219 3300025904 Ga0207647_10021126 Ga0207647_100211263 88
220 3300025907 Ga0207645_10770022 Ga0207645_107700221 88
221 3300025909 Ga0207705_10096111 Ga0207705_100961113 88
222 3300025911 Ga0207654_10234651 Ga0207654_102346512 88
223 3300025913 Ga0207695_10000027 Ga0207695_10000027115 88
224 3300025913 Ga0207695_10112141 Ga0207695_101121414 88
225 3300025914 Ga0207671_10008616 Ga0207671_100086164 88
226 3300025914 Ga0207671_10062482 Ga0207671_100624824 88
227 3300025914 Ga0207671_10079437 Ga0207671_100794373 88
228 3300025918 Ga0207662_10670990 Ga0207662_106709903 88
229 3300025923 Ga0207681_10897809 Ga0207681_108978092 88
230 3300025931 Ga0207644_10004150 Ga0207644_100041506 88
231 3300025931 Ga0207644_10335793 Ga0207644_103357933 88
232 3300025933 Ga0207706_10300007 Ga0207706_103000073 88
233 3300025934 Ga0207686_10029800 Ga0207686_100298003 88
234 3300025935 Ga0207709_10919052 Ga0207709_109190522 88
235 3300025937 Ga0207669_10278342 Ga0207669_102783422 88
236 3300025938 Ga0207704_10127677 Ga0207704_101276773 88
237 3300025940 Ga0207691_10049458 Ga0207691_100494583 88
238 3300025940 Ga0207691_10957726 Ga0207691_109577262 88
239 3300025941 Ga0207711_10162990 Ga0207711_101629903 88
240 3300025942 Ga0207689_10001469 Ga0207689_100014695 88
241 3300025942 Ga0207689_10958588 Ga0207689_109585882 88
242 3300025949 Ga0207667_10071573 Ga0207667_100715734 88
243 3300025960 Ga0207651_10574768 Ga0207651_105747683 88
244 3300025961 Ga0207712_10049301 Ga0207712_100493013 88
245 3300025981 Ga0207640_11773609 Ga0207640_117736091 88
246 3300025986 Ga0207658_10004542 Ga0207658_100045426 88
247 3300025986 Ga0207658_10014123 Ga0207658_100141233 88
248 3300025986 Ga0207658_10635066 Ga0207658_106350663 88
249 3300026023 Ga0207677_11344718 Ga0207677_113447182 88
250 3300026035 Ga0207703_10004216 Ga0207703_100042163 88
251 3300026035 Ga0207703_10432855 Ga0207703_104328552 88
252 3300026041 Ga0207639_10062281 Ga0207639_100622813 88
253 3300026088 Ga0207641_10000121 Ga0207641_100001216 88
254 3300026088 Ga0207641_10097114 Ga0207641_100971143 88
255 3300026088 Ga0207641_10125269 Ga0207641_101252692 88
256 3300026089 Ga0207648_10013767 Ga0207648_100137676 88
257 3300026089 Ga0207648_10063868 Ga0207648_100638683 88
258 3300026089 Ga0207648_10075546 Ga0207648_100755463 88
259 3300026095 Ga0207676_10065439 Ga0207676_100654393 88
260 3300026095 Ga0207676_10308199 Ga0207676_103081994 88
261 3300026095 Ga0207676_11727385 Ga0207676_117273851 88
262 3300026121 Ga0207683_10629163 Ga0207683_106291632 88
263 3300026142 Ga0207698_10013076 Ga0207698_100130763 88
264 3300026142 Ga0207698_11396587 Ga0207698_113965872 88
265 3300028381 Ga0268264_10001235 Ga0268264_100012358 88
266 3300028381 Ga0268264_10001801 Ga0268264_100018017 88
267 3300028381 Ga0268264_10003428 Ga0268264_100034289 88
268 3300028381 Ga0268264_11544966 Ga0268264_115449661 88
269 3300028786 Ga0307517_10233387 Ga0307517_102333872 88
270 3300028794 Ga0307515_10000001 Ga0307515_10000001903 88
271 3300028794 Ga0307515_10000469 Ga0307515_1000046914 88
272 3300030836 Ga0265767_106064 Ga0265767_1060642 88
273 3300030863 Ga0265766_1016454 Ga0265766_10164542 88
274 3300030886 Ga0265772_104204 Ga0265772_1042042 88
275 3300031251 Ga0265327_10000192 Ga0265327_1000019210 88
276 3300031456 Ga0307513_10302034 Ga0307513_103020343 88
277 3300031507 Ga0307509_10399307 Ga0307509_103993072 88
278 3300031595 Ga0265313_10149312 Ga0265313_101493121 88
279 3300033179 Ga0307507_10693777 Ga0307507_106937772 88
280 3300033180 Ga0307510_10011551 Ga0307510_100115517 88
281 3300041443 Ga0451789_0379272 Ga0451789_0379272_196_462 88
282 3300041444 Ga0451790_25449 Ga0451790_25449_230_541 88
283 3300041444 Ga0451790_49291 Ga0451790_49291_95_361 88
284 3300041456 Ga0451795_0022394 Ga0451795_0022394_76_342 88
285 3300041460 Ga0451802_0322553 Ga0451802_0322553_426_692 88
286 3300041486 Ga0451807_0854642 Ga0451807_0854642_308_574 88
287 3300041491 Ga0451833_0414409 Ga0451833_0414409_131_397 88
288 3300041494 Ga0451837_0689436 Ga0451837_0689436_104_370 88
289 3300041907 Ga0452268_13001 Ga0452268_13001_121_423 88
290 3300044706 Ga0466964_0880506 Ga0466964_0880506_115_387 88
291 3300046472 Ga0495580_0092266 Ga0495580_0092266_551_817 88
292 3300046507 Ga0495606_0019212 Ga0495606_0019212_3371_3637 88
293 3300046616 Ga0495668_0000878 Ga0495668_0000878_9849_10115 88
294 3300046648 Ga0495611_0000095 Ga0495611_0000095_20413_20679 88
295 3300047472 Ga0495686_0000424 Ga0495686_0000424_61168_61434 88
296 3300047472 Ga0495686_0071263 Ga0495686_0071263_1443_1709 88
297 3300048904 Ga0496101_0014418 Ga0496101_0014418_3333_3599 88
298 3300048909 Ga0496106_0212950 Ga0496106_0212950_1065_1331 88
299 3300049132 Ga0501343_002814 Ga0501343_002814_550_828 88
300 3300049459 Ga0495678_119114 Ga0495678_119114_414_680 88
301 3300049531 Ga0501315_088736 Ga0501315_088736_15_293 88
302 3300049571 Ga0501034_0001267 Ga0501034_0001267_1785_2051 88
303 3300053090 Ga0500646_0128814 Ga0500646_0128814_60_326 88
304 3300053096 Ga0500641_0207025 Ga0500641_0207025_299_565 88
305 3300053142 Ga0500577_0404224 Ga0500577_0404224_35_304 88
306 3300059477 Ga0587084_132516 Ga0587084_132516_241_519 88
307 3300059655 Ga0587114_137041 Ga0587114_137041_125_397 88
308 3300060344 Ga0587071_039692 Ga0587071_039692_449_721 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

80

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.9203 21 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9127 20 84
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9107 20 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.8973 20 84
6hix-assembly1.cif.gz_A0 cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.8919 23 84
ID Description Score Start End Superfamily
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.926 29 82 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9127 20 84 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8931 29 82 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8888 23 82 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8865 20 84 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9416 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A656Z7N7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9411 21 88 GO:0003735
GO:0006412
GO:0022625
AF-A0A4Q3J6S5-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9391 25 88 GO:0003735
GO:0006412
GO:0022625
AF-A0A7V3W3R6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9387 25 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A525J835-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9385 21 88 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
85.62 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map