F399785

General Info

Members Datasets Scaffolds Average Seq Length
308 194 616 173

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1168689|Ga0436364_1168689_240_800
Length 172
Sequence MSATGQKACAGGRYDAVDITQLILDDHHEQRRLFAILEEIPRQDTDKLAAVWKRLRALLDLHAEAEERHFYPTLLRVGKGDDHNEIRDTAAKVDEQDVGSDAWYEALTACNKANSDHMGEEEREGLTDFRQHVSLEIRHDLGVRFAAFEAEHVTGVEPVDKDPQIYIEEHRG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 1.62
Rhizosphere 91.56
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1168689 3300037853 Bacteria 866
2 JGI25164J39214_1009673 3300002772 Bacteria 944
3 JGI25165J46597_1000187 3300003214 Bacteria 93537
4 Ga0055542_1002874 3300003762 Bacteria 5113
5 Ga0070658_10061969 3300005327 Bacteria 3048
6 Ga0070658_10088642 3300005327 Bacteria 2548
7 Ga0070676_10035281 3300005328 Bacteria 2876
8 Ga0070690_100048866 3300005330 Bacteria 2696
9 Ga0070670_100124166 3300005331 Bacteria 2228
10 Ga0070670_100466984 3300005331 Bacteria 1120
11 Ga0070670_100532814 3300005331 Bacteria 1046
12 Ga0070670_100543028 3300005331 Bacteria 1036
13 Ga0070677_10008136 3300005333 Bacteria 3522
14 Ga0068869_100061605 3300005334 Bacteria 2752
15 Ga0070666_10046651 3300005335 Bacteria 2907
16 Ga0070666_10370214 3300005335 Bacteria 1027
17 Ga0068868_100127781 3300005338 Bacteria 2078
18 Ga0068868_100526287 3300005338 Bacteria 1039
19 Ga0070660_100014971 3300005339 Bacteria 5594
20 Ga0070668_100022074 3300005347 Bacteria 4811
21 Ga0070669_100049414 3300005353 Bacteria 3070
22 Ga0070675_100083810 3300005354 Bacteria 2661
23 Ga0070675_100295293 3300005354 Bacteria 1427
24 Ga0070671_100003010 3300005355 Bacteria 13126
25 Ga0070671_100034780 3300005355 Bacteria 4172
26 Ga0070671_100447064 3300005355 Bacteria 1109
27 Ga0070671_100885378 3300005355 Bacteria 779
28 Ga0070674_100006525 3300005356 Bacteria 6813
29 Ga0070674_100095605 3300005356 Bacteria 2154
30 Ga0070674_100211171 3300005356 Unclassified 1504
31 Ga0070673_100029540 3300005364 Bacteria 4089
32 Ga0070673_100433071 3300005364 Bacteria 1181
33 Ga0070673_100835695 3300005364 Bacteria 852
34 Ga0070659_100405253 3300005366 Bacteria 1152
35 Ga0070667_100095330 3300005367 Bacteria 2565
36 Ga0070710_10068128 3300005437 Bacteria 2044
37 Ga0070710_10286161 3300005437 Bacteria 1071
38 Ga0070663_100305048 3300005455 Bacteria 1276
39 Ga0070678_100008316 3300005456 Bacteria 6213
40 Ga0070678_100022085 3300005456 Bacteria 4207
41 Ga0070678_100083028 3300005456 Bacteria 2434
42 Ga0070662_100014847 3300005457 Bacteria 5207
43 Ga0070662_100045745 3300005457 Bacteria 3142
44 Ga0068867_100006148 3300005459 Bacteria 8500
45 Ga0068867_100071029 3300005459 Bacteria 2603
46 Ga0070685_10406676 3300005466 Bacteria 944
47 Ga0070706_100184999 3300005467 Bacteria 1946
48 Ga0070707_100002795 3300005468 Bacteria 16613
49 Ga0070679_100013390 3300005530 Bacteria 7854
50 Ga0070679_100639974 3300005530 Bacteria 1006
51 Ga0070684_100699660 3300005535 Unclassified 945
52 Ga0070672_100006281 3300005543 Bacteria 7965
53 Ga0070672_100036120 3300005543 Bacteria 3762
54 Ga0070672_100156542 3300005543 Bacteria 1887
55 Ga0070672_100496417 3300005543 Bacteria 1055
56 Ga0070672_100910219 3300005543 Bacteria 777
57 Ga0070686_100362148 3300005544 Bacteria 1093
58 Ga0070665_101259839 3300005548 Bacteria 750
59 Ga0070664_100120530 3300005564 Bacteria 2296
60 Ga0070664_100241447 3300005564 Bacteria 1622
61 Ga0068856_100005849 3300005614 Bacteria 12119
62 Ga0068852_100107540 3300005616 Bacteria 2530
63 Ga0068852_100123997 3300005616 Bacteria 2369
64 Ga0068852_100257485 3300005616 Bacteria 1674
65 Ga0068852_100393101 3300005616 Bacteria 1362
66 Ga0068852_100523070 3300005616 Bacteria 1184
67 Ga0068852_100596394 3300005616 Bacteria 1109
68 Ga0068866_10024865 3300005718 Bacteria 2808
69 Ga0068861_100006344 3300005719 Bacteria 8052
70 Ga0068870_10263461 3300005840 Bacteria 1074
71 Ga0068870_10326016 3300005840 Bacteria 977
72 Ga0068863_100012567 3300005841 Bacteria 8169
73 Ga0068863_100085360 3300005841 Bacteria 2992
74 Ga0068863_100107608 3300005841 Bacteria 2654
75 Ga0068863_100351402 3300005841 Bacteria 1436
76 Ga0068863_100390578 3300005841 Bacteria 1360
77 Ga0068858_100141404 3300005842 Bacteria 2259
78 Ga0068860_100115581 3300005843 Bacteria 2566
79 Ga0070717_10510326 3300006028 Bacteria 1087
80 Ga0070717_10922860 3300006028 Bacteria 795
81 Ga0070715_10050962 3300006163 Bacteria 1779
82 Ga0070712_101093576 3300006175 Bacteria 692
83 Ga0097621_100039161 3300006237 Bacteria 3806
84 Ga0097621_100866425 3300006237 Bacteria 840
85 Ga0068871_100014841 3300006358 Bacteria 5819
86 Ga0075431_100751959 3300006847 Bacteria 950
87 Ga0075433_10095535 3300006852 Bacteria 2630
88 Ga0075434_100022754 3300006871 Bacteria 6104
89 Ga0075429_100192773 3300006880 Unclassified 1785
90 Ga0075436_100146580 3300006914 Bacteria 1660
91 Ga0075435_100074140 3300007076 Bacteria 2783
92 Ga0105240_10022663 3300009093 Bacteria 8320
93 Ga0105240_10022917 3300009093 Bacteria 8272
94 Ga0105240_10202368 3300009093 Bacteria 2326
95 Ga0111539_10166483 3300009094 Unclassified 2577
96 Ga0111539_10570910 3300009094 Bacteria 1317
97 Ga0114129_10164445 3300009147 Bacteria 3029
98 Ga0114129_11983350 3300009147 Unclassified 704
99 Ga0105243_10013921 3300009148 Bacteria 6087
100 Ga0105243_10217114 3300009148 Unclassified 1688
101 Ga0105243_11544577 3300009148 Bacteria 689
102 Ga0105242_10251153 3300009176 Unclassified 1594
103 Ga0105248_10020915 3300009177 Bacteria 7252
104 Ga0105248_10037848 3300009177 Bacteria 5398
105 Ga0105248_10166594 3300009177 Bacteria 2484
106 Ga0105248_10246339 3300009177 Bacteria 2012
107 Ga0105248_10543480 3300009177 Bacteria 1311
108 Ga0105238_10046796 3300009551 Bacteria 4363
109 Ga0105249_10150102 3300009553 Bacteria 2243
110 Ga0105246_10292821 3300011119 Unclassified 1311
111 Ga0157371_10417693 3300013102 Bacteria 983
112 Ga0157370_10000337 3300013104 Bacteria 59072
113 Ga0157370_10243552 3300013104 Bacteria 1664
114 Ga0157370_10604747 3300013104 Bacteria 1004
115 Ga0157369_10006039 3300013105 Bacteria 14058
116 Ga0157374_10207599 3300013296 Bacteria 1920
117 Ga0163162_10299107 3300013306 Bacteria 1741
118 Ga0163162_10519766 3300013306 Bacteria 1320
119 Ga0157372_10047280 3300013307 Bacteria 4780
120 Ga0157372_10152041 3300013307 Bacteria 2672
121 Ga0157372_11190226 3300013307 Bacteria 881
122 Ga0157372_12094587 3300013307 Bacteria 650
123 Ga0157375_10018704 3300013308 Bacteria 6288
124 Ga0163163_10699089 3300014325 Bacteria 1077
125 Ga0157380_10056477 3300014326 Bacteria 3122
126 Ga0182008_10230660 3300014497 Unclassified 950
127 Ga0157377_10672156 3300014745 Bacteria 748
128 Ga0157379_10034653 3300014968 Bacteria 4501
129 Ga0157379_10173125 3300014968 Bacteria 1949
130 Ga0157376_10364595 3300014969 Bacteria 1387
131 Ga0157376_11173014 3300014969 Bacteria 796
132 Ga0163161_10046302 3300017792 Bacteria 3138
133 Ga0163161_10116412 3300017792 Bacteria 2004
134 Ga0213876_10579916 3300021384 Unclassified 597
135 Ga0213875_10131099 3300021388 Bacteria 1172
136 Ga0207427_101283 3300025231 Bacteria 9556
137 Ga0209026_1001234 3300025250 Bacteria 11705
138 Ga0209148_1002141 3300025254 Bacteria 7357
139 Ga0209233_1000003 3300025261 Bacteria 1607366
140 Ga0207697_10017548 3300025315 Bacteria 2941
141 Ga0207682_10028826 3300025893 Unclassified 2217
142 Ga0207682_10031942 3300025893 Bacteria 2115
143 Ga0207682_10048710 3300025893 Bacteria 1747
144 Ga0207642_10120970 3300025899 Bacteria 1350
145 Ga0207688_10176308 3300025901 Bacteria 1273
146 Ga0207680_10035672 3300025903 Bacteria 2857
147 Ga0207680_10515577 3300025903 Bacteria 852
148 Ga0207645_10007230 3300025907 Bacteria 7862
149 Ga0207705_10000468 3300025909 Bacteria 34564
150 Ga0207705_10150374 3300025909 Bacteria 1744
151 Ga0207684_10013500 3300025910 Bacteria 7064
152 Ga0207707_10150472 3300025912 Bacteria 2035
153 Ga0207695_10005032 3300025913 Bacteria 17749
154 Ga0207695_10020959 3300025913 Bacteria 7469
155 Ga0207695_10179077 3300025913 Bacteria 2041
156 Ga0207693_10437461 3300025915 Bacteria 1022
157 Ga0207693_10455050 3300025915 Bacteria 1000
158 Ga0207660_10004706 3300025917 Bacteria 8884
159 Ga0207662_10033195 3300025918 Bacteria 3007
160 Ga0207657_10447061 3300025919 Bacteria 1014
161 Ga0207649_10152278 3300025920 Bacteria 1594
162 Ga0207652_10008104 3300025921 Bacteria 8435
163 Ga0207646_10004537 3300025922 Bacteria 15037
164 Ga0207681_10031380 3300025923 Bacteria 3469
165 Ga0207694_10027628 3300025924 Bacteria 4322
166 Ga0207650_10039370 3300025925 Bacteria 3455
167 Ga0207650_10078231 3300025925 Bacteria 2502
168 Ga0207659_10074157 3300025926 Bacteria 2494
169 Ga0207644_10000924 3300025931 Bacteria 18658
170 Ga0207644_10309419 3300025931 Bacteria 1275
171 Ga0207690_10426607 3300025932 Bacteria 1062
172 Ga0207706_10023020 3300025933 Bacteria 5595
173 Ga0207706_10024737 3300025933 Bacteria 5382
174 Ga0207706_10087163 3300025933 Bacteria 2745
175 Ga0207706_10206345 3300025933 Unclassified 1723
176 Ga0207706_11038812 3300025933 Bacteria 687
177 Ga0207686_10034620 3300025934 Bacteria 3024
178 Ga0207686_10308050 3300025934 Unclassified 1178
179 Ga0207709_10370578 3300025935 Bacteria 1087
180 Ga0207709_10453570 3300025935 Bacteria 992
181 Ga0207669_10051810 3300025937 Bacteria 2461
182 Ga0207669_10069969 3300025937 Bacteria 2198
183 Ga0207669_10250518 3300025937 Unclassified 1318
184 Ga0207691_10009010 3300025940 Bacteria 9567
185 Ga0207691_10180073 3300025940 Bacteria 1847
186 Ga0207691_10320322 3300025940 Bacteria 1329
187 Ga0207691_10464376 3300025940 Unclassified 1077
188 Ga0207711_10006498 3300025941 Bacteria 9843
189 Ga0207711_10279749 3300025941 Bacteria 1536
190 Ga0207711_10352309 3300025941 Bacteria 1363
191 Ga0207689_10010903 3300025942 Bacteria 7817
192 Ga0207689_11141463 3300025942 Bacteria 656
193 Ga0207661_10082139 3300025944 Bacteria 2664
194 Ga0207679_10061475 3300025945 Bacteria 2796
195 Ga0207679_10065832 3300025945 Bacteria 2713
196 Ga0207679_10078829 3300025945 Bacteria 2510
197 Ga0207679_11390785 3300025945 Bacteria 644
198 Ga0207651_10255078 3300025960 Bacteria 1437
199 Ga0207651_10326410 3300025960 Bacteria 1284
200 Ga0207712_10083704 3300025961 Bacteria 2329
201 Ga0207640_10024092 3300025981 Bacteria 3667
202 Ga0207640_10082779 3300025981 Bacteria 2198
203 Ga0207658_10046304 3300025986 Bacteria 3175
204 Ga0207677_10031178 3300026023 Bacteria 3412
205 Ga0207678_10136753 3300026067 Bacteria 2091
206 Ga0207678_10167606 3300026067 Bacteria 1875
207 Ga0207708_10077923 3300026075 Bacteria 2544
208 Ga0207702_10001659 3300026078 Bacteria 21993
209 Ga0207702_10191712 3300026078 Bacteria 1889
210 Ga0207641_10064092 3300026088 Bacteria 3140
211 Ga0207641_10071048 3300026088 Bacteria 2993
212 Ga0207641_10082376 3300026088 Bacteria 2795
213 Ga0207648_10028086 3300026089 Bacteria 4990
214 Ga0207648_10898014 3300026089 Bacteria 828
215 Ga0207676_10068650 3300026095 Bacteria 2836
216 Ga0207675_100018653 3300026118 Bacteria 6476
217 Ga0207683_10023899 3300026121 Bacteria 5258
218 Ga0207683_10036438 3300026121 Bacteria 4283
219 Ga0207683_10166100 3300026121 Bacteria 1997
220 Ga0207683_10253249 3300026121 Bacteria 1607
221 Ga0207698_10024820 3300026142 Bacteria 4213
222 Ga0207698_10193213 3300026142 Bacteria 1815
223 Ga0207698_10529324 3300026142 Bacteria 1151
224 Ga0207698_11183801 3300026142 Bacteria 778
225 Ga0268266_11287981 3300028379 Bacteria 706
226 Ga0268264_10270526 3300028381 Bacteria 1587
227 Ga0265338_10580121 3300028800 Unclassified 782
228 Ga0307408_100627470 3300031548 Bacteria 958
229 Ga0307413_10275969 3300031824 Bacteria 1261
230 Ga0307406_10456142 3300031901 Bacteria 1027
231 Ga0307407_10786739 3300031903 Bacteria 723
232 Ga0307409_100020319 3300031995 Bacteria 4523
233 Ga0307416_100003439 3300032002 Bacteria 9300
234 Ga0307416_100015810 3300032002 Bacteria 5224
235 Ga0307411_10261005 3300032005 Bacteria 1368
236 Ga0307415_100003110 3300032126 Bacteria 8397
237 Ga0373923_0017805 3300035111 Bacteria 2723
238 Ga0373943_0174527 3300035170 Bacteria 1178
239 Ga0373955_0164070 3300035172 Bacteria 1313
240 Ga0373924_0089656 3300035410 Bacteria 1315
241 Ga0373927_0158678 3300035695 Bacteria 1482
242 Ga0373937_0062441 3300036401 Bacteria 3425
243 Ga0373925_0261494 3300037068 Bacteria 1390
244 Ga0373925_0336768 3300037068 Bacteria 1223
245 Ga0395899_0001608 3300037312 Bacteria 18926
246 Ga0395900_0268864 3300037418 Bacteria 1700
247 Ga0436364_0974795 3300037853 Bacteria 3382
248 Ga0436363_0123740 3300039450 Bacteria 1182
249 Ga0436363_0216525 3300039450 Bacteria 674
250 Ga0436363_0399039 3300039450 Bacteria 1855
251 Ga0436362_0277821 3300039453 Bacteria 684
252 Ga0436362_0657264 3300039453 Unclassified 1914
253 Ga0451807_2466989 3300041486 Bacteria 803
254 Ga0451853_3149720 3300041512 Bacteria 1610
255 Ga0439437_014059 3300042000 Unclassified 934
256 Ga0439464_0001408 3300042439 Bacteria 5649
257 Ga0439460_0082368 3300042461 Bacteria 1012
258 Ga0466966_0217902 3300044684 Unclassified 1153
259 Ga0466961_0021533 3300044693 Bacteria 4148
260 Ga0466961_0043690 3300044693 Bacteria 2869
261 Ga0466961_0065229 3300044693 Bacteria 2314
262 Ga0466963_0004126 3300044694 Bacteria 8402
263 Ga0466963_0010335 3300044694 Bacteria 5650
264 Ga0466963_0228761 3300044694 Bacteria 1303
265 Ga0466963_0257967 3300044694 Bacteria 1224
266 Ga0466963_0453202 3300044694 Bacteria 905
267 Ga0466971_0003292 3300044719 Bacteria 6895
268 Ga0466970_0134391 3300044765 Bacteria 1360
269 Ga0466957_0009462 3300044842 Bacteria 5564
270 Ga0466957_0061414 3300044842 Bacteria 2306
271 Ga0466957_0526738 3300044842 Bacteria 822
272 Ga0466960_0228200 3300044901 Bacteria 1027
273 Ga0466959_0743804 3300045049 Unclassified 656
274 Ga0466958_0005415 3300045836 Bacteria 6865
275 Ga0466958_0897990 3300045836 Bacteria 578
276 Ga0466967_0016672 3300045976 Bacteria 5802
277 Ga0466967_0341913 3300045976 Bacteria 1447
278 Ga0466967_0557356 3300045976 Bacteria 1128
279 Ga0495585_0130197 3300046492 Bacteria 1325
280 Ga0495667_0238064 3300046559 Bacteria 1160
281 Ga0495658_0233251 3300046683 Bacteria 1154
282 Ga0495658_0367564 3300046683 Bacteria 915
283 Ga0495613_0112709 3300046689 Bacteria 1959
284 Ga0495604_0835179 3300047317 Bacteria 579
285 Ga0495684_0089858 3300047471 Bacteria 2327
286 Ga0495686_0000177 3300047472 Bacteria 121808
287 Ga0496105_0177275 3300048908 Bacteria 1746
288 Ga0496110_0144547 3300048913 Bacteria 2151
289 Ga0496113_0648966 3300048916 Bacteria 844
290 Ga0496114_0034840 3300048917 Bacteria 4155
291 Ga0496119_0020381 3300048922 Bacteria 4840
292 Ga0501249_043118 3300049679 Bacteria 1026
293 nmdc:mga05p37_120669_c1 3300050507 Bacteria 3221
294 nmdc:mga09592_1009247_c1 3300050508 Bacteria 695
295 nmdc:mga08y16_333384_c1 3300050511 Unclassified 1560
296 nmdc:mga0n895_457684_c1 3300050512 Bacteria 1288
297 nmdc:mga0rr50_80596_c1 3300050513 Bacteria 2510
298 nmdc:mga08x19_143082_c1 3300050514 Bacteria 1616
299 nmdc:mga0a205_278385_c1 3300050515 Unclassified 1549
300 Ga0495601_0046259 3300053077 Bacteria 2739
301 Ga0500635_0000174 3300053080 Bacteria 33055
302 Ga0495619_0014176 3300053085 Bacteria 5034
303 Ga0500607_083774 3300053121 Bacteria 1620
304 Ga0500559_0029304 3300053136 Bacteria 2356
305 Ga0500636_0056640 3300053177 Bacteria 2295
306 Ga0500637_0030488 3300053178 Bacteria 3001
307 Ga0466962_0003901 3300061719 Bacteria 7127
308 Ga0466962_0531702 3300061719 Bacteria 596
309 Ga0436364_1168689
310 JGI25164J39214_1009673
311 JGI25165J46597_1000187
312 Ga0055542_1002874
313 Ga0070658_10061969
314 Ga0070658_10088642
315 Ga0070676_10035281
316 Ga0070690_100048866
317 Ga0070670_100124166
318 Ga0070670_100466984
319 Ga0070670_100532814
320 Ga0070670_100543028
321 Ga0070677_10008136
322 Ga0068869_100061605
323 Ga0070666_10046651
324 Ga0070666_10370214
325 Ga0068868_100127781
326 Ga0068868_100526287
327 Ga0070660_100014971
328 Ga0070668_100022074
329 Ga0070669_100049414
330 Ga0070675_100083810
331 Ga0070675_100295293
332 Ga0070671_100003010
333 Ga0070671_100034780
334 Ga0070671_100447064
335 Ga0070671_100885378
336 Ga0070674_100006525
337 Ga0070674_100095605
338 Ga0070674_100211171
339 Ga0070673_100029540
340 Ga0070673_100433071
341 Ga0070673_100835695
342 Ga0070659_100405253
343 Ga0070667_100095330
344 Ga0070710_10068128
345 Ga0070710_10286161
346 Ga0070663_100305048
347 Ga0070678_100008316
348 Ga0070678_100022085
349 Ga0070678_100083028
350 Ga0070662_100014847
351 Ga0070662_100045745
352 Ga0068867_100006148
353 Ga0068867_100071029
354 Ga0070685_10406676
355 Ga0070706_100184999
356 Ga0070707_100002795
357 Ga0070679_100013390
358 Ga0070679_100639974
359 Ga0070684_100699660
360 Ga0070672_100006281
361 Ga0070672_100036120
362 Ga0070672_100156542
363 Ga0070672_100496417
364 Ga0070672_100910219
365 Ga0070686_100362148
366 Ga0070665_101259839
367 Ga0070664_100120530
368 Ga0070664_100241447
369 Ga0068856_100005849
370 Ga0068852_100107540
371 Ga0068852_100123997
372 Ga0068852_100257485
373 Ga0068852_100393101
374 Ga0068852_100523070
375 Ga0068852_100596394
376 Ga0068866_10024865
377 Ga0068861_100006344
378 Ga0068870_10263461
379 Ga0068870_10326016
380 Ga0068863_100012567
381 Ga0068863_100085360
382 Ga0068863_100107608
383 Ga0068863_100351402
384 Ga0068863_100390578
385 Ga0068858_100141404
386 Ga0068860_100115581
387 Ga0070717_10510326
388 Ga0070717_10922860
389 Ga0070715_10050962
390 Ga0070712_101093576
391 Ga0097621_100039161
392 Ga0097621_100866425
393 Ga0068871_100014841
394 Ga0075431_100751959
395 Ga0075433_10095535
396 Ga0075434_100022754
397 Ga0075429_100192773
398 Ga0075436_100146580
399 Ga0075435_100074140
400 Ga0105240_10022663
401 Ga0105240_10022917
402 Ga0105240_10202368
403 Ga0111539_10166483
404 Ga0111539_10570910
405 Ga0114129_10164445
406 Ga0114129_11983350
407 Ga0105243_10013921
408 Ga0105243_10217114
409 Ga0105243_11544577
410 Ga0105242_10251153
411 Ga0105248_10020915
412 Ga0105248_10037848
413 Ga0105248_10166594
414 Ga0105248_10246339
415 Ga0105248_10543480
416 Ga0105238_10046796
417 Ga0105249_10150102
418 Ga0105246_10292821
419 Ga0157371_10417693
420 Ga0157370_10000337
421 Ga0157370_10243552
422 Ga0157370_10604747
423 Ga0157369_10006039
424 Ga0157374_10207599
425 Ga0163162_10299107
426 Ga0163162_10519766
427 Ga0157372_10047280
428 Ga0157372_10152041
429 Ga0157372_11190226
430 Ga0157372_12094587
431 Ga0157375_10018704
432 Ga0163163_10699089
433 Ga0157380_10056477
434 Ga0182008_10230660
435 Ga0157377_10672156
436 Ga0157379_10034653
437 Ga0157379_10173125
438 Ga0157376_10364595
439 Ga0157376_11173014
440 Ga0163161_10046302
441 Ga0163161_10116412
442 Ga0213876_10579916
443 Ga0213875_10131099
444 Ga0207427_101283
445 Ga0209026_1001234
446 Ga0209148_1002141
447 Ga0209233_1000003
448 Ga0207697_10017548
449 Ga0207682_10028826
450 Ga0207682_10031942
451 Ga0207682_10048710
452 Ga0207642_10120970
453 Ga0207688_10176308
454 Ga0207680_10035672
455 Ga0207680_10515577
456 Ga0207645_10007230
457 Ga0207705_10000468
458 Ga0207705_10150374
459 Ga0207684_10013500
460 Ga0207707_10150472
461 Ga0207695_10005032
462 Ga0207695_10020959
463 Ga0207695_10179077
464 Ga0207693_10437461
465 Ga0207693_10455050
466 Ga0207660_10004706
467 Ga0207662_10033195
468 Ga0207657_10447061
469 Ga0207649_10152278
470 Ga0207652_10008104
471 Ga0207646_10004537
472 Ga0207681_10031380
473 Ga0207694_10027628
474 Ga0207650_10039370
475 Ga0207650_10078231
476 Ga0207659_10074157
477 Ga0207644_10000924
478 Ga0207644_10309419
479 Ga0207690_10426607
480 Ga0207706_10023020
481 Ga0207706_10024737
482 Ga0207706_10087163
483 Ga0207706_10206345
484 Ga0207706_11038812
485 Ga0207686_10034620
486 Ga0207686_10308050
487 Ga0207709_10370578
488 Ga0207709_10453570
489 Ga0207669_10051810
490 Ga0207669_10069969
491 Ga0207669_10250518
492 Ga0207691_10009010
493 Ga0207691_10180073
494 Ga0207691_10320322
495 Ga0207691_10464376
496 Ga0207711_10006498
497 Ga0207711_10279749
498 Ga0207711_10352309
499 Ga0207689_10010903
500 Ga0207689_11141463
501 Ga0207661_10082139
502 Ga0207679_10061475
503 Ga0207679_10065832
504 Ga0207679_10078829
505 Ga0207679_11390785
506 Ga0207651_10255078
507 Ga0207651_10326410
508 Ga0207712_10083704
509 Ga0207640_10024092
510 Ga0207640_10082779
511 Ga0207658_10046304
512 Ga0207677_10031178
513 Ga0207678_10136753
514 Ga0207678_10167606
515 Ga0207708_10077923
516 Ga0207702_10001659
517 Ga0207702_10191712
518 Ga0207641_10064092
519 Ga0207641_10071048
520 Ga0207641_10082376
521 Ga0207648_10028086
522 Ga0207648_10898014
523 Ga0207676_10068650
524 Ga0207675_100018653
525 Ga0207683_10023899
526 Ga0207683_10036438
527 Ga0207683_10166100
528 Ga0207683_10253249
529 Ga0207698_10024820
530 Ga0207698_10193213
531 Ga0207698_10529324
532 Ga0207698_11183801
533 Ga0268266_11287981
534 Ga0268264_10270526
535 Ga0265338_10580121
536 Ga0307408_100627470
537 Ga0307413_10275969
538 Ga0307406_10456142
539 Ga0307407_10786739
540 Ga0307409_100020319
541 Ga0307416_100003439
542 Ga0307416_100015810
543 Ga0307411_10261005
544 Ga0307415_100003110
545 Ga0373923_0017805
546 Ga0373943_0174527
547 Ga0373955_0164070
548 Ga0373924_0089656
549 Ga0373927_0158678
550 Ga0373937_0062441
551 Ga0373925_0261494
552 Ga0373925_0336768
553 Ga0395899_0001608
554 Ga0395900_0268864
555 Ga0436364_0974795
556 Ga0436363_0123740
557 Ga0436363_0216525
558 Ga0436363_0399039
559 Ga0436362_0277821
560 Ga0436362_0657264
561 Ga0451807_2466989
562 Ga0451853_3149720
563 Ga0439437_014059
564 Ga0439464_0001408
565 Ga0439460_0082368
566 Ga0466966_0217902
567 Ga0466961_0021533
568 Ga0466961_0043690
569 Ga0466961_0065229
570 Ga0466963_0004126
571 Ga0466963_0010335
572 Ga0466963_0228761
573 Ga0466963_0257967
574 Ga0466963_0453202
575 Ga0466971_0003292
576 Ga0466970_0134391
577 Ga0466957_0009462
578 Ga0466957_0061414
579 Ga0466957_0526738
580 Ga0466960_0228200
581 Ga0466959_0743804
582 Ga0466958_0005415
583 Ga0466958_0897990
584 Ga0466967_0016672
585 Ga0466967_0341913
586 Ga0466967_0557356
587 Ga0495585_0130197
588 Ga0495667_0238064
589 Ga0495658_0233251
590 Ga0495658_0367564
591 Ga0495613_0112709
592 Ga0495604_0835179
593 Ga0495684_0089858
594 Ga0495686_0000177
595 Ga0496105_0177275
596 Ga0496110_0144547
597 Ga0496113_0648966
598 Ga0496114_0034840
599 Ga0496119_0020381
600 Ga0501249_043118
601 nmdc:mga05p37_120669_c1
602 nmdc:mga09592_1009247_c1
603 nmdc:mga08y16_333384_c1
604 nmdc:mga0n895_457684_c1
605 nmdc:mga0rr50_80596_c1
606 nmdc:mga08x19_143082_c1
607 nmdc:mga0a205_278385_c1
608 Ga0495601_0046259
609 Ga0500635_0000174
610 Ga0495619_0014176
611 Ga0500607_083774
612 Ga0500559_0029304
613 Ga0500636_0056640
614 Ga0500637_0030488
615 Ga0466962_0003901
616 Ga0466962_0531702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

18

128

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.8546 1 149
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7409 1 149
6dg5-assembly1.cif.gz_A structure of a de novo designed interleukin-2/interleukin-15 mimetic complex with il-2rb and il-2rg 0.6609 4 118
6y07-assembly1.cif.gz_A designing a granulopoietic protein by topological rescaffolding 1: sohair 0.6376 3 118
7y5e-assembly1.cif.gz_QL in situ single-pbs-psii-psi-lhcs megacomplex. 0.6354 4 118
ID Description Score Start End Superfamily
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9376 2 148 1.20.120.520
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.9004 2 148 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8671 1 147 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8565 1 147 1.20.120.520
af_A0A1D6G2I2_110_215_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8537 77 145 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A525JSK8-F1-model_v4 Hemerythrin domain-containing protein 0.9991 1 169
AF-A0A2X1BCL3-F1-model_v4 Uncharacterized conserved protein 0.9941 1 145
AF-A0A519QDC4-F1-model_v4 Cation-binding protein 0.9908 34 169
AF-A0A525JSK8-F1-model_v4 Hemerythrin domain-containing protein 0.9874 1 169
AF-A0A543MBI7-F1-model_v4 deleted 0.9834 1 169

Map