F399594

General Info

Members Datasets Scaffolds Average Seq Length
308 154 308 389

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100021222|Ga0070697_1000212224
Length 412
Sequence VRFYGEALMFSRHVTKDISAYCHGELSSQQSKQFAEHIISCVRCRSRFEEIKLGIKFAEQLPQISAPDHLWSGLESLLDKQSGPQITQIRQVPASSWRMRVAAAXXXLLVVSLGVWWVYNKRPSAVLISENGKPYWQVIRLDGTPTIGKEGISNNGQLAVGEWLETDGKSKAQIAVSSIGSVDIDENTRVRLLETHATEHRLELARGKMSARIWAPPRLFFVDTPSAVAADLGCAYTLEVDDHGASKLQVTSGWVALELRDRESTVPAGASCETRPVVGPGTPYFDDSSNEFRAELNKVDFDPDAAARSAALKLMLDDARPKDTLTLWHLLTRVDGNDRVRVYEKMAALSPPPQGVTREGILQLNQTMLDGWRDELKLTWMGVGKGVPKPLAEAYWRAKNGVSRRLKEMAPK

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
140 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
146 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
147 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.97
Rhizosphere 98.7
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000006 3300002459 Bacteria 134556
2 JGI25406J46586_10001728 3300003203 Bacteria 10264
3 rootL2_10067334 3300003322 Bacteria 2560
4 Ga0065714_10064454 3300005288 Bacteria 72991
5 Ga0065712_10000129 3300005290 Bacteria 72972
6 Ga0065712_10072461 3300005290 Bacteria 4746
7 Ga0065715_10017966 3300005293 Bacteria 2735
8 Ga0065715_10092364 3300005293 Bacteria 5162
9 Ga0065715_10112763 3300005293 Bacteria 2501
10 Ga0065707_10001905 3300005295 Bacteria 8124
11 Ga0065707_10116128 3300005295 Bacteria 2247
12 Ga0070676_10024342 3300005328 Bacteria 3410
13 Ga0070690_100024380 3300005330 Bacteria 3719
14 Ga0070690_100034594 3300005330 Bacteria 3166
15 Ga0070670_100007756 3300005331 Bacteria 9130
16 Ga0070670_100125037 3300005331 Bacteria 2220
17 Ga0068869_100045857 3300005334 Bacteria 3149
18 Ga0068869_100118887 3300005334 Bacteria 2019
19 Ga0068869_100154195 3300005334 Bacteria 1784
20 Ga0068869_100230159 3300005334 Bacteria 1472
21 Ga0070666_10043421 3300005335 Bacteria 3011
22 Ga0070680_100047474 3300005336 Bacteria 3497
23 Ga0070682_100049440 3300005337 Unclassified 2622
24 Ga0068868_100018333 3300005338 Bacteria 5232
25 Ga0070689_100011753 3300005340 Bacteria 6281
26 Ga0070687_100024776 3300005343 Bacteria 2871
27 Ga0070692_10023761 3300005345 Bacteria 3007
28 Ga0070669_100003437 3300005353 Bacteria 11408
29 Ga0070669_100023412 3300005353 Bacteria 4423
30 Ga0070669_100053633 3300005353 Bacteria 2951
31 Ga0070675_100114680 3300005354 Bacteria 2283
32 Ga0070671_100183592 3300005355 Bacteria 1771
33 Ga0070671_100228577 3300005355 Bacteria 1578
34 Ga0070674_100042476 3300005356 Bacteria 3089
35 Ga0070673_100018481 3300005364 Bacteria 4981
36 Ga0070673_100035314 3300005364 Bacteria 3789
37 Ga0070667_100037415 3300005367 Bacteria 4068
38 Ga0070705_100053708 3300005440 Bacteria 2360
39 Ga0070700_100000183 3300005441 Bacteria 35579
40 Ga0070700_100016710 3300005441 Bacteria 4184
41 Ga0070700_100037499 3300005441 Bacteria 2949
42 Ga0070700_100045523 3300005441 Bacteria 2707
43 Ga0070700_100080269 3300005441 Bacteria 2104
44 Ga0070694_100018725 3300005444 Bacteria 4398
45 Ga0070694_100044665 3300005444 Bacteria 2966
46 Ga0070694_100073415 3300005444 Unclassified 2363
47 Ga0070694_100104321 3300005444 Bacteria 2010
48 Ga0070708_100010874 3300005445 Bacteria 7392
49 Ga0070708_100043352 3300005445 Bacteria 3953
50 Ga0070678_100045912 3300005456 Bacteria 3129
51 Ga0070681_10024675 3300005458 Bacteria 6050
52 Ga0070681_10420402 3300005458 Unclassified 1249
53 Ga0068867_100059690 3300005459 Bacteria 2827
54 Ga0068867_100072109 3300005459 Bacteria 2585
55 Ga0070685_10013990 3300005466 Bacteria 4245
56 Ga0070706_100000044 3300005467 Bacteria 146303
57 Ga0070706_100025364 3300005467 Bacteria 5454
58 Ga0070706_100112225 3300005467 Unclassified 2537
59 Ga0070698_100009784 3300005471 Bacteria 10249
60 Ga0070698_100009833 3300005471 Bacteria 10223
61 Ga0070698_100048641 3300005471 Bacteria 4333
62 Ga0070698_100054763 3300005471 Bacteria 4049
63 Ga0070698_100085875 3300005471 Bacteria 3133
64 Ga0070699_100006601 3300005518 Bacteria 10086
65 Ga0070699_100007620 3300005518 Bacteria 9412
66 Ga0070699_100022778 3300005518 Bacteria 5398
67 Ga0070699_100051811 3300005518 Bacteria 3554
68 Ga0070699_100066937 3300005518 Unclassified 3119
69 Ga0070699_100162286 3300005518 Bacteria 1978
70 Ga0070679_100319462 3300005530 Unclassified 1502
71 Ga0070697_100000047 3300005536 Bacteria 90650
72 Ga0070697_100021222 3300005536 Bacteria 5145
73 Ga0070697_100068249 3300005536 Unclassified 2910
74 Ga0068853_100011691 3300005539 Archaea 7135
75 Ga0070686_100043266 3300005544 Bacteria 2825
76 Ga0070695_100028200 3300005545 Bacteria 3483
77 Ga0070695_100238652 3300005545 Bacteria 1318
78 Ga0070696_100016197 3300005546 Bacteria 5015
79 Ga0070696_100073052 3300005546 Bacteria 2416
80 Ga0070693_100002095 3300005547 Bacteria 9125
81 Ga0070693_100011085 3300005547 Bacteria 4534
82 Ga0070704_100021692 3300005549 Bacteria 4168
83 Ga0070704_100053006 3300005549 Bacteria 2865
84 Ga0070704_100079904 3300005549 Unclassified 2404
85 Ga0070664_100304751 3300005564 Bacteria 1440
86 Ga0068854_100083071 3300005578 Unclassified 2368
87 Ga0070702_100007298 3300005615 Bacteria 5286
88 Ga0070702_100015059 3300005615 Bacteria 3938
89 Ga0070702_100027726 3300005615 Bacteria 3060
90 Ga0068852_100105642 3300005616 Bacteria 2551
91 Ga0068859_100012730 3300005617 Bacteria 8453
92 Ga0068859_100017979 3300005617 Bacteria 7105
93 Ga0068859_100020686 3300005617 Bacteria 6604
94 Ga0068859_100028049 3300005617 Bacteria 5645
95 Ga0068859_100040274 3300005617 Bacteria 4690
96 Ga0068859_100064126 3300005617 Bacteria 3706
97 Ga0068859_100134948 3300005617 Bacteria 2540
98 Ga0068864_100004786 3300005618 Bacteria 11091
99 Ga0068864_100008141 3300005618 Bacteria 8645
100 Ga0068864_100027352 3300005618 Bacteria 4816
101 Ga0068864_100066388 3300005618 Bacteria 3131
102 Ga0068864_100071441 3300005618 Bacteria 3022
103 Ga0068864_100160842 3300005618 Bacteria 2041
104 Ga0068864_100165097 3300005618 Bacteria 2015
105 Ga0068861_100000953 3300005719 Bacteria 17595
106 Ga0068861_100010722 3300005719 Bacteria 6369
107 Ga0068861_100019636 3300005719 Bacteria 4827
108 Ga0068861_100155557 3300005719 Bacteria 1880
109 Ga0068851_10000522 3300005834 Bacteria 16803
110 Ga0068870_10004832 3300005840 Bacteria 5827
111 Ga0068870_10021000 3300005840 Bacteria 3189
112 Ga0068863_100084998 3300005841 Bacteria 2998
113 Ga0068863_100130489 3300005841 Bacteria 2399
114 Ga0068863_100348316 3300005841 Bacteria 1442
115 Ga0068858_100101699 3300005842 Bacteria 2680
116 Ga0068860_100006272 3300005843 Bacteria 11941
117 Ga0068860_100087008 3300005843 Bacteria 2974
118 Ga0068860_100105411 3300005843 Bacteria 2693
119 Ga0068862_100028030 3300005844 Bacteria 4743
120 Ga0068862_100097366 3300005844 Bacteria 2569
121 Ga0068862_100131893 3300005844 Bacteria 2211
122 Ga0081540_1020222 3300005983 Bacteria 4013
123 Ga0081539_10001299 3300005985 Bacteria 43815
124 Ga0070716_100019390 3300006173 Unclassified 3554
125 Ga0097621_100002401 3300006237 Bacteria 12838
126 Ga0097621_100023487 3300006237 Bacteria 4802
127 Ga0097621_100129684 3300006237 Bacteria 2145
128 Ga0097621_100206042 3300006237 Bacteria 1709
129 Ga0068871_100015963 3300006358 Bacteria 5641
130 Ga0068871_100027863 3300006358 Bacteria 4424
131 Ga0068871_100081320 3300006358 Bacteria 2684
132 Ga0068871_100127889 3300006358 Unclassified 2152
133 Ga0075428_100065354 3300006844 Bacteria 3983
134 Ga0075430_100044090 3300006846 Bacteria 3772
135 Ga0075433_10040433 3300006852 Bacteria 4036
136 Ga0075433_10083495 3300006852 Bacteria 2819
137 Ga0075434_100091024 3300006871 Bacteria 3052
138 Ga0075429_100061153 3300006880 Bacteria 3280
139 Ga0075436_100016798 3300006914 Bacteria 5010
140 Ga0097620_100012730 3300006931 Bacteria 8453
141 Ga0097620_100017978 3300006931 Bacteria 7105
142 Ga0097620_100020687 3300006931 Bacteria 6604
143 Ga0097620_100028049 3300006931 Bacteria 5645
144 Ga0097620_100040270 3300006931 Bacteria 4690
145 Ga0097620_100064125 3300006931 Bacteria 3706
146 Ga0097620_100134948 3300006931 Bacteria 2540
147 Ga0111539_10003191 3300009094 Bacteria 21698
148 Ga0111539_10020310 3300009094 Bacteria 8182
149 Ga0111539_10023715 3300009094 Bacteria 7538
150 Ga0111539_10031059 3300009094 Bacteria 6491
151 Ga0111539_10095952 3300009094 Bacteria 3483
152 Ga0111539_10132593 3300009094 Bacteria 2918
153 Ga0105245_10028085 3300009098 Bacteria 4959
154 Ga0105247_10045259 3300009101 Bacteria 2700
155 Ga0105247_10083365 3300009101 Bacteria 2019
156 Ga0114129_10007532 3300009147 Bacteria 15506
157 Ga0114129_10046827 3300009147 Bacteria 6077
158 Ga0114129_10072372 3300009147 Bacteria 4805
159 Ga0114129_10105412 3300009147 Bacteria 3896
160 Ga0114129_10402146 3300009147 Bacteria 1804
161 Ga0105243_10006941 3300009148 Bacteria 8721
162 Ga0105243_10087951 3300009148 Bacteria 2552
163 Ga0105241_10060314 3300009174 Bacteria 2918
164 Ga0105241_10104377 3300009174 Bacteria 2258
165 Ga0105241_10111175 3300009174 Bacteria 2193
166 Ga0105242_10037546 3300009176 Bacteria 3891
167 Ga0105242_10148070 3300009176 Bacteria 2044
168 Ga0105248_10005056 3300009177 Bacteria 14565
169 Ga0105248_10106863 3300009177 Bacteria 3156
170 Ga0105248_10183443 3300009177 Bacteria 2358
171 Ga0105237_10001434 3300009545 Bacteria 31525
172 Ga0105238_10028161 3300009551 Bacteria 5724
173 Ga0105238_10075607 3300009551 Bacteria 3359
174 Ga0105249_10033305 3300009553 Bacteria 4665
175 Ga0105249_10084565 3300009553 Bacteria 2955
176 Ga0105249_10136224 3300009553 Bacteria 2350
177 Ga0105249_10163152 3300009553 Bacteria 2155
178 Ga0105246_10056159 3300011119 Bacteria 2720
179 Ga0157373_10014643 3300013100 Bacteria 5751
180 Ga0157373_10031712 3300013100 Bacteria 3804
181 Ga0157374_10009323 3300013296 Bacteria 8421
182 Ga0157378_10004006 3300013297 Bacteria 13017
183 Ga0157378_10041333 3300013297 Bacteria 4089
184 Ga0157378_10149631 3300013297 Unclassified 2174
185 Ga0157378_10286369 3300013297 Unclassified 1590
186 Ga0163162_10005207 3300013306 Bacteria 12540
187 Ga0163162_10214037 3300013306 Bacteria 2057
188 Ga0163162_10275842 3300013306 Bacteria 1813
189 Ga0157372_10003705 3300013307 Bacteria 16416
190 Ga0157375_10003749 3300013308 Bacteria 13180
191 Ga0157375_10049117 3300013308 Bacteria 4132
192 Ga0157375_10060081 3300013308 Bacteria 3768
193 Ga0157375_10070604 3300013308 Bacteria 3503
194 Ga0157375_10213046 3300013308 Bacteria 2090
195 Ga0163163_10004417 3300014325 Bacteria 11986
196 Ga0163163_10007544 3300014325 Bacteria 9604
197 Ga0163163_10014244 3300014325 Bacteria 7308
198 Ga0163163_10098328 3300014325 Bacteria 2947
199 Ga0157380_10039687 3300014326 Bacteria 3663
200 Ga0157380_10067242 3300014326 Bacteria 2885
201 Ga0157380_10091071 3300014326 Unclassified 2517
202 Ga0157377_10048852 3300014745 Bacteria 2376
203 Ga0157377_10057043 3300014745 Unclassified 2219
204 Ga0157377_10116665 3300014745 Unclassified 1612
205 Ga0157376_10020206 3300014969 Bacteria 5147
206 Ga0157376_10070904 3300014969 Bacteria 2959
207 Ga0163161_10069207 3300017792 Bacteria 2580
208 Ga0207656_10000968 3300025321 Bacteria 9398
209 Ga0207710_10018751 3300025900 Bacteria 2945
210 Ga0207647_10010631 3300025904 Bacteria 6490
211 Ga0207643_10004210 3300025908 Bacteria 7753
212 Ga0207684_10003111 3300025910 Bacteria 16372
213 Ga0207684_10105697 3300025910 Unclassified 2408
214 Ga0207654_10043701 3300025911 Bacteria 2541
215 Ga0207707_10085820 3300025912 Bacteria 2751
216 Ga0207695_10012301 3300025913 Bacteria 10280
217 Ga0207671_10000811 3300025914 Bacteria 39493
218 Ga0207671_10085197 3300025914 Bacteria 2374
219 Ga0207660_10022337 3300025917 Bacteria 4262
220 Ga0207660_10172783 3300025917 Bacteria 1674
221 Ga0207662_10017969 3300025918 Unclassified 4005
222 Ga0207662_10116734 3300025918 Bacteria 1669
223 Ga0207681_10001566 3300025923 Bacteria 14713
224 Ga0207681_10039186 3300025923 Bacteria 3144
225 Ga0207694_10029685 3300025924 Bacteria 4173
226 Ga0207650_10000028 3300025925 Bacteria 236867
227 Ga0207650_10001960 3300025925 Bacteria 14467
228 Ga0207650_10085629 3300025925 Bacteria 2398
229 Ga0207650_10091366 3300025925 Bacteria 2326
230 Ga0207687_10013396 3300025927 Bacteria 5353
231 Ga0207706_10071662 3300025933 Bacteria 3048
232 Ga0207686_10055558 3300025934 Bacteria 2485
233 Ga0207709_10066185 3300025935 Bacteria 2275
234 Ga0207670_10083439 3300025936 Bacteria 2241
235 Ga0207691_10006094 3300025940 Bacteria 11654
236 Ga0207691_10077284 3300025940 Unclassified 2999
237 Ga0207691_10124785 3300025940 Bacteria 2279
238 Ga0207711_10254127 3300025941 Bacteria 1614
239 Ga0207689_10009036 3300025942 Bacteria 8629
240 Ga0207689_10110374 3300025942 Bacteria 2260
241 Ga0207689_10208722 3300025942 Bacteria 1613
242 Ga0207689_10234509 3300025942 Unclassified 1517
243 Ga0207651_10010066 3300025960 Bacteria 5219
244 Ga0207651_10092091 3300025960 Unclassified 2222
245 Ga0207640_10124580 3300025981 Unclassified 1853
246 Ga0207658_10271408 3300025986 Bacteria 1450
247 Ga0207703_10043765 3300026035 Bacteria 3595
248 Ga0207708_10000100 3300026075 Bacteria 65501
249 Ga0207708_10005351 3300026075 Bacteria 9454
250 Ga0207708_10030336 3300026075 Bacteria 4099
251 Ga0207708_10070298 3300026075 Unclassified 2680
252 Ga0207708_10121509 3300026075 Bacteria 2035
253 Ga0207702_10331463 3300026078 Bacteria 1452
254 Ga0207641_10026699 3300026088 Bacteria 4768
255 Ga0207641_10059798 3300026088 Bacteria 3247
256 Ga0207641_10154614 3300026088 Bacteria 2080
257 Ga0207641_10196086 3300026088 Bacteria 1859
258 Ga0207648_10007392 3300026089 Bacteria 10813
259 Ga0207648_10014348 3300026089 Bacteria 7324
260 Ga0207676_10004285 3300026095 Bacteria 10088
261 Ga0207676_10035953 3300026095 Bacteria 3764
262 Ga0207676_10081817 3300026095 Bacteria 2624
263 Ga0207676_10142571 3300026095 Bacteria 2053
264 Ga0207676_10184981 3300026095 Bacteria 1828
265 Ga0207676_10277195 3300026095 Bacteria 1521
266 Ga0207674_10024268 3300026116 Bacteria 6482
267 Ga0207674_10062656 3300026116 Bacteria 3756
268 Ga0207675_100002272 3300026118 Bacteria 19109
269 Ga0207675_100017033 3300026118 Bacteria 6791
270 Ga0207675_100225530 3300026118 Bacteria 1806
271 Ga0207683_10013393 3300026121 Bacteria 6993
272 Ga0207428_10045943 3300027907 Bacteria 3514
273 Ga0268265_10032593 3300028380 Bacteria 3778
274 Ga0268265_10139465 3300028380 Bacteria 2028
275 Ga0268265_10145459 3300028380 Bacteria 1991
276 Ga0268264_10003455 3300028381 Bacteria 13625
277 Ga0268264_10012599 3300028381 Bacteria 6966
278 Ga0307407_10164579 3300031903 Unclassified 1455
279 Ga0307412_10019547 3300031911 Bacteria 4105
280 Ga0307412_10070504 3300031911 Unclassified 2383
281 Ga0307409_100381359 3300031995 Unclassified 1340
282 Ga0307411_10005717 3300032005 Bacteria 6146
283 Ga0373951_0001753 3300035091 Bacteria 5645
284 Ga0373942_0004279 3300035207 Bacteria 3324
285 Ga0373937_0019888 3300036401 Bacteria 6014
286 Ga0395900_0142969 3300037418 Bacteria 2449
287 Ga0395898_0115990 3300037466 Bacteria 2566
288 Ga0395901_0120997 3300038443 Bacteria 2751
289 Ga0242420_002529 3300038996 Bacteria 2616
290 Ga0439439_0014146 3300041406 Bacteria 1941
291 Ga0496104_0243190 3300048907 Bacteria 1712
292 Ga0496106_0157305 3300048909 Bacteria 1795
293 Ga0496112_0178438 3300048915 Unclassified 2088
294 Ga0501077_0164460 3300049593 Unclassified 1409
295 Ga0501233_005436 3300049668 Bacteria 2365
296 Ga0501234_004746 3300049707 Bacteria 2132
297 Ga0501212_003317 3300049851 Bacteria 2011
298 nmdc:mga05p37_4358_c1 3300050507 Bacteria 16518
299 nmdc:mga0qj67_199065_c1 3300050509 Bacteria 1628
300 nmdc:mga06r32_114226_c1 3300050510 Bacteria 2658
301 nmdc:mga06r32_88930_c1 3300050510 Bacteria 3015
302 nmdc:mga08y16_19098_c1 3300050511 Bacteria 7222
303 nmdc:mga08y16_47497_c1 3300050511 Bacteria 4493
304 nmdc:mga08y16_7194_c1 3300050511 Bacteria 11678
305 nmdc:mga0n895_183245_c1 3300050512 Unclassified 2125
306 nmdc:mga0n895_31440_c1 3300050512 Bacteria 5083
307 nmdc:mga0rr50_33504_c2 3300050513 Unclassified 1748
308 nmdc:mga0a205_17126_c1 3300050515 Bacteria 6787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10164579 Ga0307407_101645792 299
2 3300009174 Ga0105241_10060314 Ga0105241_100603143 319
3 3300009553 Ga0105249_10084565 Ga0105249_100845654 319
4 3300013306 Ga0163162_10214037 Ga0163162_102140372 319
5 3300009147 Ga0114129_10105412 Ga0114129_101054122 325
6 3300025942 Ga0207689_10208722 Ga0207689_102087222 331
7 3300048915 Ga0496112_0178438 Ga0496112_0178438_990_2054 342
8 3300005444 Ga0070694_100044665 Ga0070694_1000446653 345
9 3300038996 Ga0242420_002529 Ga0242420_002529_699_1763 349
10 3300009147 Ga0114129_10007532 Ga0114129_100075326 357
11 3300050507 nmdc:mga05p37_4358_c1 nmdc:mga05p37_4358_c1_954_2057 357
12 3300003322 rootL2_10067334 rootL2_100673344 360
13 3300031911 Ga0307412_10070504 Ga0307412_100705042 361
14 3300005518 Ga0070699_100051811 Ga0070699_1000518113 362
15 3300005293 Ga0065715_10112763 Ga0065715_101127632 363
16 3300005328 Ga0070676_10024342 Ga0070676_100243424 363
17 3300005330 Ga0070690_100034594 Ga0070690_1000345943 363
18 3300005334 Ga0068869_100154195 Ga0068869_1001541951 363
19 3300005338 Ga0068868_100018333 Ga0068868_1000183334 363
20 3300005343 Ga0070687_100024776 Ga0070687_1000247762 363
21 3300005354 Ga0070675_100114680 Ga0070675_1001146802 363
22 3300005355 Ga0070671_100183592 Ga0070671_1001835922 363
23 3300005356 Ga0070674_100042476 Ga0070674_1000424762 363
24 3300005367 Ga0070667_100037415 Ga0070667_1000374153 363
25 3300005456 Ga0070678_100045912 Ga0070678_1000459123 363
26 3300005459 Ga0068867_100059690 Ga0068867_1000596903 363
27 3300005466 Ga0070685_10013990 Ga0070685_100139903 363
28 3300005544 Ga0070686_100043266 Ga0070686_1000432663 363
29 3300005615 Ga0070702_100015059 Ga0070702_1000150593 363
30 3300005617 Ga0068859_100064126 Ga0068859_1000641263 363
31 3300005618 Ga0068864_100071441 Ga0068864_1000714413 363
32 3300005719 Ga0068861_100019636 Ga0068861_1000196363 363
33 3300005840 Ga0068870_10021000 Ga0068870_100210002 363
34 3300005841 Ga0068863_100130489 Ga0068863_1001304892 363
35 3300005842 Ga0068858_100101699 Ga0068858_1001016993 363
36 3300006237 Ga0097621_100129684 Ga0097621_1001296841 363
37 3300006358 Ga0068871_100027863 Ga0068871_1000278635 363
38 3300006931 Ga0097620_100064125 Ga0097620_1000641254 363
39 3300009098 Ga0105245_10028085 Ga0105245_100280854 363
40 3300009148 Ga0105243_10006941 Ga0105243_100069416 363
41 3300009174 Ga0105241_10104377 Ga0105241_101043772 363
42 3300009176 Ga0105242_10037546 Ga0105242_100375463 363
43 3300009177 Ga0105248_10106863 Ga0105248_101068632 363
44 3300013297 Ga0157378_10149631 Ga0157378_101496312 363
45 3300013308 Ga0157375_10049117 Ga0157375_100491174 363
46 3300014325 Ga0163163_10098328 Ga0163163_100983282 363
47 3300014326 Ga0157380_10039687 Ga0157380_100396873 363
48 3300014745 Ga0157377_10048852 Ga0157377_100488523 363
49 3300014969 Ga0157376_10020206 Ga0157376_100202064 363
50 3300017792 Ga0163161_10069207 Ga0163161_100692072 363
51 3300025918 Ga0207662_10116734 Ga0207662_101167342 363
52 3300025927 Ga0207687_10013396 Ga0207687_100133963 363
53 3300025936 Ga0207670_10083439 Ga0207670_100834392 363
54 3300025940 Ga0207691_10006094 Ga0207691_100060948 363
55 3300025942 Ga0207689_10009036 Ga0207689_100090367 363
56 3300025960 Ga0207651_10092091 Ga0207651_100920912 363
57 3300025986 Ga0207658_10271408 Ga0207658_102714081 363
58 3300026088 Ga0207641_10154614 Ga0207641_101546142 363
59 3300026089 Ga0207648_10007392 Ga0207648_100073922 363
60 3300026095 Ga0207676_10035953 Ga0207676_100359533 363
61 3300026121 Ga0207683_10013393 Ga0207683_100133932 363
62 3300013308 Ga0157375_10070604 Ga0157375_100706043 366
63 3300050510 nmdc:mga06r32_114226_c1 nmdc:mga06r32_114226_c1_543_1697 366
64 3300009174 Ga0105241_10111175 Ga0105241_101111752 367
65 3300025911 Ga0207654_10043701 Ga0207654_100437012 367
66 3300031995 Ga0307409_100381359 Ga0307409_1003813591 368
67 3300005337 Ga0070682_100049440 Ga0070682_1000494403 370
68 3300005615 Ga0070702_100007298 Ga0070702_1000072982 370
69 3300006173 Ga0070716_100019390 Ga0070716_1000193902 371
70 3300005539 Ga0068853_100011691 Ga0068853_1000116919 372
71 3300025942 Ga0207689_10110374 Ga0207689_101103742 372
72 3300005618 Ga0068864_100160842 Ga0068864_1001608422 373
73 3300006871 Ga0075434_100091024 Ga0075434_1000910242 373
74 3300025904 Ga0207647_10010631 Ga0207647_100106314 373
75 3300025918 Ga0207662_10017969 Ga0207662_100179692 373
76 3300025925 Ga0207650_10085629 Ga0207650_100856292 373
77 3300026095 Ga0207676_10142571 Ga0207676_101425712 373
78 3300050512 nmdc:mga0n895_183245_c1 nmdc:mga0n895_183245_c1_890_2068 373
79 3300005353 Ga0070669_100003437 Ga0070669_10000343710 374
80 3300005549 Ga0070704_100021692 Ga0070704_1000216924 374
81 3300005834 Ga0068851_10000522 Ga0068851_1000052217 374
82 3300005840 Ga0068870_10004832 Ga0068870_100048327 374
83 3300009545 Ga0105237_10001434 Ga0105237_1000143416 374
84 3300025321 Ga0207656_10000968 Ga0207656_100009689 374
85 3300025908 Ga0207643_10004210 Ga0207643_100042106 374
86 3300025914 Ga0207671_10000811 Ga0207671_1000081126 374
87 3300025923 Ga0207681_10001566 Ga0207681_100015667 374
88 3300025925 Ga0207650_10001960 Ga0207650_1000196011 374
89 3300005518 Ga0070699_100007620 Ga0070699_1000076202 375
90 3300009094 Ga0111539_10132593 Ga0111539_101325932 375
91 3300037418 Ga0395900_0142969 Ga0395900_0142969_425_1582 375
92 3300037466 Ga0395898_0115990 Ga0395898_0115990_1270_2427 375
93 3300005545 Ga0070695_100028200 Ga0070695_1000282002 376
94 3300005547 Ga0070693_100002095 Ga0070693_1000020954 376
95 3300005618 Ga0068864_100008141 Ga0068864_1000081412 376
96 3300006846 Ga0075430_100044090 Ga0075430_1000440903 376
97 3300006880 Ga0075429_100061153 Ga0075429_1000611532 376
98 3300009147 Ga0114129_10072372 Ga0114129_100723722 376
99 3300050510 nmdc:mga06r32_88930_c1 nmdc:mga06r32_88930_c1_1742_2902 376
100 3300009551 Ga0105238_10075607 Ga0105238_100756074 377
101 3300013297 Ga0157378_10004006 Ga0157378_1000400610 377
102 3300025924 Ga0207694_10029685 Ga0207694_100296854 377
103 3300038443 Ga0395901_0120997 Ga0395901_0120997_47_1195 377
104 3300050509 nmdc:mga0qj67_199065_c1 nmdc:mga0qj67_199065_c1_87_1250 377
105 3300005983 Ga0081540_1020222 Ga0081540_10202225 379
106 3300013100 Ga0157373_10031712 Ga0157373_100317122 379
107 3300049593 Ga0501077_0164460 Ga0501077_0164460_130_1293 379
108 3300005330 Ga0070690_100024380 Ga0070690_1000243802 380
109 3300005445 Ga0070708_100043352 Ga0070708_1000433522 380
110 3300005518 Ga0070699_100022778 Ga0070699_1000227785 380
111 3300005536 Ga0070697_100000047 Ga0070697_10000004767 380
112 3300005843 Ga0068860_100006272 Ga0068860_1000062727 380
113 3300005844 Ga0068862_100131893 Ga0068862_1001318933 380
114 3300013297 Ga0157378_10286369 Ga0157378_102863691 380
115 3300013306 Ga0163162_10005207 Ga0163162_100052075 380
116 3300013308 Ga0157375_10213046 Ga0157375_102130463 380
117 3300028380 Ga0268265_10145459 Ga0268265_101454592 380
118 3300028381 Ga0268264_10003455 Ga0268264_1000345510 380
119 3300041406 Ga0439439_0014146 Ga0439439_0014146_686_1879 380
120 3300005295 Ga0065707_10001905 Ga0065707_100019059 381
121 3300005445 Ga0070708_100010874 Ga0070708_1000108747 381
122 3300005467 Ga0070706_100025364 Ga0070706_1000253642 381
123 3300005471 Ga0070698_100054763 Ga0070698_1000547632 381
124 3300005471 Ga0070698_100085875 Ga0070698_1000858753 381
125 3300005518 Ga0070699_100066937 Ga0070699_1000669372 381
126 3300005536 Ga0070697_100068249 Ga0070697_1000682492 381
127 3300025910 Ga0207684_10105697 Ga0207684_101056971 381
128 3300005295 Ga0065707_10116128 Ga0065707_101161283 383
129 3300005345 Ga0070692_10023761 Ga0070692_100237612 383
130 3300005441 Ga0070700_100016710 Ga0070700_1000167105 383
131 3300005444 Ga0070694_100104321 Ga0070694_1001043212 383
132 3300005719 Ga0068861_100010722 Ga0068861_1000107222 383
133 3300005844 Ga0068862_100028030 Ga0068862_1000280302 383
134 3300009094 Ga0111539_10023715 Ga0111539_100237155 383
135 3300009094 Ga0111539_10095952 Ga0111539_100959523 383
136 3300009553 Ga0105249_10136224 Ga0105249_101362242 383
137 3300013297 Ga0157378_10041333 Ga0157378_100413335 383
138 3300013308 Ga0157375_10060081 Ga0157375_100600814 383
139 3300014326 Ga0157380_10067242 Ga0157380_100672423 383
140 3300014745 Ga0157377_10116665 Ga0157377_101166652 383
141 3300025917 Ga0207660_10172783 Ga0207660_101727832 383
142 3300025940 Ga0207691_10124785 Ga0207691_101247852 383
143 3300026075 Ga0207708_10030336 Ga0207708_100303362 383
144 3300026118 Ga0207675_100017033 Ga0207675_1000170337 383
145 3300028380 Ga0268265_10032593 Ga0268265_100325935 383
146 3300050511 nmdc:mga08y16_47497_c1 nmdc:mga08y16_47497_c1_771_1964 383
147 3300005334 Ga0068869_100230159 Ga0068869_1002301592 384
148 3300005545 Ga0070695_100238652 Ga0070695_1002386521 384
149 3300006852 Ga0075433_10083495 Ga0075433_100834952 384
150 3300006914 Ga0075436_100016798 Ga0075436_1000167982 384
151 3300009094 Ga0111539_10020310 Ga0111539_100203101 384
152 3300009553 Ga0105249_10163152 Ga0105249_101631522 384
153 3300050511 nmdc:mga08y16_19098_c1 nmdc:mga08y16_19098_c1_70_1257 384
154 3300006358 Ga0068871_100127889 Ga0068871_1001278892 385
155 3300009094 Ga0111539_10031059 Ga0111539_100310596 385
156 3300049668 Ga0501233_005436 Ga0501233_005436_736_1959 385
157 3300049707 Ga0501234_004746 Ga0501234_004746_76_1299 385
158 3300049851 Ga0501212_003317 Ga0501212_003317_713_1936 385
159 3300005334 Ga0068869_100045857 Ga0068869_1000458573 386
160 3300005441 Ga0070700_100080269 Ga0070700_1000802692 386
161 3300005458 Ga0070681_10420402 Ga0070681_104204021 386
162 3300005617 Ga0068859_100017979 Ga0068859_1000179795 386
163 3300005617 Ga0068859_100134948 Ga0068859_1001349481 386
164 3300005618 Ga0068864_100165097 Ga0068864_1001650972 386
165 3300005844 Ga0068862_100097366 Ga0068862_1000973662 386
166 3300006931 Ga0097620_100017978 Ga0097620_1000179785 386
167 3300006931 Ga0097620_100134948 Ga0097620_1001349481 386
168 3300013100 Ga0157373_10014643 Ga0157373_100146432 386
169 3300025912 Ga0207707_10085820 Ga0207707_100858201 386
170 3300026075 Ga0207708_10121509 Ga0207708_101215092 386
171 3300026088 Ga0207641_10026699 Ga0207641_100266995 386
172 3300026095 Ga0207676_10277195 Ga0207676_102771952 386
173 3300028380 Ga0268265_10139465 Ga0268265_101394652 386
174 3300031911 Ga0307412_10019547 Ga0307412_100195472 386
175 3300048907 Ga0496104_0243190 Ga0496104_0243190_95_1270 386
176 3300005288 Ga0065714_10064454 Ga0065714_1006445430 387
177 3300005290 Ga0065712_10000129 Ga0065712_1000012939 387
178 3300005441 Ga0070700_100000183 Ga0070700_10000018331 387
179 3300005471 Ga0070698_100009784 Ga0070698_1000097844 387
180 3300005549 Ga0070704_100053006 Ga0070704_1000530064 387
181 3300005617 Ga0068859_100020686 Ga0068859_1000206865 387
182 3300005719 Ga0068861_100000953 Ga0068861_10000095317 387
183 3300006237 Ga0097621_100023487 Ga0097621_1000234874 387
184 3300006358 Ga0068871_100081320 Ga0068871_1000813203 387
185 3300006931 Ga0097620_100020687 Ga0097620_1000206875 387
186 3300009177 Ga0105248_10183443 Ga0105248_101834432 387
187 3300025941 Ga0207711_10254127 Ga0207711_102541272 387
188 3300026075 Ga0207708_10000100 Ga0207708_100001003 387
189 3300026116 Ga0207674_10024268 Ga0207674_100242684 387
190 3300026118 Ga0207675_100002272 Ga0207675_10000227217 387
191 3300005615 Ga0070702_100027726 Ga0070702_1000277263 388
192 3300005843 Ga0068860_100087008 Ga0068860_1000870081 388
193 3300006237 Ga0097621_100206042 Ga0097621_1002060421 388
194 3300009094 Ga0111539_10003191 Ga0111539_1000319117 388
195 3300009147 Ga0114129_10402146 Ga0114129_104021462 388
196 3300009176 Ga0105242_10148070 Ga0105242_101480702 388
197 3300025934 Ga0207686_10055558 Ga0207686_100555582 388
198 3300028381 Ga0268264_10012599 Ga0268264_100125997 388
199 3300050511 nmdc:mga08y16_7194_c1 nmdc:mga08y16_7194_c1_2256_3455 388
200 3300005334 Ga0068869_100118887 Ga0068869_1001188872 389
201 3300005335 Ga0070666_10043421 Ga0070666_100434213 389
202 3300005355 Ga0070671_100228577 Ga0070671_1002285771 389
203 3300005364 Ga0070673_100035314 Ga0070673_1000353144 389
204 3300005564 Ga0070664_100304751 Ga0070664_1003047511 389
205 3300005617 Ga0068859_100040274 Ga0068859_1000402746 389
206 3300005618 Ga0068864_100027352 Ga0068864_1000273523 389
207 3300005841 Ga0068863_100348316 Ga0068863_1003483162 389
208 3300005843 Ga0068860_100105411 Ga0068860_1001054113 389
209 3300006237 Ga0097621_100002401 Ga0097621_1000024014 389
210 3300006358 Ga0068871_100015963 Ga0068871_1000159633 389
211 3300006931 Ga0097620_100040270 Ga0097620_1000402701 389
212 3300009177 Ga0105248_10005056 Ga0105248_1000505613 389
213 3300013296 Ga0157374_10009323 Ga0157374_100093232 389
214 3300013308 Ga0157375_10003749 Ga0157375_100037494 389
215 3300014325 Ga0163163_10004417 Ga0163163_1000441713 389
216 3300014969 Ga0157376_10070904 Ga0157376_100709043 389
217 3300026035 Ga0207703_10043765 Ga0207703_100437655 389
218 3300026088 Ga0207641_10059798 Ga0207641_100597982 389
219 3300036401 Ga0373937_0019888 Ga0373937_0019888_79_1287 389
220 3300005340 Ga0070689_100011753 Ga0070689_1000117533 390
221 3300005353 Ga0070669_100053633 Ga0070669_1000536333 390
222 3300005547 Ga0070693_100011085 Ga0070693_1000110852 390
223 3300005618 Ga0068864_100066388 Ga0068864_1000663882 390
224 3300005719 Ga0068861_100155557 Ga0068861_1001555572 390
225 3300006852 Ga0075433_10040433 Ga0075433_100404333 390
226 3300026095 Ga0207676_10081817 Ga0207676_100818174 390
227 3300026118 Ga0207675_100225530 Ga0207675_1002255302 390
228 3300027907 Ga0207428_10045943 Ga0207428_100459434 390
229 3300050512 nmdc:mga0n895_31440_c1 nmdc:mga0n895_31440_c1_1407_2630 390
230 3300050515 nmdc:mga0a205_17126_c1 nmdc:mga0a205_17126_c1_4345_5568 390
231 3300005293 Ga0065715_10092364 Ga0065715_100923646 391
232 3300005336 Ga0070680_100047474 Ga0070680_1000474744 391
233 3300005364 Ga0070673_100018481 Ga0070673_1000184813 391
234 3300005440 Ga0070705_100053708 Ga0070705_1000537082 391
235 3300005441 Ga0070700_100045523 Ga0070700_1000455233 391
236 3300005444 Ga0070694_100018725 Ga0070694_1000187255 391
237 3300005458 Ga0070681_10024675 Ga0070681_100246754 391
238 3300005471 Ga0070698_100048641 Ga0070698_1000486412 391
239 3300005518 Ga0070699_100162286 Ga0070699_1001622862 391
240 3300005530 Ga0070679_100319462 Ga0070679_1003194622 391
241 3300005546 Ga0070696_100016197 Ga0070696_1000161973 391
242 3300005546 Ga0070696_100073052 Ga0070696_1000730522 391
243 3300005549 Ga0070704_100079904 Ga0070704_1000799043 391
244 3300005578 Ga0068854_100083071 Ga0068854_1000830712 391
245 3300005617 Ga0068859_100028049 Ga0068859_1000280496 391
246 3300006931 Ga0097620_100028049 Ga0097620_1000280492 391
247 3300014326 Ga0157380_10091071 Ga0157380_100910712 391
248 3300025914 Ga0207671_10085197 Ga0207671_100851973 391
249 3300025917 Ga0207660_10022337 Ga0207660_100223374 391
250 3300025933 Ga0207706_10071662 Ga0207706_100716622 391
251 3300025942 Ga0207689_10234509 Ga0207689_102345092 391
252 3300025960 Ga0207651_10010066 Ga0207651_100100663 391
253 3300025981 Ga0207640_10124580 Ga0207640_101245802 391
254 3300026075 Ga0207708_10070298 Ga0207708_100702983 391
255 3300026078 Ga0207702_10331463 Ga0207702_103314631 391
256 3300026088 Ga0207641_10196086 Ga0207641_101960861 391
257 3300026116 Ga0207674_10062656 Ga0207674_100626562 391
258 3300048909 Ga0496106_0157305 Ga0496106_0157305_568_1752 391
259 3300005459 Ga0068867_100072109 Ga0068867_1000721092 392
260 3300005467 Ga0070706_100112225 Ga0070706_1001122252 392
261 3300005617 Ga0068859_100012730 Ga0068859_1000127307 392
262 3300006844 Ga0075428_100065354 Ga0075428_1000653542 392
263 3300006931 Ga0097620_100012730 Ga0097620_1000127305 392
264 3300009101 Ga0105247_10083365 Ga0105247_100833652 392
265 3300009147 Ga0114129_10046827 Ga0114129_100468275 392
266 3300009148 Ga0105243_10087951 Ga0105243_100879512 392
267 3300011119 Ga0105246_10056159 Ga0105246_100561592 392
268 3300013307 Ga0157372_10003705 Ga0157372_1000370513 392
269 3300025913 Ga0207695_10012301 Ga0207695_1001230110 392
270 3300025935 Ga0207709_10066185 Ga0207709_100661852 392
271 3300026089 Ga0207648_10014348 Ga0207648_100143481 392
272 3300032005 Ga0307411_10005717 Ga0307411_100057172 393
273 3300005471 Ga0070698_100009833 Ga0070698_1000098334 394
274 3300005290 Ga0065712_10072461 Ga0065712_100724613 395
275 3300005293 Ga0065715_10017966 Ga0065715_100179663 395
276 3300005331 Ga0070670_100125037 Ga0070670_1001250372 395
277 3300005467 Ga0070706_100000044 Ga0070706_10000004478 395
278 3300009101 Ga0105247_10045259 Ga0105247_100452593 395
279 3300025900 Ga0207710_10018751 Ga0207710_100187513 395
280 3300025910 Ga0207684_10003111 Ga0207684_100031119 395
281 3300025925 Ga0207650_10091366 Ga0207650_100913662 395
282 3300050513 nmdc:mga0rr50_33504_c2 nmdc:mga0rr50_33504_c2_199_1401 395
283 3300003203 JGI25406J46586_10001728 JGI25406J46586_100017285 396
284 3300005985 Ga0081539_10001299 Ga0081539_100012996 396
285 3300035091 Ga0373951_0001753 Ga0373951_0001753_251_1453 396
286 3300035207 Ga0373942_0004279 Ga0373942_0004279_2017_3216 396
287 3300005441 Ga0070700_100037499 Ga0070700_1000374993 397
288 3300005444 Ga0070694_100073415 Ga0070694_1000734151 397
289 3300005618 Ga0068864_100004786 Ga0068864_1000047865 397
290 3300005841 Ga0068863_100084998 Ga0068863_1000849982 397
291 3300014325 Ga0163163_10014244 Ga0163163_100142445 397
292 3300014745 Ga0157377_10057043 Ga0157377_100570432 397
293 3300025940 Ga0207691_10077284 Ga0207691_100772842 397
294 3300026075 Ga0207708_10005351 Ga0207708_100053514 397
295 3300026095 Ga0207676_10004285 Ga0207676_100042858 397
296 3300026095 Ga0207676_10184981 Ga0207676_101849812 397
297 3300002459 JGI24751J29686_10000006 JGI24751J29686_1000000630 398
298 3300005331 Ga0070670_100007756 Ga0070670_1000077564 398
299 3300005353 Ga0070669_100023412 Ga0070669_1000234123 398
300 3300005518 Ga0070699_100006601 Ga0070699_1000066016 398
301 3300005536 Ga0070697_100021222 Ga0070697_1000212224 398
302 3300005616 Ga0068852_100105642 Ga0068852_1001056423 398
303 3300009551 Ga0105238_10028161 Ga0105238_100281616 398
304 3300009553 Ga0105249_10033305 Ga0105249_100333052 398
305 3300013306 Ga0163162_10275842 Ga0163162_102758422 398
306 3300014325 Ga0163163_10007544 Ga0163163_100075445 398
307 3300025923 Ga0207681_10039186 Ga0207681_100391863 398
308 3300025925 Ga0207650_10000028 Ga0207650_10000028114 398

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

12

45

0.95

PF04773

FecR

FecR protein

163

256

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m0n-assembly1.cif.gz_A crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 1.65 a resolution 0.7318 149 284
4m0h-assembly2.cif.gz_B crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 2.50 a resolution 0.7292 149 284
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6946 3 55
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.6581 6 68
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6562 3 55
ID Description Score Start End Superfamily
4m0hB01 Mainly Beta;Sandwich;Jelly Rolls; 0.7877 149 265 2.60.120.1440
af_P23485_97_238_2.60.120.1440 Mainly Beta;Sandwich;Jelly Rolls; 0.7831 151 275 2.60.120.1440
af_F4HSZ1_1_345_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7032 276 335 1.25.10.10
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6946 3 55 1.10.10.1320
af_P23485_97_238_2.60.120.1440 Mainly Beta;Sandwich;Jelly Rolls; 0.6945 151 275 2.60.120.1440
ID Description Score Start End GO Terms
AF-A0A7V8ZB06-F1-model_v4 FecR domain-containing protein 0.9658 121 366
AF-A0A2V7S9B5-F1-model_v4 FecR protein domain-containing protein 0.9425 124 366
AF-A0A7V8ZB06-F1-model_v4 FecR domain-containing protein 0.9288 121 366
AF-A0A2V7PJQ8-F1-model_v4 FecR protein domain-containing protein 0.9227 149 360
AF-A0A1L6LE89-F1-model_v4 deleted 0.9216 112 364

Feature Viewer

pLDDT pTM Quality
76.86 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map