F399786
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 308 | 195 | 305 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1269393|Ga0436364_1269393_985_1251 |
| Length | 88 |
| Sequence | VAHKKGLGSSRNGRDSHAKRLGVKVFAGEAVTGGEIIVRQRGTRFKPGDGVGIGKDDTIYAESAGTVQFTRGRRGRVISVAPVSDSEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 2 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 3 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 31 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 71 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 116 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 120 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 135 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 136 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 137 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 139 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 143 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 144 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 145 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 146 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 147 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 148 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 149 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 180 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 181 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 182 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 183 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 184 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 185 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 186 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 187 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 189 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.36 |
| Metatranscriptomes | 12.66 |
| Isolates | 0.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.52 |
| Nodule | 0 |
| Rhizoplane | 4.22 |
| Rhizosphere | 84.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10054627 | 3300002077 | Bacteria | 734 |
| 2 | rootH2_10047594 | 3300003320 | Bacteria | 7211 |
| 3 | rootH1_10018570 | 3300003323 | Bacteria | 21878 |
| 4 | JGI25160J50197_1016846 | 3300003354 | Bacteria | 2338 |
| 5 | Ga0065704_10211291 | 3300005289 | Bacteria | 1108 |
| 6 | Ga0070658_10410991 | 3300005327 | Unclassified | 1163 |
| 7 | Ga0070676_10565569 | 3300005328 | Bacteria | 816 |
| 8 | Ga0070676_11575129 | 3300005328 | Bacteria | 507 |
| 9 | Ga0070690_100124595 | 3300005330 | Bacteria | 1733 |
| 10 | Ga0070690_100385029 | 3300005330 | Bacteria | 1026 |
| 11 | Ga0070690_100679589 | 3300005330 | Bacteria | 789 |
| 12 | Ga0070670_100019667 | 3300005331 | Bacteria | 5797 |
| 13 | Ga0070670_100052209 | 3300005331 | Bacteria | 3511 |
| 14 | Ga0068869_100084462 | 3300005334 | Bacteria | 2376 |
| 15 | Ga0068869_100221748 | 3300005334 | Bacteria | 1499 |
| 16 | Ga0070666_10258703 | 3300005335 | Unclassified | 1234 |
| 17 | Ga0070666_10258787 | 3300005335 | Bacteria | 1233 |
| 18 | Ga0070666_10375627 | 3300005335 | Bacteria | 1020 |
| 19 | Ga0070682_100000173 | 3300005337 | Bacteria | 47981 |
| 20 | Ga0070682_100074103 | 3300005337 | Bacteria | 2185 |
| 21 | Ga0070682_100596244 | 3300005337 | Bacteria | 872 |
| 22 | Ga0068868_100021904 | 3300005338 | Bacteria | 4818 |
| 23 | Ga0068868_101427784 | 3300005338 | Bacteria | 646 |
| 24 | Ga0070671_100049586 | 3300005355 | Bacteria | 3493 |
| 25 | Ga0070671_100057320 | 3300005355 | Bacteria | 3241 |
| 26 | Ga0070671_100973651 | 3300005355 | Unclassified | 743 |
| 27 | Ga0070671_101426712 | 3300005355 | Bacteria | 612 |
| 28 | Ga0070674_100959802 | 3300005356 | Bacteria | 748 |
| 29 | Ga0070688_100081722 | 3300005365 | Bacteria | 2093 |
| 30 | Ga0070667_100002475 | 3300005367 | Bacteria | 16121 |
| 31 | Ga0070667_100013727 | 3300005367 | Bacteria | 6696 |
| 32 | Ga0070667_100083326 | 3300005367 | Bacteria | 2739 |
| 33 | Ga0070667_101516153 | 3300005367 | Bacteria | 630 |
| 34 | Ga0070678_101464572 | 3300005456 | Unclassified | 639 |
| 35 | Ga0068867_100007221 | 3300005459 | Bacteria | 7855 |
| 36 | Ga0068867_100166195 | 3300005459 | Bacteria | 1743 |
| 37 | Ga0068867_100290291 | 3300005459 | Bacteria | 1344 |
| 38 | Ga0070685_10121622 | 3300005466 | Bacteria | 1622 |
| 39 | Ga0068853_100052240 | 3300005539 | Bacteria | 3521 |
| 40 | Ga0068853_100221561 | 3300005539 | Bacteria | 1728 |
| 41 | Ga0068853_100275242 | 3300005539 | Bacteria | 1551 |
| 42 | Ga0070672_100045783 | 3300005543 | Bacteria | 3387 |
| 43 | Ga0070672_101146190 | 3300005543 | Bacteria | 692 |
| 44 | Ga0070686_100284819 | 3300005544 | Bacteria | 1220 |
| 45 | Ga0068855_100083595 | 3300005563 | Bacteria | 3698 |
| 46 | Ga0068852_100031101 | 3300005616 | Bacteria | 4401 |
| 47 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 48 | Ga0068859_100085764 | 3300005617 | Bacteria | 3195 |
| 49 | Ga0068864_100009784 | 3300005618 | Bacteria | 7905 |
| 50 | Ga0068864_102499146 | 3300005618 | Bacteria | 523 |
| 51 | Ga0068866_10131711 | 3300005718 | Bacteria | 1423 |
| 52 | Ga0068866_10184429 | 3300005718 | Bacteria | 1235 |
| 53 | Ga0068866_10465010 | 3300005718 | Unclassified | 830 |
| 54 | Ga0068851_10016956 | 3300005834 | Bacteria | 3492 |
| 55 | Ga0068863_100059599 | 3300005841 | Bacteria | 3611 |
| 56 | Ga0068863_100098061 | 3300005841 | Bacteria | 2783 |
| 57 | Ga0068863_100437911 | 3300005841 | Bacteria | 1282 |
| 58 | Ga0068858_100002078 | 3300005842 | Bacteria | 20367 |
| 59 | Ga0068858_100446090 | 3300005842 | Bacteria | 1247 |
| 60 | Ga0068860_100002052 | 3300005843 | Bacteria | 21230 |
| 61 | Ga0068860_100008452 | 3300005843 | Bacteria | 10253 |
| 62 | Ga0068860_100739384 | 3300005843 | Bacteria | 995 |
| 63 | Ga0068862_100103788 | 3300005844 | Bacteria | 2490 |
| 64 | Ga0068862_100715959 | 3300005844 | Bacteria | 971 |
| 65 | Ga0070717_10200903 | 3300006028 | Bacteria | 1746 |
| 66 | Ga0097621_100000254 | 3300006237 | Bacteria | 36129 |
| 67 | Ga0097621_100089922 | 3300006237 | Bacteria | 2568 |
| 68 | Ga0068871_100013263 | 3300006358 | Bacteria | 6112 |
| 69 | Ga0068871_100014168 | 3300006358 | Bacteria | 5934 |
| 70 | Ga0068871_100800652 | 3300006358 | Bacteria | 869 |
| 71 | Ga0075434_100523584 | 3300006871 | Bacteria | 1206 |
| 72 | Ga0068865_100262991 | 3300006881 | Bacteria | 1367 |
| 73 | Ga0068865_100494924 | 3300006881 | Unclassified | 1018 |
| 74 | Ga0068865_102102705 | 3300006881 | Bacteria | 513 |
| 75 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 76 | Ga0097620_100085763 | 3300006931 | Bacteria | 3195 |
| 77 | Ga0105240_10039925 | 3300009093 | Bacteria | 6007 |
| 78 | Ga0105240_10153983 | 3300009093 | Bacteria | 2736 |
| 79 | Ga0105247_10005742 | 3300009101 | Bacteria | 7769 |
| 80 | Ga0105247_10328046 | 3300009101 | Bacteria | 1070 |
| 81 | Ga0105243_12051360 | 3300009148 | Bacteria | 607 |
| 82 | Ga0105241_10000159 | 3300009174 | Bacteria | 49102 |
| 83 | Ga0105241_10207286 | 3300009174 | Bacteria | 1641 |
| 84 | Ga0105242_10280800 | 3300009176 | Bacteria | 1512 |
| 85 | Ga0105242_12721322 | 3300009176 | Bacteria | 544 |
| 86 | Ga0105248_11994409 | 3300009177 | Bacteria | 659 |
| 87 | Ga0105237_10045357 | 3300009545 | Bacteria | 4425 |
| 88 | Ga0105237_10056469 | 3300009545 | Bacteria | 3930 |
| 89 | Ga0105237_10109394 | 3300009545 | Bacteria | 2756 |
| 90 | Ga0105238_10177757 | 3300009551 | Bacteria | 2105 |
| 91 | Ga0105249_10023164 | 3300009553 | Bacteria | 5569 |
| 92 | Ga0105239_10001895 | 3300010375 | Bacteria | 27349 |
| 93 | Ga0105239_10056538 | 3300010375 | Bacteria | 4304 |
| 94 | Ga0105239_10139970 | 3300010375 | Bacteria | 2696 |
| 95 | Ga0105239_12364292 | 3300010375 | Bacteria | 619 |
| 96 | Ga0105239_12381243 | 3300010375 | Bacteria | 617 |
| 97 | Ga0105246_10087440 | 3300011119 | Bacteria | 2237 |
| 98 | Ga0157346_1029755 | 3300012480 | Bacteria | 526 |
| 99 | Ga0157370_10853015 | 3300013104 | Bacteria | 828 |
| 100 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 101 | Ga0157374_10018319 | 3300013296 | Bacteria | 6177 |
| 102 | Ga0157374_10049898 | 3300013296 | Bacteria | 3888 |
| 103 | Ga0157374_10634730 | 3300013296 | Bacteria | 1079 |
| 104 | Ga0157378_10010095 | 3300013297 | Bacteria | 8232 |
| 105 | Ga0157378_10541760 | 3300013297 | Bacteria | 1168 |
| 106 | Ga0157378_11166366 | 3300013297 | Bacteria | 809 |
| 107 | Ga0163162_10000118 | 3300013306 | Bacteria | 69834 |
| 108 | Ga0163162_10018015 | 3300013306 | Bacteria | 6910 |
| 109 | Ga0163162_10049491 | 3300013306 | Bacteria | 4212 |
| 110 | Ga0163162_11153514 | 3300013306 | Bacteria | 879 |
| 111 | Ga0163162_11957560 | 3300013306 | Bacteria | 671 |
| 112 | Ga0163162_12966728 | 3300013306 | Bacteria | 545 |
| 113 | Ga0157372_10004225 | 3300013307 | Bacteria | 15360 |
| 114 | Ga0157375_10005268 | 3300013308 | Bacteria | 11232 |
| 115 | Ga0157375_11844688 | 3300013308 | Bacteria | 717 |
| 116 | Ga0157375_11861181 | 3300013308 | Bacteria | 714 |
| 117 | Ga0157375_13258281 | 3300013308 | Bacteria | 541 |
| 118 | Ga0163163_10003221 | 3300014325 | Bacteria | 13829 |
| 119 | Ga0163163_10130922 | 3300014325 | Bacteria | 2549 |
| 120 | Ga0163163_10136831 | 3300014325 | Bacteria | 2491 |
| 121 | Ga0163163_11267080 | 3300014325 | Bacteria | 799 |
| 122 | Ga0157380_10280353 | 3300014326 | Bacteria | 1525 |
| 123 | Ga0157380_10440579 | 3300014326 | Bacteria | 1248 |
| 124 | Ga0157380_12365986 | 3300014326 | Bacteria | 596 |
| 125 | Ga0157379_10048721 | 3300014968 | Bacteria | 3782 |
| 126 | Ga0157379_10063068 | 3300014968 | Bacteria | 3314 |
| 127 | Ga0157379_10663367 | 3300014968 | Bacteria | 977 |
| 128 | Ga0157376_10005827 | 3300014969 | Bacteria | 8638 |
| 129 | Ga0157376_10015222 | 3300014969 | Bacteria | 5803 |
| 130 | Ga0157376_10171658 | 3300014969 | Unclassified | 1975 |
| 131 | Ga0163161_10044609 | 3300017792 | Bacteria | 3194 |
| 132 | Ga0163161_10190857 | 3300017792 | Bacteria | 1575 |
| 133 | Ga0184594_123780 | 3300019181 | Bacteria | 640 |
| 134 | Ga0197907_10563666 | 3300020069 | Bacteria | 666 |
| 135 | Ga0206356_11600678 | 3300020070 | Bacteria | 773 |
| 136 | Ga0206350_10009649 | 3300020080 | Bacteria | 647 |
| 137 | Ga0256744_119513 | 3300023309 | Bacteria | 533 |
| 138 | Ga0209436_107080 | 3300025208 | Bacteria | 2386 |
| 139 | Ga0209436_133680 | 3300025208 | Bacteria | 522 |
| 140 | Ga0209130_1001419 | 3300025284 | Bacteria | 15964 |
| 141 | Ga0209050_1004094 | 3300025298 | Bacteria | 10188 |
| 142 | Ga0207426_1000412 | 3300025302 | Bacteria | 71401 |
| 143 | Ga0207656_10105206 | 3300025321 | Bacteria | 1298 |
| 144 | Ga0207642_10365609 | 3300025899 | Bacteria | 855 |
| 145 | Ga0207710_10069215 | 3300025900 | Bacteria | 1615 |
| 146 | Ga0207680_10007673 | 3300025903 | Bacteria | 5272 |
| 147 | Ga0207680_10812533 | 3300025903 | Unclassified | 670 |
| 148 | Ga0207680_11137601 | 3300025903 | Bacteria | 557 |
| 149 | Ga0207647_10021126 | 3300025904 | Bacteria | 4350 |
| 150 | Ga0207645_10770022 | 3300025907 | Bacteria | 654 |
| 151 | Ga0207705_10096111 | 3300025909 | Unclassified | 2175 |
| 152 | Ga0207654_10234651 | 3300025911 | Bacteria | 1223 |
| 153 | Ga0207695_10000027 | 3300025913 | Bacteria | 612456 |
| 154 | Ga0207695_10112141 | 3300025913 | Bacteria | 2705 |
| 155 | Ga0207671_10008616 | 3300025914 | Bacteria | 8619 |
| 156 | Ga0207671_10062482 | 3300025914 | Bacteria | 2765 |
| 157 | Ga0207671_10079437 | 3300025914 | Bacteria | 2458 |
| 158 | Ga0207662_10670990 | 3300025918 | Bacteria | 725 |
| 159 | Ga0207681_10897809 | 3300025923 | Bacteria | 742 |
| 160 | Ga0207700_11674307 | 3300025928 | Bacteria | 561 |
| 161 | Ga0207664_10846544 | 3300025929 | Bacteria | 822 |
| 162 | Ga0207644_10004150 | 3300025931 | Bacteria | 9397 |
| 163 | Ga0207644_10335793 | 3300025931 | Bacteria | 1224 |
| 164 | Ga0207706_10300007 | 3300025933 | Bacteria | 1400 |
| 165 | Ga0207686_10029800 | 3300025934 | Bacteria | 3224 |
| 166 | Ga0207709_10919052 | 3300025935 | Bacteria | 712 |
| 167 | Ga0207669_10278342 | 3300025937 | Bacteria | 1261 |
| 168 | Ga0207704_10127677 | 3300025938 | Bacteria | 1754 |
| 169 | Ga0207691_10049458 | 3300025940 | Bacteria | 3852 |
| 170 | Ga0207691_10957726 | 3300025940 | Bacteria | 715 |
| 171 | Ga0207711_10162990 | 3300025941 | Bacteria | 2019 |
| 172 | Ga0207689_10001469 | 3300025942 | Bacteria | 22581 |
| 173 | Ga0207689_10958588 | 3300025942 | Bacteria | 722 |
| 174 | Ga0207667_10071573 | 3300025949 | Bacteria | 3605 |
| 175 | Ga0207651_10574768 | 3300025960 | Bacteria | 982 |
| 176 | Ga0207712_10049301 | 3300025961 | Bacteria | 2933 |
| 177 | Ga0207640_11773609 | 3300025981 | Bacteria | 558 |
| 178 | Ga0207658_10004542 | 3300025986 | Bacteria | 9637 |
| 179 | Ga0207658_10014123 | 3300025986 | Bacteria | 5470 |
| 180 | Ga0207658_10635066 | 3300025986 | Bacteria | 961 |
| 181 | Ga0207677_11344718 | 3300026023 | Bacteria | 657 |
| 182 | Ga0207703_10004216 | 3300026035 | Bacteria | 11850 |
| 183 | Ga0207703_10432855 | 3300026035 | Bacteria | 1226 |
| 184 | Ga0207639_10062281 | 3300026041 | Bacteria | 2884 |
| 185 | Ga0207639_10155236 | 3300026041 | Bacteria | 1922 |
| 186 | Ga0207678_11747809 | 3300026067 | Bacteria | 545 |
| 187 | Ga0207702_10811666 | 3300026078 | Bacteria | 925 |
| 188 | Ga0207641_10000121 | 3300026088 | Bacteria | 114943 |
| 189 | Ga0207641_10097114 | 3300026088 | Bacteria | 2589 |
| 190 | Ga0207641_10125269 | 3300026088 | Bacteria | 2299 |
| 191 | Ga0207648_10013767 | 3300026089 | Bacteria | 7507 |
| 192 | Ga0207648_10063868 | 3300026089 | Bacteria | 3209 |
| 193 | Ga0207648_10075546 | 3300026089 | Bacteria | 2937 |
| 194 | Ga0207676_10065439 | 3300026095 | Bacteria | 2894 |
| 195 | Ga0207676_10308199 | 3300026095 | Bacteria | 1448 |
| 196 | Ga0207676_11727385 | 3300026095 | Bacteria | 624 |
| 197 | Ga0207683_10629163 | 3300026121 | Bacteria | 994 |
| 198 | Ga0207698_10013076 | 3300026142 | Bacteria | 5465 |
| 199 | Ga0207698_11396587 | 3300026142 | Bacteria | 715 |
| 200 | Ga0268265_10175096 | 3300028380 | Bacteria | 1838 |
| 201 | Ga0268265_10358683 | 3300028380 | Bacteria | 1334 |
| 202 | Ga0268264_10001235 | 3300028381 | Bacteria | 24523 |
| 203 | Ga0268264_10001801 | 3300028381 | Bacteria | 19592 |
| 204 | Ga0268264_10003428 | 3300028381 | Bacteria | 13678 |
| 205 | Ga0268264_11544966 | 3300028381 | Bacteria | 674 |
| 206 | Ga0307517_10233387 | 3300028786 | Bacteria | 1101 |
| 207 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 208 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 209 | Ga0265338_10049437 | 3300028800 | Bacteria | 3812 |
| 210 | Ga0265324_10009259 | 3300029957 | Bacteria | 3854 |
| 211 | Ga0307512_10129280 | 3300030522 | Bacteria | 1591 |
| 212 | Ga0265767_106064 | 3300030836 | Bacteria | 746 |
| 213 | Ga0265766_1016454 | 3300030863 | Bacteria | 580 |
| 214 | Ga0265772_104204 | 3300030886 | Bacteria | 615 |
| 215 | Ga0265328_10064078 | 3300031239 | Bacteria | 1350 |
| 216 | Ga0265320_10051323 | 3300031240 | Bacteria | 2002 |
| 217 | Ga0265327_10000046 | 3300031251 | Bacteria | 280722 |
| 218 | Ga0265327_10000192 | 3300031251 | Bacteria | 129439 |
| 219 | Ga0265327_10266181 | 3300031251 | Unclassified | 760 |
| 220 | Ga0307513_10302034 | 3300031456 | Bacteria | 1367 |
| 221 | Ga0307509_10399307 | 3300031507 | Bacteria | 1082 |
| 222 | Ga0265313_10149312 | 3300031595 | Bacteria | 1000 |
| 223 | Ga0307413_10208749 | 3300031824 | Bacteria | 1416 |
| 224 | Ga0307409_101892143 | 3300031995 | Bacteria | 626 |
| 225 | Ga0307416_101933580 | 3300032002 | Bacteria | 693 |
| 226 | Ga0307507_10693777 | 3300033179 | Bacteria | 510 |
| 227 | Ga0307510_10011551 | 3300033180 | Bacteria | 10480 |
| 228 | Ga0316584_0562825 | 3300036712 | Unclassified | 794 |
| 229 | Ga0436364_1269393 | 3300037853 | Bacteria | 5020 |
| 230 | Ga0436361_0006659 | 3300039447 | Bacteria | 732 |
| 231 | Ga0451789_0379272 | 3300041443 | Bacteria | 812 |
| 232 | Ga0451790_25449 | 3300041444 | Bacteria | 653 |
| 233 | Ga0451790_28362 | 3300041444 | Bacteria | 633 |
| 234 | Ga0451790_49291 | 3300041444 | Bacteria | 655 |
| 235 | Ga0451795_0022394 | 3300041456 | Unclassified | 602 |
| 236 | Ga0451802_0322553 | 3300041460 | Bacteria | 742 |
| 237 | Ga0451802_1237120 | 3300041460 | Bacteria | 509 |
| 238 | Ga0451807_0654678 | 3300041486 | Bacteria | 506 |
| 239 | Ga0451807_0854642 | 3300041486 | Bacteria | 1206 |
| 240 | Ga0451807_1882086 | 3300041486 | Bacteria | 914 |
| 241 | Ga0451833_0414409 | 3300041491 | Bacteria | 622 |
| 242 | Ga0451837_0689436 | 3300041494 | Bacteria | 513 |
| 243 | Ga0452268_13001 | 3300041907 | Bacteria | 648 |
| 244 | Ga0439441_099387 | 3300042001 | Bacteria | 651 |
| 245 | Ga0451577_0295931 | 3300042876 | Unclassified | 1467 |
| 246 | Ga0466964_0880506 | 3300044706 | Bacteria | 511 |
| 247 | Ga0451576_0760923 | 3300045051 | Unclassified | 1017 |
| 248 | Ga0451576_2319363 | 3300045051 | Bacteria | 550 |
| 249 | Ga0495590_0149616 | 3300046457 | Bacteria | 846 |
| 250 | Ga0495638_0298906 | 3300046460 | Bacteria | 868 |
| 251 | Ga0495580_0092266 | 3300046472 | Bacteria | 2108 |
| 252 | Ga0495606_0019212 | 3300046507 | Bacteria | 5093 |
| 253 | Ga0495640_0627336 | 3300046533 | Bacteria | 648 |
| 254 | Ga0495668_0000878 | 3300046616 | Bacteria | 33873 |
| 255 | Ga0495611_0000095 | 3300046648 | Bacteria | 61293 |
| 256 | Ga0495686_0000424 | 3300047472 | Bacteria | 66338 |
| 257 | Ga0495686_0071263 | 3300047472 | Bacteria | 2140 |
| 258 | Ga0495686_0493301 | 3300047472 | Bacteria | 646 |
| 259 | Ga0495615_0316378 | 3300048090 | Bacteria | 509 |
| 260 | Ga0496101_0014418 | 3300048904 | Bacteria | 5312 |
| 261 | Ga0496106_0212950 | 3300048909 | Bacteria | 1540 |
| 262 | Ga0496114_0002425 | 3300048917 | Bacteria | 14224 |
| 263 | Ga0496122_0622795 | 3300048925 | Bacteria | 501 |
| 264 | Ga0496126_1123886 | 3300048929 | Unclassified | 582 |
| 265 | Ga0501308_027865 | 3300049128 | Bacteria | 744 |
| 266 | Ga0501343_002814 | 3300049132 | Bacteria | 1258 |
| 267 | Ga0501305_037633 | 3300049161 | Bacteria | 777 |
| 268 | Ga0501305_085403 | 3300049161 | Bacteria | 572 |
| 269 | Ga0501307_063865 | 3300049162 | Bacteria | 576 |
| 270 | Ga0501342_02649 | 3300049163 | Bacteria | 612 |
| 271 | Ga0495678_119114 | 3300049459 | Bacteria | 889 |
| 272 | Ga0501312_057004 | 3300049528 | Bacteria | 670 |
| 273 | Ga0501314_006530 | 3300049530 | Bacteria | 1018 |
| 274 | Ga0501314_007779 | 3300049530 | Bacteria | 957 |
| 275 | Ga0501315_033706 | 3300049531 | Bacteria | 749 |
| 276 | Ga0501315_088736 | 3300049531 | Bacteria | 533 |
| 277 | Ga0501320_049166 | 3300049536 | Bacteria | 571 |
| 278 | Ga0501324_037116 | 3300049540 | Bacteria | 548 |
| 279 | Ga0501325_026827 | 3300049541 | Bacteria | 639 |
| 280 | Ga0501335_013432 | 3300049551 | Bacteria | 819 |
| 281 | Ga0501335_024945 | 3300049551 | Bacteria | 654 |
| 282 | Ga0501335_035648 | 3300049551 | Bacteria | 574 |
| 283 | Ga0501338_12585 | 3300049554 | Bacteria | 585 |
| 284 | Ga0501338_17526 | 3300049554 | Bacteria | 521 |
| 285 | Ga0501034_0001267 | 3300049571 | Bacteria | 34303 |
| 286 | Ga0501076_0474843 | 3300049592 | Bacteria | 1030 |
| 287 | Ga0500578_0030080 | 3300053086 | Bacteria | 3488 |
| 288 | Ga0500646_0128814 | 3300053090 | Bacteria | 821 |
| 289 | Ga0500641_0207025 | 3300053096 | Bacteria | 836 |
| 290 | Ga0500650_0213343 | 3300053098 | Bacteria | 876 |
| 291 | Ga0500554_054210 | 3300053102 | Bacteria | 1270 |
| 292 | Ga0500556_0167858 | 3300053104 | Bacteria | 867 |
| 293 | Ga0500572_119695 | 3300053111 | Bacteria | 852 |
| 294 | Ga0500577_0404224 | 3300053142 | Bacteria | 597 |
| 295 | Ga0500636_0119601 | 3300053177 | Bacteria | 1479 |
| 296 | Ga0500637_0403521 | 3300053178 | Bacteria | 709 |
| 297 | Ga0500637_0543049 | 3300053178 | Bacteria | 565 |
| 298 | Ga0587084_132516 | 3300059477 | Bacteria | 534 |
| 299 | Ga0587077_029918 | 3300059493 | Bacteria | 1030 |
| 300 | Ga0587077_135795 | 3300059493 | Unclassified | 629 |
| 301 | Ga0587076_024567 | 3300059645 | Bacteria | 1023 |
| 302 | Ga0587107_114055 | 3300059652 | Bacteria | 550 |
| 303 | Ga0587114_137041 | 3300059655 | Bacteria | 509 |
| 304 | Ga0587081_08581 | 3300060246 | Bacteria | 714 |
| 305 | Ga0587071_039692 | 3300060344 | Bacteria | 939 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100973651 | Ga0070671_1009736512 | 80 |
| 2 | 3300031251 | Ga0265327_10266181 | Ga0265327_102661812 | 81 |
| 3 | 3300036712 | Ga0316584_0562825 | Ga0316584_0562825_422_673 | 81 |
| 4 | 3300048925 | Ga0496122_0622795 | Ga0496122_0622795_162_413 | 81 |
| 5 | 3300048929 | Ga0496126_1123886 | Ga0496126_1123886_218_469 | 81 |
| 6 | 3300049592 | Ga0501076_0474843 | Ga0501076_0474843_38_289 | 81 |
| 7 | 3300005337 | Ga0070682_100074103 | Ga0070682_1000741032 | 82 |
| 8 | 3300010375 | Ga0105239_12364292 | Ga0105239_123642922 | 82 |
| 9 | 3300012480 | Ga0157346_1029755 | Ga0157346_10297552 | 82 |
| 10 | 3300020080 | Ga0206350_10009649 | Ga0206350_100096492 | 82 |
| 11 | 3300031239 | Ga0265328_10064078 | Ga0265328_100640783 | 82 |
| 12 | 3300031240 | Ga0265320_10051323 | Ga0265320_100513232 | 82 |
| 13 | 3300032002 | Ga0307416_101933580 | Ga0307416_1019335802 | 82 |
| 14 | 3300041486 | Ga0451807_0654678 | Ga0451807_0654678_125_397 | 82 |
| 15 | 3300046457 | Ga0495590_0149616 | Ga0495590_0149616_68_325 | 82 |
| 16 | 3300047472 | Ga0495686_0493301 | Ga0495686_0493301_319_576 | 82 |
| 17 | 3300006028 | Ga0070717_10200903 | Ga0070717_102009032 | 83 |
| 18 | 3300025928 | Ga0207700_11674307 | Ga0207700_116743071 | 83 |
| 19 | 3300025929 | Ga0207664_10846544 | Ga0207664_108465442 | 83 |
| 20 | iso_pu_bacteria | 2643221699 | 2644551406 | 83 |
| 21 | 3300005844 | Ga0068862_100103788 | Ga0068862_1001037883 | 84 |
| 22 | 3300025298 | Ga0209050_1004094 | Ga0209050_100409410 | 84 |
| 23 | 3300028380 | Ga0268265_10175096 | Ga0268265_101750963 | 84 |
| 24 | 3300042876 | Ga0451577_0295931 | Ga0451577_0295931_618_878 | 84 |
| 25 | 3300045051 | Ga0451576_0760923 | Ga0451576_0760923_581_841 | 84 |
| 26 | 3300045051 | Ga0451576_2319363 | Ga0451576_2319363_70_339 | 84 |
| 27 | 3300049161 | Ga0501305_085403 | Ga0501305_085403_68_322 | 84 |
| 28 | iso_pu_bacteria | 2818991460 | 2819680425 | 84 |
| 29 | iso_pu_bacteria | 2896109856 | 2896115231 | 84 |
| 30 | 3300005328 | Ga0070676_11575129 | Ga0070676_115751291 | 85 |
| 31 | 3300005456 | Ga0070678_101464572 | Ga0070678_1014645722 | 85 |
| 32 | 3300005539 | Ga0068853_100275242 | Ga0068853_1002752421 | 85 |
| 33 | 3300005718 | Ga0068866_10465010 | Ga0068866_104650102 | 85 |
| 34 | 3300006881 | Ga0068865_100494924 | Ga0068865_1004949242 | 85 |
| 35 | 3300013296 | Ga0157374_10018319 | Ga0157374_100183193 | 85 |
| 36 | 3300014325 | Ga0163163_11267080 | Ga0163163_112670801 | 85 |
| 37 | 3300023309 | Ga0256744_119513 | Ga0256744_1195131 | 85 |
| 38 | 3300025208 | Ga0209436_133680 | Ga0209436_1336801 | 85 |
| 39 | 3300026041 | Ga0207639_10155236 | Ga0207639_101552364 | 85 |
| 40 | 3300049128 | Ga0501308_027865 | Ga0501308_027865_310_567 | 85 |
| 41 | 3300049161 | Ga0501305_037633 | Ga0501305_037633_321_578 | 85 |
| 42 | 3300049162 | Ga0501307_063865 | Ga0501307_063865_64_321 | 85 |
| 43 | 3300049163 | Ga0501342_02649 | Ga0501342_02649_154_411 | 85 |
| 44 | 3300049528 | Ga0501312_057004 | Ga0501312_057004_197_454 | 85 |
| 45 | 3300049530 | Ga0501314_006530 | Ga0501314_006530_298_555 | 85 |
| 46 | 3300049530 | Ga0501314_007779 | Ga0501314_007779_450_707 | 85 |
| 47 | 3300049531 | Ga0501315_033706 | Ga0501315_033706_147_404 | 85 |
| 48 | 3300049536 | Ga0501320_049166 | Ga0501320_049166_147_404 | 85 |
| 49 | 3300049540 | Ga0501324_037116 | Ga0501324_037116_35_292 | 85 |
| 50 | 3300049541 | Ga0501325_026827 | Ga0501325_026827_310_567 | 85 |
| 51 | 3300049551 | Ga0501335_013432 | Ga0501335_013432_227_484 | 85 |
| 52 | 3300049551 | Ga0501335_024945 | Ga0501335_024945_63_320 | 85 |
| 53 | 3300049551 | Ga0501335_035648 | Ga0501335_035648_15_272 | 85 |
| 54 | 3300049554 | Ga0501338_12585 | Ga0501338_12585_301_558 | 85 |
| 55 | 3300049554 | Ga0501338_17526 | Ga0501338_17526_28_285 | 85 |
| 56 | 3300053086 | Ga0500578_0030080 | Ga0500578_0030080_1498_1755 | 85 |
| 57 | 3300053098 | Ga0500650_0213343 | Ga0500650_0213343_88_345 | 85 |
| 58 | 3300053102 | Ga0500554_054210 | Ga0500554_054210_42_299 | 85 |
| 59 | 3300053111 | Ga0500572_119695 | Ga0500572_119695_496_753 | 85 |
| 60 | 3300053177 | Ga0500636_0119601 | Ga0500636_0119601_712_969 | 85 |
| 61 | 3300053178 | Ga0500637_0543049 | Ga0500637_0543049_139_396 | 85 |
| 62 | 3300059493 | Ga0587077_029918 | Ga0587077_029918_450_707 | 85 |
| 63 | 3300059645 | Ga0587076_024567 | Ga0587076_024567_447_704 | 85 |
| 64 | 3300059652 | Ga0587107_114055 | Ga0587107_114055_175_432 | 85 |
| 65 | 3300060246 | Ga0587081_08581 | Ga0587081_08581_438_695 | 85 |
| 66 | 3300014326 | Ga0157380_10440579 | Ga0157380_104405792 | 86 |
| 67 | 3300020069 | Ga0197907_10563666 | Ga0197907_105636662 | 86 |
| 68 | 3300041486 | Ga0451807_1882086 | Ga0451807_1882086_158_418 | 86 |
| 69 | 3300042001 | Ga0439441_099387 | Ga0439441_099387_340_600 | 86 |
| 70 | 3300006871 | Ga0075434_100523584 | Ga0075434_1005235842 | 87 |
| 71 | 3300014326 | Ga0157380_12365986 | Ga0157380_123659861 | 87 |
| 72 | 3300017792 | Ga0163161_10190857 | Ga0163161_101908572 | 87 |
| 73 | 3300026067 | Ga0207678_11747809 | Ga0207678_117478092 | 87 |
| 74 | 3300026078 | Ga0207702_10811666 | Ga0207702_108116662 | 87 |
| 75 | 3300028380 | Ga0268265_10358683 | Ga0268265_103586832 | 87 |
| 76 | 3300028800 | Ga0265338_10049437 | Ga0265338_100494373 | 87 |
| 77 | 3300029957 | Ga0265324_10009259 | Ga0265324_100092594 | 87 |
| 78 | 3300030522 | Ga0307512_10129280 | Ga0307512_101292802 | 87 |
| 79 | 3300031251 | Ga0265327_10000046 | Ga0265327_1000004670 | 87 |
| 80 | 3300031824 | Ga0307413_10208749 | Ga0307413_102087492 | 87 |
| 81 | 3300031995 | Ga0307409_101892143 | Ga0307409_1018921432 | 87 |
| 82 | 3300037853 | Ga0436364_1269393 | Ga0436364_1269393_985_1251 | 87 |
| 83 | 3300039447 | Ga0436361_0006659 | Ga0436361_0006659_399_668 | 87 |
| 84 | 3300041444 | Ga0451790_28362 | Ga0451790_28362_296_565 | 87 |
| 85 | 3300041460 | Ga0451802_1237120 | Ga0451802_1237120_171_443 | 87 |
| 86 | 3300046460 | Ga0495638_0298906 | Ga0495638_0298906_269_541 | 87 |
| 87 | 3300046533 | Ga0495640_0627336 | Ga0495640_0627336_43_327 | 87 |
| 88 | 3300048090 | Ga0495615_0316378 | Ga0495615_0316378_168_440 | 87 |
| 89 | 3300048917 | Ga0496114_0002425 | Ga0496114_0002425_11936_12199 | 87 |
| 90 | 3300053104 | Ga0500556_0167858 | Ga0500556_0167858_209_487 | 87 |
| 91 | 3300053178 | Ga0500637_0403521 | Ga0500637_0403521_377_649 | 87 |
| 92 | 3300059493 | Ga0587077_135795 | Ga0587077_135795_111_383 | 87 |
| 93 | 3300002077 | JGI24744J21845_10054627 | JGI24744J21845_100546271 | 88 |
| 94 | 3300003320 | rootH2_10047594 | rootH2_100475947 | 88 |
| 95 | 3300003323 | rootH1_10018570 | rootH1_1001857021 | 88 |
| 96 | 3300003354 | JGI25160J50197_1016846 | JGI25160J50197_10168464 | 88 |
| 97 | 3300005289 | Ga0065704_10211291 | Ga0065704_102112912 | 88 |
| 98 | 3300005327 | Ga0070658_10410991 | Ga0070658_104109913 | 88 |
| 99 | 3300005328 | Ga0070676_10565569 | Ga0070676_105655691 | 88 |
| 100 | 3300005330 | Ga0070690_100124595 | Ga0070690_1001245951 | 88 |
| 101 | 3300005330 | Ga0070690_100385029 | Ga0070690_1003850292 | 88 |
| 102 | 3300005330 | Ga0070690_100679589 | Ga0070690_1006795893 | 88 |
| 103 | 3300005331 | Ga0070670_100019667 | Ga0070670_1000196677 | 88 |
| 104 | 3300005331 | Ga0070670_100052209 | Ga0070670_1000522094 | 88 |
| 105 | 3300005334 | Ga0068869_100084462 | Ga0068869_1000844623 | 88 |
| 106 | 3300005334 | Ga0068869_100221748 | Ga0068869_1002217484 | 88 |
| 107 | 3300005335 | Ga0070666_10258703 | Ga0070666_102587033 | 88 |
| 108 | 3300005335 | Ga0070666_10258787 | Ga0070666_102587873 | 88 |
| 109 | 3300005335 | Ga0070666_10375627 | Ga0070666_103756272 | 88 |
| 110 | 3300005337 | Ga0070682_100000173 | Ga0070682_10000017317 | 88 |
| 111 | 3300005337 | Ga0070682_100596244 | Ga0070682_1005962442 | 88 |
| 112 | 3300005338 | Ga0068868_100021904 | Ga0068868_1000219043 | 88 |
| 113 | 3300005338 | Ga0068868_101427784 | Ga0068868_1014277842 | 88 |
| 114 | 3300005355 | Ga0070671_100049586 | Ga0070671_1000495863 | 88 |
| 115 | 3300005355 | Ga0070671_100057320 | Ga0070671_1000573203 | 88 |
| 116 | 3300005355 | Ga0070671_101426712 | Ga0070671_1014267121 | 88 |
| 117 | 3300005356 | Ga0070674_100959802 | Ga0070674_1009598021 | 88 |
| 118 | 3300005365 | Ga0070688_100081722 | Ga0070688_1000817223 | 88 |
| 119 | 3300005367 | Ga0070667_100002475 | Ga0070667_1000024756 | 88 |
| 120 | 3300005367 | Ga0070667_100013727 | Ga0070667_1000137273 | 88 |
| 121 | 3300005367 | Ga0070667_100083326 | Ga0070667_1000833262 | 88 |
| 122 | 3300005367 | Ga0070667_101516153 | Ga0070667_1015161531 | 88 |
| 123 | 3300005459 | Ga0068867_100007221 | Ga0068867_1000072214 | 88 |
| 124 | 3300005459 | Ga0068867_100166195 | Ga0068867_1001661951 | 88 |
| 125 | 3300005459 | Ga0068867_100290291 | Ga0068867_1002902912 | 88 |
| 126 | 3300005466 | Ga0070685_10121622 | Ga0070685_101216222 | 88 |
| 127 | 3300005539 | Ga0068853_100052240 | Ga0068853_1000522403 | 88 |
| 128 | 3300005539 | Ga0068853_100221561 | Ga0068853_1002215613 | 88 |
| 129 | 3300005543 | Ga0070672_100045783 | Ga0070672_1000457833 | 88 |
| 130 | 3300005543 | Ga0070672_101146190 | Ga0070672_1011461902 | 88 |
| 131 | 3300005544 | Ga0070686_100284819 | Ga0070686_1002848193 | 88 |
| 132 | 3300005563 | Ga0068855_100083595 | Ga0068855_1000835954 | 88 |
| 133 | 3300005616 | Ga0068852_100031101 | Ga0068852_1000311013 | 88 |
| 134 | 3300005617 | Ga0068859_100000037 | Ga0068859_10000003758 | 88 |
| 135 | 3300005617 | Ga0068859_100085764 | Ga0068859_1000857643 | 88 |
| 136 | 3300005618 | Ga0068864_100009784 | Ga0068864_1000097847 | 88 |
| 137 | 3300005618 | Ga0068864_102499146 | Ga0068864_1024991461 | 88 |
| 138 | 3300005718 | Ga0068866_10131711 | Ga0068866_101317113 | 88 |
| 139 | 3300005718 | Ga0068866_10184429 | Ga0068866_101844292 | 88 |
| 140 | 3300005834 | Ga0068851_10016956 | Ga0068851_100169564 | 88 |
| 141 | 3300005841 | Ga0068863_100059599 | Ga0068863_1000595993 | 88 |
| 142 | 3300005841 | Ga0068863_100098061 | Ga0068863_1000980612 | 88 |
| 143 | 3300005841 | Ga0068863_100437911 | Ga0068863_1004379113 | 88 |
| 144 | 3300005842 | Ga0068858_100002078 | Ga0068858_1000020783 | 88 |
| 145 | 3300005842 | Ga0068858_100446090 | Ga0068858_1004460902 | 88 |
| 146 | 3300005843 | Ga0068860_100002052 | Ga0068860_10000205214 | 88 |
| 147 | 3300005843 | Ga0068860_100008452 | Ga0068860_10000845210 | 88 |
| 148 | 3300005843 | Ga0068860_100739384 | Ga0068860_1007393843 | 88 |
| 149 | 3300005844 | Ga0068862_100715959 | Ga0068862_1007159593 | 88 |
| 150 | 3300006237 | Ga0097621_100000254 | Ga0097621_10000025423 | 88 |
| 151 | 3300006237 | Ga0097621_100089922 | Ga0097621_1000899223 | 88 |
| 152 | 3300006358 | Ga0068871_100013263 | Ga0068871_1000132632 | 88 |
| 153 | 3300006358 | Ga0068871_100014168 | Ga0068871_1000141685 | 88 |
| 154 | 3300006358 | Ga0068871_100800652 | Ga0068871_1008006522 | 88 |
| 155 | 3300006881 | Ga0068865_100262991 | Ga0068865_1002629912 | 88 |
| 156 | 3300006881 | Ga0068865_102102705 | Ga0068865_1021027052 | 88 |
| 157 | 3300006931 | Ga0097620_100000037 | Ga0097620_10000003758 | 88 |
| 158 | 3300006931 | Ga0097620_100085763 | Ga0097620_1000857633 | 88 |
| 159 | 3300009093 | Ga0105240_10039925 | Ga0105240_100399257 | 88 |
| 160 | 3300009093 | Ga0105240_10153983 | Ga0105240_101539834 | 88 |
| 161 | 3300009101 | Ga0105247_10005742 | Ga0105247_100057424 | 88 |
| 162 | 3300009101 | Ga0105247_10328046 | Ga0105247_103280462 | 88 |
| 163 | 3300009148 | Ga0105243_12051360 | Ga0105243_120513601 | 88 |
| 164 | 3300009174 | Ga0105241_10000159 | Ga0105241_1000015914 | 88 |
| 165 | 3300009174 | Ga0105241_10207286 | Ga0105241_102072864 | 88 |
| 166 | 3300009176 | Ga0105242_10280800 | Ga0105242_102808002 | 88 |
| 167 | 3300009176 | Ga0105242_12721322 | Ga0105242_127213222 | 88 |
| 168 | 3300009177 | Ga0105248_11994409 | Ga0105248_119944092 | 88 |
| 169 | 3300009545 | Ga0105237_10045357 | Ga0105237_100453573 | 88 |
| 170 | 3300009545 | Ga0105237_10056469 | Ga0105237_100564693 | 88 |
| 171 | 3300009545 | Ga0105237_10109394 | Ga0105237_101093944 | 88 |
| 172 | 3300009551 | Ga0105238_10177757 | Ga0105238_101777573 | 88 |
| 173 | 3300009553 | Ga0105249_10023164 | Ga0105249_100231643 | 88 |
| 174 | 3300010375 | Ga0105239_10001895 | Ga0105239_100018956 | 88 |
| 175 | 3300010375 | Ga0105239_10056538 | Ga0105239_100565384 | 88 |
| 176 | 3300010375 | Ga0105239_10139970 | Ga0105239_101399703 | 88 |
| 177 | 3300010375 | Ga0105239_12381243 | Ga0105239_123812431 | 88 |
| 178 | 3300011119 | Ga0105246_10087440 | Ga0105246_100874403 | 88 |
| 179 | 3300013104 | Ga0157370_10853015 | Ga0157370_108530152 | 88 |
| 180 | 3300013296 | Ga0157374_10000004 | Ga0157374_10000004562 | 88 |
| 181 | 3300013296 | Ga0157374_10049898 | Ga0157374_100498983 | 88 |
| 182 | 3300013296 | Ga0157374_10634730 | Ga0157374_106347301 | 88 |
| 183 | 3300013297 | Ga0157378_10010095 | Ga0157378_100100954 | 88 |
| 184 | 3300013297 | Ga0157378_10541760 | Ga0157378_105417602 | 88 |
| 185 | 3300013297 | Ga0157378_11166366 | Ga0157378_111663662 | 88 |
| 186 | 3300013306 | Ga0163162_10000118 | Ga0163162_100001184 | 88 |
| 187 | 3300013306 | Ga0163162_10018015 | Ga0163162_100180153 | 88 |
| 188 | 3300013306 | Ga0163162_10049491 | Ga0163162_100494913 | 88 |
| 189 | 3300013306 | Ga0163162_11153514 | Ga0163162_111535142 | 88 |
| 190 | 3300013306 | Ga0163162_11957560 | Ga0163162_119575602 | 88 |
| 191 | 3300013306 | Ga0163162_12966728 | Ga0163162_129667281 | 88 |
| 192 | 3300013307 | Ga0157372_10004225 | Ga0157372_100042255 | 88 |
| 193 | 3300013308 | Ga0157375_10005268 | Ga0157375_100052685 | 88 |
| 194 | 3300013308 | Ga0157375_11844688 | Ga0157375_118446883 | 88 |
| 195 | 3300013308 | Ga0157375_11861181 | Ga0157375_118611811 | 88 |
| 196 | 3300013308 | Ga0157375_13258281 | Ga0157375_132582811 | 88 |
| 197 | 3300014325 | Ga0163163_10003221 | Ga0163163_100032215 | 88 |
| 198 | 3300014325 | Ga0163163_10130922 | Ga0163163_101309223 | 88 |
| 199 | 3300014325 | Ga0163163_10136831 | Ga0163163_101368311 | 88 |
| 200 | 3300014326 | Ga0157380_10280353 | Ga0157380_102803532 | 88 |
| 201 | 3300014968 | Ga0157379_10048721 | Ga0157379_100487213 | 88 |
| 202 | 3300014968 | Ga0157379_10063068 | Ga0157379_100630683 | 88 |
| 203 | 3300014968 | Ga0157379_10663367 | Ga0157379_106633671 | 88 |
| 204 | 3300014969 | Ga0157376_10005827 | Ga0157376_100058274 | 88 |
| 205 | 3300014969 | Ga0157376_10015222 | Ga0157376_100152223 | 88 |
| 206 | 3300014969 | Ga0157376_10171658 | Ga0157376_101716583 | 88 |
| 207 | 3300017792 | Ga0163161_10044609 | Ga0163161_100446094 | 88 |
| 208 | 3300019181 | Ga0184594_123780 | Ga0184594_1237802 | 88 |
| 209 | 3300020070 | Ga0206356_11600678 | Ga0206356_116006781 | 88 |
| 210 | 3300025208 | Ga0209436_107080 | Ga0209436_1070802 | 88 |
| 211 | 3300025284 | Ga0209130_1001419 | Ga0209130_10014192 | 88 |
| 212 | 3300025302 | Ga0207426_1000412 | Ga0207426_10004122 | 88 |
| 213 | 3300025321 | Ga0207656_10105206 | Ga0207656_101052062 | 88 |
| 214 | 3300025899 | Ga0207642_10365609 | Ga0207642_103656093 | 88 |
| 215 | 3300025900 | Ga0207710_10069215 | Ga0207710_100692153 | 88 |
| 216 | 3300025903 | Ga0207680_10007673 | Ga0207680_100076731 | 88 |
| 217 | 3300025903 | Ga0207680_10812533 | Ga0207680_108125332 | 88 |
| 218 | 3300025903 | Ga0207680_11137601 | Ga0207680_111376012 | 88 |
| 219 | 3300025904 | Ga0207647_10021126 | Ga0207647_100211263 | 88 |
| 220 | 3300025907 | Ga0207645_10770022 | Ga0207645_107700221 | 88 |
| 221 | 3300025909 | Ga0207705_10096111 | Ga0207705_100961113 | 88 |
| 222 | 3300025911 | Ga0207654_10234651 | Ga0207654_102346512 | 88 |
| 223 | 3300025913 | Ga0207695_10000027 | Ga0207695_10000027115 | 88 |
| 224 | 3300025913 | Ga0207695_10112141 | Ga0207695_101121414 | 88 |
| 225 | 3300025914 | Ga0207671_10008616 | Ga0207671_100086164 | 88 |
| 226 | 3300025914 | Ga0207671_10062482 | Ga0207671_100624824 | 88 |
| 227 | 3300025914 | Ga0207671_10079437 | Ga0207671_100794373 | 88 |
| 228 | 3300025918 | Ga0207662_10670990 | Ga0207662_106709903 | 88 |
| 229 | 3300025923 | Ga0207681_10897809 | Ga0207681_108978092 | 88 |
| 230 | 3300025931 | Ga0207644_10004150 | Ga0207644_100041506 | 88 |
| 231 | 3300025931 | Ga0207644_10335793 | Ga0207644_103357933 | 88 |
| 232 | 3300025933 | Ga0207706_10300007 | Ga0207706_103000073 | 88 |
| 233 | 3300025934 | Ga0207686_10029800 | Ga0207686_100298003 | 88 |
| 234 | 3300025935 | Ga0207709_10919052 | Ga0207709_109190522 | 88 |
| 235 | 3300025937 | Ga0207669_10278342 | Ga0207669_102783422 | 88 |
| 236 | 3300025938 | Ga0207704_10127677 | Ga0207704_101276773 | 88 |
| 237 | 3300025940 | Ga0207691_10049458 | Ga0207691_100494583 | 88 |
| 238 | 3300025940 | Ga0207691_10957726 | Ga0207691_109577262 | 88 |
| 239 | 3300025941 | Ga0207711_10162990 | Ga0207711_101629903 | 88 |
| 240 | 3300025942 | Ga0207689_10001469 | Ga0207689_100014695 | 88 |
| 241 | 3300025942 | Ga0207689_10958588 | Ga0207689_109585882 | 88 |
| 242 | 3300025949 | Ga0207667_10071573 | Ga0207667_100715734 | 88 |
| 243 | 3300025960 | Ga0207651_10574768 | Ga0207651_105747683 | 88 |
| 244 | 3300025961 | Ga0207712_10049301 | Ga0207712_100493013 | 88 |
| 245 | 3300025981 | Ga0207640_11773609 | Ga0207640_117736091 | 88 |
| 246 | 3300025986 | Ga0207658_10004542 | Ga0207658_100045426 | 88 |
| 247 | 3300025986 | Ga0207658_10014123 | Ga0207658_100141233 | 88 |
| 248 | 3300025986 | Ga0207658_10635066 | Ga0207658_106350663 | 88 |
| 249 | 3300026023 | Ga0207677_11344718 | Ga0207677_113447182 | 88 |
| 250 | 3300026035 | Ga0207703_10004216 | Ga0207703_100042163 | 88 |
| 251 | 3300026035 | Ga0207703_10432855 | Ga0207703_104328552 | 88 |
| 252 | 3300026041 | Ga0207639_10062281 | Ga0207639_100622813 | 88 |
| 253 | 3300026088 | Ga0207641_10000121 | Ga0207641_100001216 | 88 |
| 254 | 3300026088 | Ga0207641_10097114 | Ga0207641_100971143 | 88 |
| 255 | 3300026088 | Ga0207641_10125269 | Ga0207641_101252692 | 88 |
| 256 | 3300026089 | Ga0207648_10013767 | Ga0207648_100137676 | 88 |
| 257 | 3300026089 | Ga0207648_10063868 | Ga0207648_100638683 | 88 |
| 258 | 3300026089 | Ga0207648_10075546 | Ga0207648_100755463 | 88 |
| 259 | 3300026095 | Ga0207676_10065439 | Ga0207676_100654393 | 88 |
| 260 | 3300026095 | Ga0207676_10308199 | Ga0207676_103081994 | 88 |
| 261 | 3300026095 | Ga0207676_11727385 | Ga0207676_117273851 | 88 |
| 262 | 3300026121 | Ga0207683_10629163 | Ga0207683_106291632 | 88 |
| 263 | 3300026142 | Ga0207698_10013076 | Ga0207698_100130763 | 88 |
| 264 | 3300026142 | Ga0207698_11396587 | Ga0207698_113965872 | 88 |
| 265 | 3300028381 | Ga0268264_10001235 | Ga0268264_100012358 | 88 |
| 266 | 3300028381 | Ga0268264_10001801 | Ga0268264_100018017 | 88 |
| 267 | 3300028381 | Ga0268264_10003428 | Ga0268264_100034289 | 88 |
| 268 | 3300028381 | Ga0268264_11544966 | Ga0268264_115449661 | 88 |
| 269 | 3300028786 | Ga0307517_10233387 | Ga0307517_102333872 | 88 |
| 270 | 3300028794 | Ga0307515_10000001 | Ga0307515_10000001903 | 88 |
| 271 | 3300028794 | Ga0307515_10000469 | Ga0307515_1000046914 | 88 |
| 272 | 3300030836 | Ga0265767_106064 | Ga0265767_1060642 | 88 |
| 273 | 3300030863 | Ga0265766_1016454 | Ga0265766_10164542 | 88 |
| 274 | 3300030886 | Ga0265772_104204 | Ga0265772_1042042 | 88 |
| 275 | 3300031251 | Ga0265327_10000192 | Ga0265327_1000019210 | 88 |
| 276 | 3300031456 | Ga0307513_10302034 | Ga0307513_103020343 | 88 |
| 277 | 3300031507 | Ga0307509_10399307 | Ga0307509_103993072 | 88 |
| 278 | 3300031595 | Ga0265313_10149312 | Ga0265313_101493121 | 88 |
| 279 | 3300033179 | Ga0307507_10693777 | Ga0307507_106937772 | 88 |
| 280 | 3300033180 | Ga0307510_10011551 | Ga0307510_100115517 | 88 |
| 281 | 3300041443 | Ga0451789_0379272 | Ga0451789_0379272_196_462 | 88 |
| 282 | 3300041444 | Ga0451790_25449 | Ga0451790_25449_230_541 | 88 |
| 283 | 3300041444 | Ga0451790_49291 | Ga0451790_49291_95_361 | 88 |
| 284 | 3300041456 | Ga0451795_0022394 | Ga0451795_0022394_76_342 | 88 |
| 285 | 3300041460 | Ga0451802_0322553 | Ga0451802_0322553_426_692 | 88 |
| 286 | 3300041486 | Ga0451807_0854642 | Ga0451807_0854642_308_574 | 88 |
| 287 | 3300041491 | Ga0451833_0414409 | Ga0451833_0414409_131_397 | 88 |
| 288 | 3300041494 | Ga0451837_0689436 | Ga0451837_0689436_104_370 | 88 |
| 289 | 3300041907 | Ga0452268_13001 | Ga0452268_13001_121_423 | 88 |
| 290 | 3300044706 | Ga0466964_0880506 | Ga0466964_0880506_115_387 | 88 |
| 291 | 3300046472 | Ga0495580_0092266 | Ga0495580_0092266_551_817 | 88 |
| 292 | 3300046507 | Ga0495606_0019212 | Ga0495606_0019212_3371_3637 | 88 |
| 293 | 3300046616 | Ga0495668_0000878 | Ga0495668_0000878_9849_10115 | 88 |
| 294 | 3300046648 | Ga0495611_0000095 | Ga0495611_0000095_20413_20679 | 88 |
| 295 | 3300047472 | Ga0495686_0000424 | Ga0495686_0000424_61168_61434 | 88 |
| 296 | 3300047472 | Ga0495686_0071263 | Ga0495686_0071263_1443_1709 | 88 |
| 297 | 3300048904 | Ga0496101_0014418 | Ga0496101_0014418_3333_3599 | 88 |
| 298 | 3300048909 | Ga0496106_0212950 | Ga0496106_0212950_1065_1331 | 88 |
| 299 | 3300049132 | Ga0501343_002814 | Ga0501343_002814_550_828 | 88 |
| 300 | 3300049459 | Ga0495678_119114 | Ga0495678_119114_414_680 | 88 |
| 301 | 3300049531 | Ga0501315_088736 | Ga0501315_088736_15_293 | 88 |
| 302 | 3300049571 | Ga0501034_0001267 | Ga0501034_0001267_1785_2051 | 88 |
| 303 | 3300053090 | Ga0500646_0128814 | Ga0500646_0128814_60_326 | 88 |
| 304 | 3300053096 | Ga0500641_0207025 | Ga0500641_0207025_299_565 | 88 |
| 305 | 3300053142 | Ga0500577_0404224 | Ga0500577_0404224_35_304 | 88 |
| 306 | 3300059477 | Ga0587084_132516 | Ga0587084_132516_241_519 | 88 |
| 307 | 3300059655 | Ga0587114_137041 | Ga0587114_137041_125_397 | 88 |
| 308 | 3300060344 | Ga0587071_039692 | Ga0587071_039692_449_721 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7pkt-assembly1.cif.gz_u | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.9203 | 21 | 85 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9127 | 20 | 84 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9107 | 20 | 84 |
| 8c94-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.8973 | 20 | 84 |
| 6hix-assembly1.cif.gz_A0 | cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit | 0.8919 | 23 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.926 | 29 | 82 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9127 | 20 | 84 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8931 | 29 | 82 | 2.40.50.100 |
| af_Q4DLT4_19_136_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8888 | 23 | 82 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8865 | 20 | 84 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A328ESH9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9416 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A656Z7N7-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9411 | 21 | 88 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A4Q3J6S5-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9391 | 25 | 88 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7V3W3R6-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9387 | 25 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A525J835-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9385 | 21 | 88 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar