F399683

General Info

Members Datasets Scaffolds Average Seq Length
308 187 616 255

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10281618|Ga0157378_102816182
Length 280
Sequence MQAKKLLSLAKAGTCADNLRILITMLGNKVALVTGGATGIGRAIAIELAKNGARVAIASRSLSRIKSTADELRSAGFSALGVQMDVRKKRDVEAGIAAIVSEWGALHILVNNAGISGLSLMTDADDSKWFDIIDTNLNGLYLVTKAALRQMADGAGRVINIASVLGKFGVPGYTAYCATKHGMIGFSRALALEVVDRGITVNTICPGWVETEMATLGISESAALQGITPEEFKARAIAAVPIKRFLQAEEVAALVAYIASEAAAGITGQAINICGGQIMN

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
164 2519899620 Rhizobium sp. Pop5 Isolate Nodule
165 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
166 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
167 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
168 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
169 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
170 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
171 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
172 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
173 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
174 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
175 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
176 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
177 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
178 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
179 2838061910 Rhizobium phaseoli L15 Isolate Nodule
180 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
181 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
182 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
183 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
184 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
185 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
186 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
187 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.88
Metatranscriptomes 0
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 7.47
Rhizoplane 1.95
Rhizosphere 89.94
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10281618 3300013297 Bacteria 1603
2 Ga0065712_10013188 3300005290 Unclassified 4023
3 Ga0065715_10000578 3300005293 Bacteria 14761
4 Ga0065707_10099340 3300005295 Bacteria 3014
5 Ga0065707_10151995 3300005295 Bacteria 1648
6 Ga0065707_10256678 3300005295 Bacteria 1109
7 Ga0070676_10011193 3300005328 Bacteria 4876
8 Ga0070690_100002949 3300005330 Bacteria 9198
9 Ga0070670_100002195 3300005331 Bacteria 16044
10 Ga0070666_10377788 3300005335 Bacteria 1017
11 Ga0070680_100006187 3300005336 Bacteria 9078
12 Ga0070680_100109030 3300005336 Bacteria 2303
13 Ga0070682_100199913 3300005337 Bacteria 1409
14 Ga0068868_100006806 3300005338 Bacteria 8117
15 Ga0070660_100137328 3300005339 Bacteria 1959
16 Ga0070660_100496128 3300005339 Bacteria 1015
17 Ga0070691_10031633 3300005341 Bacteria 2483
18 Ga0070661_100007745 3300005344 Bacteria 7413
19 Ga0070692_10001397 3300005345 Bacteria 8741
20 Ga0070668_100077973 3300005347 Bacteria 2590
21 Ga0070668_100117101 3300005347 Bacteria 2125
22 Ga0070668_100201899 3300005347 Bacteria 1632
23 Ga0070669_100016366 3300005353 Bacteria 5290
24 Ga0070669_100072718 3300005353 Bacteria 2546
25 Ga0070669_100141784 3300005353 Bacteria 1853
26 Ga0070675_100057862 3300005354 Bacteria 3196
27 Ga0070675_100475657 3300005354 Bacteria 1123
28 Ga0070671_100264664 3300005355 Bacteria 1461
29 Ga0070674_100009485 3300005356 Bacteria 5827
30 Ga0070674_100049209 3300005356 Bacteria 2897
31 Ga0070673_100009976 3300005364 Bacteria 6404
32 Ga0070659_100263094 3300005366 Bacteria 1431
33 Ga0070711_100130324 3300005439 Unclassified 1872
34 Ga0070711_100155391 3300005439 Bacteria 1729
35 Ga0070700_100012421 3300005441 Bacteria 4753
36 Ga0070700_100060086 3300005441 Bacteria 2395
37 Ga0070700_100092170 3300005441 Bacteria 1980
38 Ga0070700_100465307 3300005441 Bacteria 965
39 Ga0070694_100000241 3300005444 Bacteria 28813
40 Ga0070694_100045018 3300005444 Bacteria 2956
41 Ga0070663_100024688 3300005455 Bacteria 4049
42 Ga0070663_100206190 3300005455 Bacteria 1537
43 Ga0070678_100015809 3300005456 Bacteria 4807
44 Ga0070678_100263014 3300005456 Bacteria 1452
45 Ga0070662_100025204 3300005457 Bacteria 4104
46 Ga0070662_100100241 3300005457 Bacteria 2191
47 Ga0070662_100140228 3300005457 Bacteria 1872
48 Ga0070681_10038043 3300005458 Bacteria 4824
49 Ga0068867_100077365 3300005459 Bacteria 2500
50 Ga0070706_100033931 3300005467 Bacteria 4711
51 Ga0070707_100057431 3300005468 Bacteria 3733
52 Ga0070698_100013244 3300005471 Bacteria 8726
53 Ga0070698_100028767 3300005471 Bacteria 5769
54 Ga0070698_100150031 3300005471 Bacteria 2279
55 Ga0070698_100254066 3300005471 Bacteria 1690
56 Ga0070699_100000007 3300005518 Bacteria 310847
57 Ga0070699_100022336 3300005518 Bacteria 5452
58 Ga0070699_100583485 3300005518 Unclassified 1019
59 Ga0070679_100078618 3300005530 Bacteria 3287
60 Ga0070684_100302020 3300005535 Bacteria 1469
61 Ga0070697_100000090 3300005536 Bacteria 75895
62 Ga0070697_100012928 3300005536 Bacteria 6540
63 Ga0070697_100162625 3300005536 Unclassified 1886
64 Ga0070697_100176145 3300005536 Bacteria 1812
65 Ga0070697_100225967 3300005536 Bacteria 1596
66 Ga0070672_100005825 3300005543 Bacteria 8221
67 Ga0070686_100032826 3300005544 Unclassified 3186
68 Ga0070695_100007410 3300005545 Bacteria 6509
69 Ga0070696_100011759 3300005546 Bacteria 5866
70 Ga0070696_100027480 3300005546 Bacteria 3877
71 Ga0070693_100007961 3300005547 Bacteria 5202
72 Ga0070665_100627805 3300005548 Bacteria 1087
73 Ga0070704_100112276 3300005549 Bacteria 2076
74 Ga0070704_100400488 3300005549 Bacteria 1171
75 Ga0068855_100324010 3300005563 Bacteria 1702
76 Ga0070664_100024699 3300005564 Unclassified 4974
77 Ga0068857_100026601 3300005577 Bacteria 5100
78 Ga0068854_100049902 3300005578 Bacteria 2991
79 Ga0070702_100027465 3300005615 Bacteria 3071
80 Ga0068864_100082458 3300005618 Bacteria 2821
81 Ga0068861_100039244 3300005719 Bacteria 3532
82 Ga0068861_100697029 3300005719 Bacteria 943
83 Ga0068858_100237405 3300005842 Bacteria 1729
84 Ga0068862_100137121 3300005844 Bacteria 2169
85 Ga0097621_100132639 3300006237 Bacteria 2121
86 Ga0068871_100172710 3300006358 Bacteria 1854
87 Ga0075428_100003013 3300006844 Bacteria 18393
88 Ga0075428_100011793 3300006844 Bacteria 9729
89 Ga0075428_100012954 3300006844 Bacteria 9274
90 Ga0075428_100072675 3300006844 Bacteria 3757
91 Ga0075428_100524081 3300006844 Unclassified 1267
92 Ga0075428_100827123 3300006844 Unclassified 984
93 Ga0075430_100002680 3300006846 Bacteria 14865
94 Ga0075430_100008831 3300006846 Bacteria 8504
95 Ga0075430_100219571 3300006846 Bacteria 1577
96 Ga0075430_100385994 3300006846 Bacteria 1156
97 Ga0075431_100001134 3300006847 Bacteria 23893
98 Ga0075431_100082426 3300006847 Bacteria 3320
99 Ga0075431_100106267 3300006847 Bacteria 2896
100 Ga0075433_10007197 3300006852 Bacteria 8810
101 Ga0075433_10021299 3300006852 Bacteria 5435
102 Ga0075433_10054616 3300006852 Bacteria 3484
103 Ga0075433_10263303 3300006852 Bacteria 1528
104 Ga0075434_100016584 3300006871 Bacteria 7083
105 Ga0075434_100088518 3300006871 Bacteria 3097
106 Ga0075434_100115700 3300006871 Bacteria 2694
107 Ga0075434_100147165 3300006871 Bacteria 2376
108 Ga0075434_100236067 3300006871 Unclassified 1848
109 Ga0075434_100533048 3300006871 Archaea 1194
110 Ga0075429_100018034 3300006880 Bacteria 6105
111 Ga0075429_100041294 3300006880 Bacteria 4018
112 Ga0075429_100063084 3300006880 Bacteria 3228
113 Ga0075429_100200732 3300006880 Bacteria 1747
114 Ga0075429_100253241 3300006880 Bacteria 1542
115 Ga0068865_100132968 3300006881 Bacteria 1866
116 Ga0075435_100020054 3300007076 Bacteria 5112
117 Ga0075435_100026755 3300007076 Bacteria 4505
118 Ga0075435_100083724 3300007076 Bacteria 2623
119 Ga0075435_100376261 3300007076 Bacteria 1220
120 Ga0111539_10000027 3300009094 Bacteria 185408
121 Ga0111539_10000574 3300009094 Bacteria 47151
122 Ga0111539_10053753 3300009094 Bacteria 4794
123 Ga0111539_10126711 3300009094 Bacteria 2991
124 Ga0111539_10132570 3300009094 Bacteria 2918
125 Ga0111539_10173666 3300009094 Bacteria 2518
126 Ga0111539_10336468 3300009094 Bacteria 1757
127 Ga0111539_10433731 3300009094 Bacteria 1530
128 Ga0105245_10025610 3300009098 Bacteria 5188
129 Ga0114129_10004747 3300009147 Bacteria 19200
130 Ga0114129_10770731 3300009147 Bacteria 1230
131 Ga0105241_10006109 3300009174 Bacteria 8875
132 Ga0105242_10002971 3300009176 Bacteria 13272
133 Ga0105248_10112628 3300009177 Bacteria 3068
134 Ga0105248_10283618 3300009177 Bacteria 1865
135 Ga0105248_10775288 3300009177 Bacteria 1082
136 Ga0105237_10022632 3300009545 Bacteria 6446
137 Ga0105249_10328678 3300009553 Bacteria 1542
138 Ga0105239_10042757 3300010375 Bacteria 4965
139 Ga0105246_10053715 3300011119 Unclassified 2774
140 Ga0157374_10026679 3300013296 Bacteria 5201
141 Ga0163162_10023377 3300013306 Bacteria 6100
142 Ga0163162_10369704 3300013306 Bacteria 1567
143 Ga0163163_10385081 3300014325 Bacteria 1460
144 Ga0157380_10010657 3300014326 Bacteria 6619
145 Ga0157380_10063882 3300014326 Bacteria 2953
146 Ga0157376_10011271 3300014969 Bacteria 6582
147 Ga0157376_10022083 3300014969 Bacteria 4953
148 Ga0207697_10008565 3300025315 Bacteria 4467
149 Ga0207653_10025674 3300025885 Bacteria 1884
150 Ga0207688_10002977 3300025901 Bacteria 9227
151 Ga0207645_10004743 3300025907 Bacteria 10005
152 Ga0207645_10009307 3300025907 Bacteria 6803
153 Ga0207684_10005879 3300025910 Bacteria 11235
154 Ga0207684_10586617 3300025910 Bacteria 952
155 Ga0207654_10118570 3300025911 Bacteria 1658
156 Ga0207707_10052011 3300025912 Bacteria 3567
157 Ga0207663_10042213 3300025916 Bacteria 2785
158 Ga0207660_10012678 3300025917 Bacteria 5521
159 Ga0207660_10049015 3300025917 Bacteria 2991
160 Ga0207657_10001442 3300025919 Bacteria 25436
161 Ga0207649_10025814 3300025920 Bacteria 3430
162 Ga0207652_10009903 3300025921 Bacteria 7669
163 Ga0207646_10000525 3300025922 Bacteria 51066
164 Ga0207681_10087708 3300025923 Bacteria 2214
165 Ga0207681_10261487 3300025923 Bacteria 1355
166 Ga0207650_10002200 3300025925 Bacteria 13629
167 Ga0207687_10582157 3300025927 Bacteria 942
168 Ga0207690_10334672 3300025932 Bacteria 1193
169 Ga0207706_10002497 3300025933 Bacteria 17925
170 Ga0207706_10014616 3300025933 Bacteria 7108
171 Ga0207706_10087738 3300025933 Bacteria 2736
172 Ga0207686_10089039 3300025934 Bacteria 2034
173 Ga0207669_10014535 3300025937 Bacteria 3949
174 Ga0207669_10080875 3300025937 Bacteria 2079
175 Ga0207689_10005229 3300025942 Bacteria 11636
176 Ga0207679_10262029 3300025945 Bacteria 1475
177 Ga0207651_10079974 3300025960 Unclassified 2350
178 Ga0207668_10088410 3300025972 Unclassified 2269
179 Ga0207668_10201599 3300025972 Bacteria 1585
180 Ga0207640_10182554 3300025981 Bacteria 1574
181 Ga0207658_10017227 3300025986 Bacteria 4978
182 Ga0207677_10072323 3300026023 Bacteria 2437
183 Ga0207639_10074928 3300026041 Bacteria 2659
184 Ga0207678_10031543 3300026067 Bacteria 4623
185 Ga0207708_10004734 3300026075 Bacteria 10014
186 Ga0207708_10010943 3300026075 Bacteria 6747
187 Ga0207708_10064847 3300026075 Bacteria 2791
188 Ga0207708_10090020 3300026075 Bacteria 2365
189 Ga0207702_10114703 3300026078 Bacteria 2401
190 Ga0207648_10006273 3300026089 Bacteria 11834
191 Ga0207648_10070988 3300026089 Unclassified 3036
192 Ga0207648_10410287 3300026089 Bacteria 1228
193 Ga0207674_10046900 3300026116 Unclassified 4434
194 Ga0207675_100007109 3300026118 Bacteria 10579
195 Ga0207675_100236613 3300026118 Bacteria 1763
196 Ga0207683_10001386 3300026121 Bacteria 21849
197 Ga0207683_10136437 3300026121 Bacteria 2209
198 Ga0207428_10000135 3300027907 Bacteria 99170
199 Ga0207428_10004047 3300027907 Bacteria 14051
200 Ga0207428_10099145 3300027907 Bacteria 2253
201 Ga0207428_10103283 3300027907 Bacteria 2200
202 Ga0207428_10191995 3300027907 Bacteria 1539
203 Ga0268266_10739047 3300028379 Bacteria 949
204 Ga0268265_10531239 3300028380 Bacteria 1113
205 Ga0307408_100277067 3300031548 Bacteria 1395
206 Ga0316576_10124120 3300031727 Bacteria 1940
207 Ga0316577_10039226 3300031733 Bacteria 2650
208 Ga0307413_10093559 3300031824 Bacteria 1965
209 Ga0307413_10240755 3300031824 Unclassified 1336
210 Ga0307410_10078486 3300031852 Bacteria 2311
211 Ga0307412_10045979 3300031911 Bacteria 2857
212 Ga0307409_100084343 3300031995 Bacteria 2579
213 Ga0307409_100227578 3300031995 Bacteria 1688
214 Ga0307416_100640762 3300032002 Bacteria 1146
215 Ga0307416_100733907 3300032002 Bacteria 1079
216 Ga0307414_10027116 3300032004 Bacteria 3698
217 Ga0307411_10039831 3300032005 Bacteria 2976
218 Ga0307411_10336317 3300032005 Bacteria 1225
219 Ga0307415_100015135 3300032126 Bacteria 4558
220 Ga0373929_0074951 3300035085 Unclassified 815
221 Ga0373939_0084677 3300035114 Unclassified 1060
222 Ga0373931_0035331 3300035691 Bacteria 2598
223 Ga0373937_0032660 3300036401 Bacteria 4722
224 Ga0373937_0115996 3300036401 Bacteria 2494
225 Ga0373937_0133550 3300036401 Bacteria 2319
226 Ga0373937_0258832 3300036401 Bacteria 1641
227 Ga0316584_0064290 3300036712 Bacteria 2747
228 Ga0316584_0322070 3300036712 Bacteria 1115
229 Ga0439457_055910 3300042014 Bacteria 890
230 Ga0439460_0090994 3300042461 Unclassified 970
231 Ga0453683_0012177 3300044673 Bacteria 5643
232 Ga0451576_0350281 3300045051 Bacteria 1546
233 Ga0451576_0367667 3300045051 Bacteria 1506
234 Ga0495580_0002912 3300046472 Bacteria 14695
235 Ga0495618_0045765 3300046514 Bacteria 2761
236 Ga0495628_0031538 3300046516 Bacteria 4286
237 Ga0495640_0233468 3300046533 Bacteria 1156
238 Ga0495621_0008917 3300046539 Bacteria 3025
239 Ga0495613_0554303 3300046689 Bacteria 769
240 Ga0495684_0100781 3300047471 Bacteria 2184
241 Ga0496100_0033984 3300048903 Unclassified 3195
242 Ga0496104_0178315 3300048907 Bacteria 2035
243 Ga0496108_0055734 3300048911 Bacteria 3320
244 Ga0496112_0065161 3300048915 Bacteria 3595
245 Ga0496112_0158957 3300048915 Bacteria 2226
246 Ga0496113_0176501 3300048916 Bacteria 1693
247 Ga0501042_0083171 3300049578 Bacteria 2295
248 Ga0501071_0058192 3300049587 Bacteria 2794
249 Ga0501072_0060079 3300049588 Bacteria 2998
250 Ga0501073_0000363 3300049589 Bacteria 30504
251 Ga0501076_0114253 3300049592 Bacteria 2185
252 Ga0501076_0664026 3300049592 Unclassified 860
253 Ga0501079_0316356 3300049741 Unclassified 1222
254 nmdc:mga05p37_25382_c1 3300050507 Bacteria 7206
255 nmdc:mga05p37_736696_c1 3300050507 Bacteria 1089
256 nmdc:mga09592_36528_c1 3300050508 Bacteria 4115
257 nmdc:mga09592_527562_c1 3300050508 Bacteria 1015
258 nmdc:mga09592_65940_c1 3300050508 Bacteria 3068
259 nmdc:mga09592_8337_c1 3300050508 Bacteria 8425
260 nmdc:mga06r32_3584_c1 3300050510 Bacteria 13853
261 nmdc:mga06r32_85471_c1 3300050510 Bacteria 3076
262 nmdc:mga08y16_101090_c1 3300050511 Bacteria 3002
263 nmdc:mga08y16_1673_c1 3300050511 Bacteria 22480
264 nmdc:mga08y16_180478_c1 3300050511 Bacteria 2192
265 nmdc:mga08y16_67937_c1 3300050511 Bacteria 3717
266 nmdc:mga08y16_709_c1 3300050511 Bacteria 31626
267 nmdc:mga08y16_771514_c1 3300050511 Bacteria 956
268 nmdc:mga0n895_14364_c1 3300050512 Bacteria 7189
269 nmdc:mga0n895_174608_c1 3300050512 Unclassified 2180
270 nmdc:mga0n895_257823_c1 3300050512 Bacteria 1770
271 nmdc:mga0n895_403981_c1 3300050512 Bacteria 1381
272 nmdc:mga0n895_40621_c1 3300050512 Bacteria 4519
273 nmdc:mga0n895_89876_c1 3300050512 Bacteria 3072
274 nmdc:mga0rr50_201789_c1 3300050513 Bacteria 1634
275 nmdc:mga0rr50_394911_c1 3300050513 Bacteria 1168
276 nmdc:mga0rr50_40384_c1 3300050513 Bacteria 3392
277 nmdc:mga0rr50_427638_c1 3300050513 Bacteria 1121
278 nmdc:mga0rr50_5822_c1 3300050513 Bacteria 7407
279 nmdc:mga0rr50_9276_c1 3300050513 Bacteria 6178
280 nmdc:mga0rr50_94454_c1 3300050513 Bacteria 2335
281 nmdc:mga0a205_5244_c2 3300050515 Bacteria 8721
282 nmdc:mga0a205_7650_c1 3300050515 Bacteria 9799
283 Ga0530510_0282835 3300061734 Bacteria 1239
284 2509111963 2508501122 Bacteria 6292184
285 2520375490 2519899620 Bacteria 6499161
286 2524453470 2524023207 Bacteria 6813453
287 2719669010 2718217997 Bacteria 6740740
288 2720489704 2718218199 Bacteria 6740745
289 2720610436 2718218232 Bacteria 6720332
290 2720628980 2718218235 Bacteria 6630699
291 2720772971 2718218269 Bacteria 6906114
292 2723030391 2721755556 Bacteria 6745503
293 2723564753 2721755684 Bacteria 6859907
294 2723570274 2721755685 Bacteria 6704835
295 2724093000 2721755819 Bacteria 6906405
296 2724101821 2721755822 Bacteria 6726041
297 2724113376 2721755823 Bacteria 6752556
298 2730110924 2728369352 Bacteria 6745171
299 2838045422 2838042994 Bacteria 6046894
300 2838064505 2838061910 Bacteria 6794874
301 2842265622 2842264693 Bacteria 6472963
302 2842428328 2842428310 Bacteria 6767288
303 2842434942 2842434925 Bacteria 6502746
304 2842442196 2842441272 Bacteria 6769273
305 2842469274 2842469257 Bacteria 6752936
306 2857462993 2857460504 Bacteria 5194327
307 8005286011 8005282627 Bacteria 6675747
308 8005624460 8005619151 Bacteria 7030230
309 Ga0157378_10281618
310 Ga0065712_10013188
311 Ga0065715_10000578
312 Ga0065707_10099340
313 Ga0065707_10151995
314 Ga0065707_10256678
315 Ga0070676_10011193
316 Ga0070690_100002949
317 Ga0070670_100002195
318 Ga0070666_10377788
319 Ga0070680_100006187
320 Ga0070680_100109030
321 Ga0070682_100199913
322 Ga0068868_100006806
323 Ga0070660_100137328
324 Ga0070660_100496128
325 Ga0070691_10031633
326 Ga0070661_100007745
327 Ga0070692_10001397
328 Ga0070668_100077973
329 Ga0070668_100117101
330 Ga0070668_100201899
331 Ga0070669_100016366
332 Ga0070669_100072718
333 Ga0070669_100141784
334 Ga0070675_100057862
335 Ga0070675_100475657
336 Ga0070671_100264664
337 Ga0070674_100009485
338 Ga0070674_100049209
339 Ga0070673_100009976
340 Ga0070659_100263094
341 Ga0070711_100130324
342 Ga0070711_100155391
343 Ga0070700_100012421
344 Ga0070700_100060086
345 Ga0070700_100092170
346 Ga0070700_100465307
347 Ga0070694_100000241
348 Ga0070694_100045018
349 Ga0070663_100024688
350 Ga0070663_100206190
351 Ga0070678_100015809
352 Ga0070678_100263014
353 Ga0070662_100025204
354 Ga0070662_100100241
355 Ga0070662_100140228
356 Ga0070681_10038043
357 Ga0068867_100077365
358 Ga0070706_100033931
359 Ga0070707_100057431
360 Ga0070698_100013244
361 Ga0070698_100028767
362 Ga0070698_100150031
363 Ga0070698_100254066
364 Ga0070699_100000007
365 Ga0070699_100022336
366 Ga0070699_100583485
367 Ga0070679_100078618
368 Ga0070684_100302020
369 Ga0070697_100000090
370 Ga0070697_100012928
371 Ga0070697_100162625
372 Ga0070697_100176145
373 Ga0070697_100225967
374 Ga0070672_100005825
375 Ga0070686_100032826
376 Ga0070695_100007410
377 Ga0070696_100011759
378 Ga0070696_100027480
379 Ga0070693_100007961
380 Ga0070665_100627805
381 Ga0070704_100112276
382 Ga0070704_100400488
383 Ga0068855_100324010
384 Ga0070664_100024699
385 Ga0068857_100026601
386 Ga0068854_100049902
387 Ga0070702_100027465
388 Ga0068864_100082458
389 Ga0068861_100039244
390 Ga0068861_100697029
391 Ga0068858_100237405
392 Ga0068862_100137121
393 Ga0097621_100132639
394 Ga0068871_100172710
395 Ga0075428_100003013
396 Ga0075428_100011793
397 Ga0075428_100012954
398 Ga0075428_100072675
399 Ga0075428_100524081
400 Ga0075428_100827123
401 Ga0075430_100002680
402 Ga0075430_100008831
403 Ga0075430_100219571
404 Ga0075430_100385994
405 Ga0075431_100001134
406 Ga0075431_100082426
407 Ga0075431_100106267
408 Ga0075433_10007197
409 Ga0075433_10021299
410 Ga0075433_10054616
411 Ga0075433_10263303
412 Ga0075434_100016584
413 Ga0075434_100088518
414 Ga0075434_100115700
415 Ga0075434_100147165
416 Ga0075434_100236067
417 Ga0075434_100533048
418 Ga0075429_100018034
419 Ga0075429_100041294
420 Ga0075429_100063084
421 Ga0075429_100200732
422 Ga0075429_100253241
423 Ga0068865_100132968
424 Ga0075435_100020054
425 Ga0075435_100026755
426 Ga0075435_100083724
427 Ga0075435_100376261
428 Ga0111539_10000027
429 Ga0111539_10000574
430 Ga0111539_10053753
431 Ga0111539_10126711
432 Ga0111539_10132570
433 Ga0111539_10173666
434 Ga0111539_10336468
435 Ga0111539_10433731
436 Ga0105245_10025610
437 Ga0114129_10004747
438 Ga0114129_10770731
439 Ga0105241_10006109
440 Ga0105242_10002971
441 Ga0105248_10112628
442 Ga0105248_10283618
443 Ga0105248_10775288
444 Ga0105237_10022632
445 Ga0105249_10328678
446 Ga0105239_10042757
447 Ga0105246_10053715
448 Ga0157374_10026679
449 Ga0163162_10023377
450 Ga0163162_10369704
451 Ga0163163_10385081
452 Ga0157380_10010657
453 Ga0157380_10063882
454 Ga0157376_10011271
455 Ga0157376_10022083
456 Ga0207697_10008565
457 Ga0207653_10025674
458 Ga0207688_10002977
459 Ga0207645_10004743
460 Ga0207645_10009307
461 Ga0207684_10005879
462 Ga0207684_10586617
463 Ga0207654_10118570
464 Ga0207707_10052011
465 Ga0207663_10042213
466 Ga0207660_10012678
467 Ga0207660_10049015
468 Ga0207657_10001442
469 Ga0207649_10025814
470 Ga0207652_10009903
471 Ga0207646_10000525
472 Ga0207681_10087708
473 Ga0207681_10261487
474 Ga0207650_10002200
475 Ga0207687_10582157
476 Ga0207690_10334672
477 Ga0207706_10002497
478 Ga0207706_10014616
479 Ga0207706_10087738
480 Ga0207686_10089039
481 Ga0207669_10014535
482 Ga0207669_10080875
483 Ga0207689_10005229
484 Ga0207679_10262029
485 Ga0207651_10079974
486 Ga0207668_10088410
487 Ga0207668_10201599
488 Ga0207640_10182554
489 Ga0207658_10017227
490 Ga0207677_10072323
491 Ga0207639_10074928
492 Ga0207678_10031543
493 Ga0207708_10004734
494 Ga0207708_10010943
495 Ga0207708_10064847
496 Ga0207708_10090020
497 Ga0207702_10114703
498 Ga0207648_10006273
499 Ga0207648_10070988
500 Ga0207648_10410287
501 Ga0207674_10046900
502 Ga0207675_100007109
503 Ga0207675_100236613
504 Ga0207683_10001386
505 Ga0207683_10136437
506 Ga0207428_10000135
507 Ga0207428_10004047
508 Ga0207428_10099145
509 Ga0207428_10103283
510 Ga0207428_10191995
511 Ga0268266_10739047
512 Ga0268265_10531239
513 Ga0307408_100277067
514 Ga0316576_10124120
515 Ga0316577_10039226
516 Ga0307413_10093559
517 Ga0307413_10240755
518 Ga0307410_10078486
519 Ga0307412_10045979
520 Ga0307409_100084343
521 Ga0307409_100227578
522 Ga0307416_100640762
523 Ga0307416_100733907
524 Ga0307414_10027116
525 Ga0307411_10039831
526 Ga0307411_10336317
527 Ga0307415_100015135
528 Ga0373929_0074951
529 Ga0373939_0084677
530 Ga0373931_0035331
531 Ga0373937_0032660
532 Ga0373937_0115996
533 Ga0373937_0133550
534 Ga0373937_0258832
535 Ga0316584_0064290
536 Ga0316584_0322070
537 Ga0439457_055910
538 Ga0439460_0090994
539 Ga0453683_0012177
540 Ga0451576_0350281
541 Ga0451576_0367667
542 Ga0495580_0002912
543 Ga0495618_0045765
544 Ga0495628_0031538
545 Ga0495640_0233468
546 Ga0495621_0008917
547 Ga0495613_0554303
548 Ga0495684_0100781
549 Ga0496100_0033984
550 Ga0496104_0178315
551 Ga0496108_0055734
552 Ga0496112_0065161
553 Ga0496112_0158957
554 Ga0496113_0176501
555 Ga0501042_0083171
556 Ga0501071_0058192
557 Ga0501072_0060079
558 Ga0501073_0000363
559 Ga0501076_0114253
560 Ga0501076_0664026
561 Ga0501079_0316356
562 nmdc:mga05p37_25382_c1
563 nmdc:mga05p37_736696_c1
564 nmdc:mga09592_36528_c1
565 nmdc:mga09592_527562_c1
566 nmdc:mga09592_65940_c1
567 nmdc:mga09592_8337_c1
568 nmdc:mga06r32_3584_c1
569 nmdc:mga06r32_85471_c1
570 nmdc:mga08y16_101090_c1
571 nmdc:mga08y16_1673_c1
572 nmdc:mga08y16_180478_c1
573 nmdc:mga08y16_67937_c1
574 nmdc:mga08y16_709_c1
575 nmdc:mga08y16_771514_c1
576 nmdc:mga0n895_14364_c1
577 nmdc:mga0n895_174608_c1
578 nmdc:mga0n895_257823_c1
579 nmdc:mga0n895_403981_c1
580 nmdc:mga0n895_40621_c1
581 nmdc:mga0n895_89876_c1
582 nmdc:mga0rr50_201789_c1
583 nmdc:mga0rr50_394911_c1
584 nmdc:mga0rr50_40384_c1
585 nmdc:mga0rr50_427638_c1
586 nmdc:mga0rr50_5822_c1
587 nmdc:mga0rr50_9276_c1
588 nmdc:mga0rr50_94454_c1
589 nmdc:mga0a205_5244_c2
590 nmdc:mga0a205_7650_c1
591 Ga0530510_0282835
592 2509111963
593 2520375490
594 2524453470
595 2719669010
596 2720489704
597 2720610436
598 2720628980
599 2720772971
600 2723030391
601 2723564753
602 2723570274
603 2724093000
604 2724101821
605 2724113376
606 2730110924
607 2838045422
608 2838064505
609 2842265622
610 2842428328
611 2842434942
612 2842442196
613 2842469274
614 2857462993
615 8005286011
616 8005624460

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

29

220

0.99

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

35

277

0.94

PF08659

KR

KR domain

30

206

0.85

PF23441

23

279

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9658 2 254
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9646 2 254
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9617 2 254
6ihi-assembly1.cif.gz_B crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9613 2 254
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9611 2 254
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9675 2 85 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9618 2 181 3.40.50.720
1zemG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9572 2 250 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9564 1 187 3.40.50.720
1ulsC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9563 1 254 3.40.50.720
ID Description Score Start End GO Terms
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.9878 2 89
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9822 1 125 GO:0005829
GO:0009688
GO:0010301
AF-A0A7T6Z693-F1-model_v4 SDR family oxidoreductase 0.9734 2 254 GO:0016616
AF-A0A559M6V2-F1-model_v4 Putative oxidoreductase 0.9734 3 93 GO:0016491
AF-A0A3D0D231-F1-model_v4 SDR family oxidoreductase 0.972 2 254 GO:0016616

Map