F399594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 308 | 154 | 308 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100021222|Ga0070697_1000212224 |
| Length | 412 |
| Sequence | VRFYGEALMFSRHVTKDISAYCHGELSSQQSKQFAEHIISCVRCRSRFEEIKLGIKFAEQLPQISAPDHLWSGLESLLDKQSGPQITQIRQVPASSWRMRVAAAXXXLLVVSLGVWWVYNKRPSAVLISENGKPYWQVIRLDGTPTIGKEGISNNGQLAVGEWLETDGKSKAQIAVSSIGSVDIDENTRVRLLETHATEHRLELARGKMSARIWAPPRLFFVDTPSAVAADLGCAYTLEVDDHGASKLQVTSGWVALELRDRESTVPAGASCETRPVVGPGTPYFDDSSNEFRAELNKVDFDPDAAARSAALKLMLDDARPKDTLTLWHLLTRVDGNDRVRVYEKMAALSPPPQGVTREGILQLNQTMLDGWRDELKLTWMGVGKGVPKPLAEAYWRAKNGVSRRLKEMAPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 140 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 141 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 142 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 143 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 144 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 146 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 147 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.97 |
| Rhizosphere | 98.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000006 | 3300002459 | Bacteria | 134556 |
| 2 | JGI25406J46586_10001728 | 3300003203 | Bacteria | 10264 |
| 3 | rootL2_10067334 | 3300003322 | Bacteria | 2560 |
| 4 | Ga0065714_10064454 | 3300005288 | Bacteria | 72991 |
| 5 | Ga0065712_10000129 | 3300005290 | Bacteria | 72972 |
| 6 | Ga0065712_10072461 | 3300005290 | Bacteria | 4746 |
| 7 | Ga0065715_10017966 | 3300005293 | Bacteria | 2735 |
| 8 | Ga0065715_10092364 | 3300005293 | Bacteria | 5162 |
| 9 | Ga0065715_10112763 | 3300005293 | Bacteria | 2501 |
| 10 | Ga0065707_10001905 | 3300005295 | Bacteria | 8124 |
| 11 | Ga0065707_10116128 | 3300005295 | Bacteria | 2247 |
| 12 | Ga0070676_10024342 | 3300005328 | Bacteria | 3410 |
| 13 | Ga0070690_100024380 | 3300005330 | Bacteria | 3719 |
| 14 | Ga0070690_100034594 | 3300005330 | Bacteria | 3166 |
| 15 | Ga0070670_100007756 | 3300005331 | Bacteria | 9130 |
| 16 | Ga0070670_100125037 | 3300005331 | Bacteria | 2220 |
| 17 | Ga0068869_100045857 | 3300005334 | Bacteria | 3149 |
| 18 | Ga0068869_100118887 | 3300005334 | Bacteria | 2019 |
| 19 | Ga0068869_100154195 | 3300005334 | Bacteria | 1784 |
| 20 | Ga0068869_100230159 | 3300005334 | Bacteria | 1472 |
| 21 | Ga0070666_10043421 | 3300005335 | Bacteria | 3011 |
| 22 | Ga0070680_100047474 | 3300005336 | Bacteria | 3497 |
| 23 | Ga0070682_100049440 | 3300005337 | Unclassified | 2622 |
| 24 | Ga0068868_100018333 | 3300005338 | Bacteria | 5232 |
| 25 | Ga0070689_100011753 | 3300005340 | Bacteria | 6281 |
| 26 | Ga0070687_100024776 | 3300005343 | Bacteria | 2871 |
| 27 | Ga0070692_10023761 | 3300005345 | Bacteria | 3007 |
| 28 | Ga0070669_100003437 | 3300005353 | Bacteria | 11408 |
| 29 | Ga0070669_100023412 | 3300005353 | Bacteria | 4423 |
| 30 | Ga0070669_100053633 | 3300005353 | Bacteria | 2951 |
| 31 | Ga0070675_100114680 | 3300005354 | Bacteria | 2283 |
| 32 | Ga0070671_100183592 | 3300005355 | Bacteria | 1771 |
| 33 | Ga0070671_100228577 | 3300005355 | Bacteria | 1578 |
| 34 | Ga0070674_100042476 | 3300005356 | Bacteria | 3089 |
| 35 | Ga0070673_100018481 | 3300005364 | Bacteria | 4981 |
| 36 | Ga0070673_100035314 | 3300005364 | Bacteria | 3789 |
| 37 | Ga0070667_100037415 | 3300005367 | Bacteria | 4068 |
| 38 | Ga0070705_100053708 | 3300005440 | Bacteria | 2360 |
| 39 | Ga0070700_100000183 | 3300005441 | Bacteria | 35579 |
| 40 | Ga0070700_100016710 | 3300005441 | Bacteria | 4184 |
| 41 | Ga0070700_100037499 | 3300005441 | Bacteria | 2949 |
| 42 | Ga0070700_100045523 | 3300005441 | Bacteria | 2707 |
| 43 | Ga0070700_100080269 | 3300005441 | Bacteria | 2104 |
| 44 | Ga0070694_100018725 | 3300005444 | Bacteria | 4398 |
| 45 | Ga0070694_100044665 | 3300005444 | Bacteria | 2966 |
| 46 | Ga0070694_100073415 | 3300005444 | Unclassified | 2363 |
| 47 | Ga0070694_100104321 | 3300005444 | Bacteria | 2010 |
| 48 | Ga0070708_100010874 | 3300005445 | Bacteria | 7392 |
| 49 | Ga0070708_100043352 | 3300005445 | Bacteria | 3953 |
| 50 | Ga0070678_100045912 | 3300005456 | Bacteria | 3129 |
| 51 | Ga0070681_10024675 | 3300005458 | Bacteria | 6050 |
| 52 | Ga0070681_10420402 | 3300005458 | Unclassified | 1249 |
| 53 | Ga0068867_100059690 | 3300005459 | Bacteria | 2827 |
| 54 | Ga0068867_100072109 | 3300005459 | Bacteria | 2585 |
| 55 | Ga0070685_10013990 | 3300005466 | Bacteria | 4245 |
| 56 | Ga0070706_100000044 | 3300005467 | Bacteria | 146303 |
| 57 | Ga0070706_100025364 | 3300005467 | Bacteria | 5454 |
| 58 | Ga0070706_100112225 | 3300005467 | Unclassified | 2537 |
| 59 | Ga0070698_100009784 | 3300005471 | Bacteria | 10249 |
| 60 | Ga0070698_100009833 | 3300005471 | Bacteria | 10223 |
| 61 | Ga0070698_100048641 | 3300005471 | Bacteria | 4333 |
| 62 | Ga0070698_100054763 | 3300005471 | Bacteria | 4049 |
| 63 | Ga0070698_100085875 | 3300005471 | Bacteria | 3133 |
| 64 | Ga0070699_100006601 | 3300005518 | Bacteria | 10086 |
| 65 | Ga0070699_100007620 | 3300005518 | Bacteria | 9412 |
| 66 | Ga0070699_100022778 | 3300005518 | Bacteria | 5398 |
| 67 | Ga0070699_100051811 | 3300005518 | Bacteria | 3554 |
| 68 | Ga0070699_100066937 | 3300005518 | Unclassified | 3119 |
| 69 | Ga0070699_100162286 | 3300005518 | Bacteria | 1978 |
| 70 | Ga0070679_100319462 | 3300005530 | Unclassified | 1502 |
| 71 | Ga0070697_100000047 | 3300005536 | Bacteria | 90650 |
| 72 | Ga0070697_100021222 | 3300005536 | Bacteria | 5145 |
| 73 | Ga0070697_100068249 | 3300005536 | Unclassified | 2910 |
| 74 | Ga0068853_100011691 | 3300005539 | Archaea | 7135 |
| 75 | Ga0070686_100043266 | 3300005544 | Bacteria | 2825 |
| 76 | Ga0070695_100028200 | 3300005545 | Bacteria | 3483 |
| 77 | Ga0070695_100238652 | 3300005545 | Bacteria | 1318 |
| 78 | Ga0070696_100016197 | 3300005546 | Bacteria | 5015 |
| 79 | Ga0070696_100073052 | 3300005546 | Bacteria | 2416 |
| 80 | Ga0070693_100002095 | 3300005547 | Bacteria | 9125 |
| 81 | Ga0070693_100011085 | 3300005547 | Bacteria | 4534 |
| 82 | Ga0070704_100021692 | 3300005549 | Bacteria | 4168 |
| 83 | Ga0070704_100053006 | 3300005549 | Bacteria | 2865 |
| 84 | Ga0070704_100079904 | 3300005549 | Unclassified | 2404 |
| 85 | Ga0070664_100304751 | 3300005564 | Bacteria | 1440 |
| 86 | Ga0068854_100083071 | 3300005578 | Unclassified | 2368 |
| 87 | Ga0070702_100007298 | 3300005615 | Bacteria | 5286 |
| 88 | Ga0070702_100015059 | 3300005615 | Bacteria | 3938 |
| 89 | Ga0070702_100027726 | 3300005615 | Bacteria | 3060 |
| 90 | Ga0068852_100105642 | 3300005616 | Bacteria | 2551 |
| 91 | Ga0068859_100012730 | 3300005617 | Bacteria | 8453 |
| 92 | Ga0068859_100017979 | 3300005617 | Bacteria | 7105 |
| 93 | Ga0068859_100020686 | 3300005617 | Bacteria | 6604 |
| 94 | Ga0068859_100028049 | 3300005617 | Bacteria | 5645 |
| 95 | Ga0068859_100040274 | 3300005617 | Bacteria | 4690 |
| 96 | Ga0068859_100064126 | 3300005617 | Bacteria | 3706 |
| 97 | Ga0068859_100134948 | 3300005617 | Bacteria | 2540 |
| 98 | Ga0068864_100004786 | 3300005618 | Bacteria | 11091 |
| 99 | Ga0068864_100008141 | 3300005618 | Bacteria | 8645 |
| 100 | Ga0068864_100027352 | 3300005618 | Bacteria | 4816 |
| 101 | Ga0068864_100066388 | 3300005618 | Bacteria | 3131 |
| 102 | Ga0068864_100071441 | 3300005618 | Bacteria | 3022 |
| 103 | Ga0068864_100160842 | 3300005618 | Bacteria | 2041 |
| 104 | Ga0068864_100165097 | 3300005618 | Bacteria | 2015 |
| 105 | Ga0068861_100000953 | 3300005719 | Bacteria | 17595 |
| 106 | Ga0068861_100010722 | 3300005719 | Bacteria | 6369 |
| 107 | Ga0068861_100019636 | 3300005719 | Bacteria | 4827 |
| 108 | Ga0068861_100155557 | 3300005719 | Bacteria | 1880 |
| 109 | Ga0068851_10000522 | 3300005834 | Bacteria | 16803 |
| 110 | Ga0068870_10004832 | 3300005840 | Bacteria | 5827 |
| 111 | Ga0068870_10021000 | 3300005840 | Bacteria | 3189 |
| 112 | Ga0068863_100084998 | 3300005841 | Bacteria | 2998 |
| 113 | Ga0068863_100130489 | 3300005841 | Bacteria | 2399 |
| 114 | Ga0068863_100348316 | 3300005841 | Bacteria | 1442 |
| 115 | Ga0068858_100101699 | 3300005842 | Bacteria | 2680 |
| 116 | Ga0068860_100006272 | 3300005843 | Bacteria | 11941 |
| 117 | Ga0068860_100087008 | 3300005843 | Bacteria | 2974 |
| 118 | Ga0068860_100105411 | 3300005843 | Bacteria | 2693 |
| 119 | Ga0068862_100028030 | 3300005844 | Bacteria | 4743 |
| 120 | Ga0068862_100097366 | 3300005844 | Bacteria | 2569 |
| 121 | Ga0068862_100131893 | 3300005844 | Bacteria | 2211 |
| 122 | Ga0081540_1020222 | 3300005983 | Bacteria | 4013 |
| 123 | Ga0081539_10001299 | 3300005985 | Bacteria | 43815 |
| 124 | Ga0070716_100019390 | 3300006173 | Unclassified | 3554 |
| 125 | Ga0097621_100002401 | 3300006237 | Bacteria | 12838 |
| 126 | Ga0097621_100023487 | 3300006237 | Bacteria | 4802 |
| 127 | Ga0097621_100129684 | 3300006237 | Bacteria | 2145 |
| 128 | Ga0097621_100206042 | 3300006237 | Bacteria | 1709 |
| 129 | Ga0068871_100015963 | 3300006358 | Bacteria | 5641 |
| 130 | Ga0068871_100027863 | 3300006358 | Bacteria | 4424 |
| 131 | Ga0068871_100081320 | 3300006358 | Bacteria | 2684 |
| 132 | Ga0068871_100127889 | 3300006358 | Unclassified | 2152 |
| 133 | Ga0075428_100065354 | 3300006844 | Bacteria | 3983 |
| 134 | Ga0075430_100044090 | 3300006846 | Bacteria | 3772 |
| 135 | Ga0075433_10040433 | 3300006852 | Bacteria | 4036 |
| 136 | Ga0075433_10083495 | 3300006852 | Bacteria | 2819 |
| 137 | Ga0075434_100091024 | 3300006871 | Bacteria | 3052 |
| 138 | Ga0075429_100061153 | 3300006880 | Bacteria | 3280 |
| 139 | Ga0075436_100016798 | 3300006914 | Bacteria | 5010 |
| 140 | Ga0097620_100012730 | 3300006931 | Bacteria | 8453 |
| 141 | Ga0097620_100017978 | 3300006931 | Bacteria | 7105 |
| 142 | Ga0097620_100020687 | 3300006931 | Bacteria | 6604 |
| 143 | Ga0097620_100028049 | 3300006931 | Bacteria | 5645 |
| 144 | Ga0097620_100040270 | 3300006931 | Bacteria | 4690 |
| 145 | Ga0097620_100064125 | 3300006931 | Bacteria | 3706 |
| 146 | Ga0097620_100134948 | 3300006931 | Bacteria | 2540 |
| 147 | Ga0111539_10003191 | 3300009094 | Bacteria | 21698 |
| 148 | Ga0111539_10020310 | 3300009094 | Bacteria | 8182 |
| 149 | Ga0111539_10023715 | 3300009094 | Bacteria | 7538 |
| 150 | Ga0111539_10031059 | 3300009094 | Bacteria | 6491 |
| 151 | Ga0111539_10095952 | 3300009094 | Bacteria | 3483 |
| 152 | Ga0111539_10132593 | 3300009094 | Bacteria | 2918 |
| 153 | Ga0105245_10028085 | 3300009098 | Bacteria | 4959 |
| 154 | Ga0105247_10045259 | 3300009101 | Bacteria | 2700 |
| 155 | Ga0105247_10083365 | 3300009101 | Bacteria | 2019 |
| 156 | Ga0114129_10007532 | 3300009147 | Bacteria | 15506 |
| 157 | Ga0114129_10046827 | 3300009147 | Bacteria | 6077 |
| 158 | Ga0114129_10072372 | 3300009147 | Bacteria | 4805 |
| 159 | Ga0114129_10105412 | 3300009147 | Bacteria | 3896 |
| 160 | Ga0114129_10402146 | 3300009147 | Bacteria | 1804 |
| 161 | Ga0105243_10006941 | 3300009148 | Bacteria | 8721 |
| 162 | Ga0105243_10087951 | 3300009148 | Bacteria | 2552 |
| 163 | Ga0105241_10060314 | 3300009174 | Bacteria | 2918 |
| 164 | Ga0105241_10104377 | 3300009174 | Bacteria | 2258 |
| 165 | Ga0105241_10111175 | 3300009174 | Bacteria | 2193 |
| 166 | Ga0105242_10037546 | 3300009176 | Bacteria | 3891 |
| 167 | Ga0105242_10148070 | 3300009176 | Bacteria | 2044 |
| 168 | Ga0105248_10005056 | 3300009177 | Bacteria | 14565 |
| 169 | Ga0105248_10106863 | 3300009177 | Bacteria | 3156 |
| 170 | Ga0105248_10183443 | 3300009177 | Bacteria | 2358 |
| 171 | Ga0105237_10001434 | 3300009545 | Bacteria | 31525 |
| 172 | Ga0105238_10028161 | 3300009551 | Bacteria | 5724 |
| 173 | Ga0105238_10075607 | 3300009551 | Bacteria | 3359 |
| 174 | Ga0105249_10033305 | 3300009553 | Bacteria | 4665 |
| 175 | Ga0105249_10084565 | 3300009553 | Bacteria | 2955 |
| 176 | Ga0105249_10136224 | 3300009553 | Bacteria | 2350 |
| 177 | Ga0105249_10163152 | 3300009553 | Bacteria | 2155 |
| 178 | Ga0105246_10056159 | 3300011119 | Bacteria | 2720 |
| 179 | Ga0157373_10014643 | 3300013100 | Bacteria | 5751 |
| 180 | Ga0157373_10031712 | 3300013100 | Bacteria | 3804 |
| 181 | Ga0157374_10009323 | 3300013296 | Bacteria | 8421 |
| 182 | Ga0157378_10004006 | 3300013297 | Bacteria | 13017 |
| 183 | Ga0157378_10041333 | 3300013297 | Bacteria | 4089 |
| 184 | Ga0157378_10149631 | 3300013297 | Unclassified | 2174 |
| 185 | Ga0157378_10286369 | 3300013297 | Unclassified | 1590 |
| 186 | Ga0163162_10005207 | 3300013306 | Bacteria | 12540 |
| 187 | Ga0163162_10214037 | 3300013306 | Bacteria | 2057 |
| 188 | Ga0163162_10275842 | 3300013306 | Bacteria | 1813 |
| 189 | Ga0157372_10003705 | 3300013307 | Bacteria | 16416 |
| 190 | Ga0157375_10003749 | 3300013308 | Bacteria | 13180 |
| 191 | Ga0157375_10049117 | 3300013308 | Bacteria | 4132 |
| 192 | Ga0157375_10060081 | 3300013308 | Bacteria | 3768 |
| 193 | Ga0157375_10070604 | 3300013308 | Bacteria | 3503 |
| 194 | Ga0157375_10213046 | 3300013308 | Bacteria | 2090 |
| 195 | Ga0163163_10004417 | 3300014325 | Bacteria | 11986 |
| 196 | Ga0163163_10007544 | 3300014325 | Bacteria | 9604 |
| 197 | Ga0163163_10014244 | 3300014325 | Bacteria | 7308 |
| 198 | Ga0163163_10098328 | 3300014325 | Bacteria | 2947 |
| 199 | Ga0157380_10039687 | 3300014326 | Bacteria | 3663 |
| 200 | Ga0157380_10067242 | 3300014326 | Bacteria | 2885 |
| 201 | Ga0157380_10091071 | 3300014326 | Unclassified | 2517 |
| 202 | Ga0157377_10048852 | 3300014745 | Bacteria | 2376 |
| 203 | Ga0157377_10057043 | 3300014745 | Unclassified | 2219 |
| 204 | Ga0157377_10116665 | 3300014745 | Unclassified | 1612 |
| 205 | Ga0157376_10020206 | 3300014969 | Bacteria | 5147 |
| 206 | Ga0157376_10070904 | 3300014969 | Bacteria | 2959 |
| 207 | Ga0163161_10069207 | 3300017792 | Bacteria | 2580 |
| 208 | Ga0207656_10000968 | 3300025321 | Bacteria | 9398 |
| 209 | Ga0207710_10018751 | 3300025900 | Bacteria | 2945 |
| 210 | Ga0207647_10010631 | 3300025904 | Bacteria | 6490 |
| 211 | Ga0207643_10004210 | 3300025908 | Bacteria | 7753 |
| 212 | Ga0207684_10003111 | 3300025910 | Bacteria | 16372 |
| 213 | Ga0207684_10105697 | 3300025910 | Unclassified | 2408 |
| 214 | Ga0207654_10043701 | 3300025911 | Bacteria | 2541 |
| 215 | Ga0207707_10085820 | 3300025912 | Bacteria | 2751 |
| 216 | Ga0207695_10012301 | 3300025913 | Bacteria | 10280 |
| 217 | Ga0207671_10000811 | 3300025914 | Bacteria | 39493 |
| 218 | Ga0207671_10085197 | 3300025914 | Bacteria | 2374 |
| 219 | Ga0207660_10022337 | 3300025917 | Bacteria | 4262 |
| 220 | Ga0207660_10172783 | 3300025917 | Bacteria | 1674 |
| 221 | Ga0207662_10017969 | 3300025918 | Unclassified | 4005 |
| 222 | Ga0207662_10116734 | 3300025918 | Bacteria | 1669 |
| 223 | Ga0207681_10001566 | 3300025923 | Bacteria | 14713 |
| 224 | Ga0207681_10039186 | 3300025923 | Bacteria | 3144 |
| 225 | Ga0207694_10029685 | 3300025924 | Bacteria | 4173 |
| 226 | Ga0207650_10000028 | 3300025925 | Bacteria | 236867 |
| 227 | Ga0207650_10001960 | 3300025925 | Bacteria | 14467 |
| 228 | Ga0207650_10085629 | 3300025925 | Bacteria | 2398 |
| 229 | Ga0207650_10091366 | 3300025925 | Bacteria | 2326 |
| 230 | Ga0207687_10013396 | 3300025927 | Bacteria | 5353 |
| 231 | Ga0207706_10071662 | 3300025933 | Bacteria | 3048 |
| 232 | Ga0207686_10055558 | 3300025934 | Bacteria | 2485 |
| 233 | Ga0207709_10066185 | 3300025935 | Bacteria | 2275 |
| 234 | Ga0207670_10083439 | 3300025936 | Bacteria | 2241 |
| 235 | Ga0207691_10006094 | 3300025940 | Bacteria | 11654 |
| 236 | Ga0207691_10077284 | 3300025940 | Unclassified | 2999 |
| 237 | Ga0207691_10124785 | 3300025940 | Bacteria | 2279 |
| 238 | Ga0207711_10254127 | 3300025941 | Bacteria | 1614 |
| 239 | Ga0207689_10009036 | 3300025942 | Bacteria | 8629 |
| 240 | Ga0207689_10110374 | 3300025942 | Bacteria | 2260 |
| 241 | Ga0207689_10208722 | 3300025942 | Bacteria | 1613 |
| 242 | Ga0207689_10234509 | 3300025942 | Unclassified | 1517 |
| 243 | Ga0207651_10010066 | 3300025960 | Bacteria | 5219 |
| 244 | Ga0207651_10092091 | 3300025960 | Unclassified | 2222 |
| 245 | Ga0207640_10124580 | 3300025981 | Unclassified | 1853 |
| 246 | Ga0207658_10271408 | 3300025986 | Bacteria | 1450 |
| 247 | Ga0207703_10043765 | 3300026035 | Bacteria | 3595 |
| 248 | Ga0207708_10000100 | 3300026075 | Bacteria | 65501 |
| 249 | Ga0207708_10005351 | 3300026075 | Bacteria | 9454 |
| 250 | Ga0207708_10030336 | 3300026075 | Bacteria | 4099 |
| 251 | Ga0207708_10070298 | 3300026075 | Unclassified | 2680 |
| 252 | Ga0207708_10121509 | 3300026075 | Bacteria | 2035 |
| 253 | Ga0207702_10331463 | 3300026078 | Bacteria | 1452 |
| 254 | Ga0207641_10026699 | 3300026088 | Bacteria | 4768 |
| 255 | Ga0207641_10059798 | 3300026088 | Bacteria | 3247 |
| 256 | Ga0207641_10154614 | 3300026088 | Bacteria | 2080 |
| 257 | Ga0207641_10196086 | 3300026088 | Bacteria | 1859 |
| 258 | Ga0207648_10007392 | 3300026089 | Bacteria | 10813 |
| 259 | Ga0207648_10014348 | 3300026089 | Bacteria | 7324 |
| 260 | Ga0207676_10004285 | 3300026095 | Bacteria | 10088 |
| 261 | Ga0207676_10035953 | 3300026095 | Bacteria | 3764 |
| 262 | Ga0207676_10081817 | 3300026095 | Bacteria | 2624 |
| 263 | Ga0207676_10142571 | 3300026095 | Bacteria | 2053 |
| 264 | Ga0207676_10184981 | 3300026095 | Bacteria | 1828 |
| 265 | Ga0207676_10277195 | 3300026095 | Bacteria | 1521 |
| 266 | Ga0207674_10024268 | 3300026116 | Bacteria | 6482 |
| 267 | Ga0207674_10062656 | 3300026116 | Bacteria | 3756 |
| 268 | Ga0207675_100002272 | 3300026118 | Bacteria | 19109 |
| 269 | Ga0207675_100017033 | 3300026118 | Bacteria | 6791 |
| 270 | Ga0207675_100225530 | 3300026118 | Bacteria | 1806 |
| 271 | Ga0207683_10013393 | 3300026121 | Bacteria | 6993 |
| 272 | Ga0207428_10045943 | 3300027907 | Bacteria | 3514 |
| 273 | Ga0268265_10032593 | 3300028380 | Bacteria | 3778 |
| 274 | Ga0268265_10139465 | 3300028380 | Bacteria | 2028 |
| 275 | Ga0268265_10145459 | 3300028380 | Bacteria | 1991 |
| 276 | Ga0268264_10003455 | 3300028381 | Bacteria | 13625 |
| 277 | Ga0268264_10012599 | 3300028381 | Bacteria | 6966 |
| 278 | Ga0307407_10164579 | 3300031903 | Unclassified | 1455 |
| 279 | Ga0307412_10019547 | 3300031911 | Bacteria | 4105 |
| 280 | Ga0307412_10070504 | 3300031911 | Unclassified | 2383 |
| 281 | Ga0307409_100381359 | 3300031995 | Unclassified | 1340 |
| 282 | Ga0307411_10005717 | 3300032005 | Bacteria | 6146 |
| 283 | Ga0373951_0001753 | 3300035091 | Bacteria | 5645 |
| 284 | Ga0373942_0004279 | 3300035207 | Bacteria | 3324 |
| 285 | Ga0373937_0019888 | 3300036401 | Bacteria | 6014 |
| 286 | Ga0395900_0142969 | 3300037418 | Bacteria | 2449 |
| 287 | Ga0395898_0115990 | 3300037466 | Bacteria | 2566 |
| 288 | Ga0395901_0120997 | 3300038443 | Bacteria | 2751 |
| 289 | Ga0242420_002529 | 3300038996 | Bacteria | 2616 |
| 290 | Ga0439439_0014146 | 3300041406 | Bacteria | 1941 |
| 291 | Ga0496104_0243190 | 3300048907 | Bacteria | 1712 |
| 292 | Ga0496106_0157305 | 3300048909 | Bacteria | 1795 |
| 293 | Ga0496112_0178438 | 3300048915 | Unclassified | 2088 |
| 294 | Ga0501077_0164460 | 3300049593 | Unclassified | 1409 |
| 295 | Ga0501233_005436 | 3300049668 | Bacteria | 2365 |
| 296 | Ga0501234_004746 | 3300049707 | Bacteria | 2132 |
| 297 | Ga0501212_003317 | 3300049851 | Bacteria | 2011 |
| 298 | nmdc:mga05p37_4358_c1 | 3300050507 | Bacteria | 16518 |
| 299 | nmdc:mga0qj67_199065_c1 | 3300050509 | Bacteria | 1628 |
| 300 | nmdc:mga06r32_114226_c1 | 3300050510 | Bacteria | 2658 |
| 301 | nmdc:mga06r32_88930_c1 | 3300050510 | Bacteria | 3015 |
| 302 | nmdc:mga08y16_19098_c1 | 3300050511 | Bacteria | 7222 |
| 303 | nmdc:mga08y16_47497_c1 | 3300050511 | Bacteria | 4493 |
| 304 | nmdc:mga08y16_7194_c1 | 3300050511 | Bacteria | 11678 |
| 305 | nmdc:mga0n895_183245_c1 | 3300050512 | Unclassified | 2125 |
| 306 | nmdc:mga0n895_31440_c1 | 3300050512 | Bacteria | 5083 |
| 307 | nmdc:mga0rr50_33504_c2 | 3300050513 | Unclassified | 1748 |
| 308 | nmdc:mga0a205_17126_c1 | 3300050515 | Bacteria | 6787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031903 | Ga0307407_10164579 | Ga0307407_101645792 | 299 |
| 2 | 3300009174 | Ga0105241_10060314 | Ga0105241_100603143 | 319 |
| 3 | 3300009553 | Ga0105249_10084565 | Ga0105249_100845654 | 319 |
| 4 | 3300013306 | Ga0163162_10214037 | Ga0163162_102140372 | 319 |
| 5 | 3300009147 | Ga0114129_10105412 | Ga0114129_101054122 | 325 |
| 6 | 3300025942 | Ga0207689_10208722 | Ga0207689_102087222 | 331 |
| 7 | 3300048915 | Ga0496112_0178438 | Ga0496112_0178438_990_2054 | 342 |
| 8 | 3300005444 | Ga0070694_100044665 | Ga0070694_1000446653 | 345 |
| 9 | 3300038996 | Ga0242420_002529 | Ga0242420_002529_699_1763 | 349 |
| 10 | 3300009147 | Ga0114129_10007532 | Ga0114129_100075326 | 357 |
| 11 | 3300050507 | nmdc:mga05p37_4358_c1 | nmdc:mga05p37_4358_c1_954_2057 | 357 |
| 12 | 3300003322 | rootL2_10067334 | rootL2_100673344 | 360 |
| 13 | 3300031911 | Ga0307412_10070504 | Ga0307412_100705042 | 361 |
| 14 | 3300005518 | Ga0070699_100051811 | Ga0070699_1000518113 | 362 |
| 15 | 3300005293 | Ga0065715_10112763 | Ga0065715_101127632 | 363 |
| 16 | 3300005328 | Ga0070676_10024342 | Ga0070676_100243424 | 363 |
| 17 | 3300005330 | Ga0070690_100034594 | Ga0070690_1000345943 | 363 |
| 18 | 3300005334 | Ga0068869_100154195 | Ga0068869_1001541951 | 363 |
| 19 | 3300005338 | Ga0068868_100018333 | Ga0068868_1000183334 | 363 |
| 20 | 3300005343 | Ga0070687_100024776 | Ga0070687_1000247762 | 363 |
| 21 | 3300005354 | Ga0070675_100114680 | Ga0070675_1001146802 | 363 |
| 22 | 3300005355 | Ga0070671_100183592 | Ga0070671_1001835922 | 363 |
| 23 | 3300005356 | Ga0070674_100042476 | Ga0070674_1000424762 | 363 |
| 24 | 3300005367 | Ga0070667_100037415 | Ga0070667_1000374153 | 363 |
| 25 | 3300005456 | Ga0070678_100045912 | Ga0070678_1000459123 | 363 |
| 26 | 3300005459 | Ga0068867_100059690 | Ga0068867_1000596903 | 363 |
| 27 | 3300005466 | Ga0070685_10013990 | Ga0070685_100139903 | 363 |
| 28 | 3300005544 | Ga0070686_100043266 | Ga0070686_1000432663 | 363 |
| 29 | 3300005615 | Ga0070702_100015059 | Ga0070702_1000150593 | 363 |
| 30 | 3300005617 | Ga0068859_100064126 | Ga0068859_1000641263 | 363 |
| 31 | 3300005618 | Ga0068864_100071441 | Ga0068864_1000714413 | 363 |
| 32 | 3300005719 | Ga0068861_100019636 | Ga0068861_1000196363 | 363 |
| 33 | 3300005840 | Ga0068870_10021000 | Ga0068870_100210002 | 363 |
| 34 | 3300005841 | Ga0068863_100130489 | Ga0068863_1001304892 | 363 |
| 35 | 3300005842 | Ga0068858_100101699 | Ga0068858_1001016993 | 363 |
| 36 | 3300006237 | Ga0097621_100129684 | Ga0097621_1001296841 | 363 |
| 37 | 3300006358 | Ga0068871_100027863 | Ga0068871_1000278635 | 363 |
| 38 | 3300006931 | Ga0097620_100064125 | Ga0097620_1000641254 | 363 |
| 39 | 3300009098 | Ga0105245_10028085 | Ga0105245_100280854 | 363 |
| 40 | 3300009148 | Ga0105243_10006941 | Ga0105243_100069416 | 363 |
| 41 | 3300009174 | Ga0105241_10104377 | Ga0105241_101043772 | 363 |
| 42 | 3300009176 | Ga0105242_10037546 | Ga0105242_100375463 | 363 |
| 43 | 3300009177 | Ga0105248_10106863 | Ga0105248_101068632 | 363 |
| 44 | 3300013297 | Ga0157378_10149631 | Ga0157378_101496312 | 363 |
| 45 | 3300013308 | Ga0157375_10049117 | Ga0157375_100491174 | 363 |
| 46 | 3300014325 | Ga0163163_10098328 | Ga0163163_100983282 | 363 |
| 47 | 3300014326 | Ga0157380_10039687 | Ga0157380_100396873 | 363 |
| 48 | 3300014745 | Ga0157377_10048852 | Ga0157377_100488523 | 363 |
| 49 | 3300014969 | Ga0157376_10020206 | Ga0157376_100202064 | 363 |
| 50 | 3300017792 | Ga0163161_10069207 | Ga0163161_100692072 | 363 |
| 51 | 3300025918 | Ga0207662_10116734 | Ga0207662_101167342 | 363 |
| 52 | 3300025927 | Ga0207687_10013396 | Ga0207687_100133963 | 363 |
| 53 | 3300025936 | Ga0207670_10083439 | Ga0207670_100834392 | 363 |
| 54 | 3300025940 | Ga0207691_10006094 | Ga0207691_100060948 | 363 |
| 55 | 3300025942 | Ga0207689_10009036 | Ga0207689_100090367 | 363 |
| 56 | 3300025960 | Ga0207651_10092091 | Ga0207651_100920912 | 363 |
| 57 | 3300025986 | Ga0207658_10271408 | Ga0207658_102714081 | 363 |
| 58 | 3300026088 | Ga0207641_10154614 | Ga0207641_101546142 | 363 |
| 59 | 3300026089 | Ga0207648_10007392 | Ga0207648_100073922 | 363 |
| 60 | 3300026095 | Ga0207676_10035953 | Ga0207676_100359533 | 363 |
| 61 | 3300026121 | Ga0207683_10013393 | Ga0207683_100133932 | 363 |
| 62 | 3300013308 | Ga0157375_10070604 | Ga0157375_100706043 | 366 |
| 63 | 3300050510 | nmdc:mga06r32_114226_c1 | nmdc:mga06r32_114226_c1_543_1697 | 366 |
| 64 | 3300009174 | Ga0105241_10111175 | Ga0105241_101111752 | 367 |
| 65 | 3300025911 | Ga0207654_10043701 | Ga0207654_100437012 | 367 |
| 66 | 3300031995 | Ga0307409_100381359 | Ga0307409_1003813591 | 368 |
| 67 | 3300005337 | Ga0070682_100049440 | Ga0070682_1000494403 | 370 |
| 68 | 3300005615 | Ga0070702_100007298 | Ga0070702_1000072982 | 370 |
| 69 | 3300006173 | Ga0070716_100019390 | Ga0070716_1000193902 | 371 |
| 70 | 3300005539 | Ga0068853_100011691 | Ga0068853_1000116919 | 372 |
| 71 | 3300025942 | Ga0207689_10110374 | Ga0207689_101103742 | 372 |
| 72 | 3300005618 | Ga0068864_100160842 | Ga0068864_1001608422 | 373 |
| 73 | 3300006871 | Ga0075434_100091024 | Ga0075434_1000910242 | 373 |
| 74 | 3300025904 | Ga0207647_10010631 | Ga0207647_100106314 | 373 |
| 75 | 3300025918 | Ga0207662_10017969 | Ga0207662_100179692 | 373 |
| 76 | 3300025925 | Ga0207650_10085629 | Ga0207650_100856292 | 373 |
| 77 | 3300026095 | Ga0207676_10142571 | Ga0207676_101425712 | 373 |
| 78 | 3300050512 | nmdc:mga0n895_183245_c1 | nmdc:mga0n895_183245_c1_890_2068 | 373 |
| 79 | 3300005353 | Ga0070669_100003437 | Ga0070669_10000343710 | 374 |
| 80 | 3300005549 | Ga0070704_100021692 | Ga0070704_1000216924 | 374 |
| 81 | 3300005834 | Ga0068851_10000522 | Ga0068851_1000052217 | 374 |
| 82 | 3300005840 | Ga0068870_10004832 | Ga0068870_100048327 | 374 |
| 83 | 3300009545 | Ga0105237_10001434 | Ga0105237_1000143416 | 374 |
| 84 | 3300025321 | Ga0207656_10000968 | Ga0207656_100009689 | 374 |
| 85 | 3300025908 | Ga0207643_10004210 | Ga0207643_100042106 | 374 |
| 86 | 3300025914 | Ga0207671_10000811 | Ga0207671_1000081126 | 374 |
| 87 | 3300025923 | Ga0207681_10001566 | Ga0207681_100015667 | 374 |
| 88 | 3300025925 | Ga0207650_10001960 | Ga0207650_1000196011 | 374 |
| 89 | 3300005518 | Ga0070699_100007620 | Ga0070699_1000076202 | 375 |
| 90 | 3300009094 | Ga0111539_10132593 | Ga0111539_101325932 | 375 |
| 91 | 3300037418 | Ga0395900_0142969 | Ga0395900_0142969_425_1582 | 375 |
| 92 | 3300037466 | Ga0395898_0115990 | Ga0395898_0115990_1270_2427 | 375 |
| 93 | 3300005545 | Ga0070695_100028200 | Ga0070695_1000282002 | 376 |
| 94 | 3300005547 | Ga0070693_100002095 | Ga0070693_1000020954 | 376 |
| 95 | 3300005618 | Ga0068864_100008141 | Ga0068864_1000081412 | 376 |
| 96 | 3300006846 | Ga0075430_100044090 | Ga0075430_1000440903 | 376 |
| 97 | 3300006880 | Ga0075429_100061153 | Ga0075429_1000611532 | 376 |
| 98 | 3300009147 | Ga0114129_10072372 | Ga0114129_100723722 | 376 |
| 99 | 3300050510 | nmdc:mga06r32_88930_c1 | nmdc:mga06r32_88930_c1_1742_2902 | 376 |
| 100 | 3300009551 | Ga0105238_10075607 | Ga0105238_100756074 | 377 |
| 101 | 3300013297 | Ga0157378_10004006 | Ga0157378_1000400610 | 377 |
| 102 | 3300025924 | Ga0207694_10029685 | Ga0207694_100296854 | 377 |
| 103 | 3300038443 | Ga0395901_0120997 | Ga0395901_0120997_47_1195 | 377 |
| 104 | 3300050509 | nmdc:mga0qj67_199065_c1 | nmdc:mga0qj67_199065_c1_87_1250 | 377 |
| 105 | 3300005983 | Ga0081540_1020222 | Ga0081540_10202225 | 379 |
| 106 | 3300013100 | Ga0157373_10031712 | Ga0157373_100317122 | 379 |
| 107 | 3300049593 | Ga0501077_0164460 | Ga0501077_0164460_130_1293 | 379 |
| 108 | 3300005330 | Ga0070690_100024380 | Ga0070690_1000243802 | 380 |
| 109 | 3300005445 | Ga0070708_100043352 | Ga0070708_1000433522 | 380 |
| 110 | 3300005518 | Ga0070699_100022778 | Ga0070699_1000227785 | 380 |
| 111 | 3300005536 | Ga0070697_100000047 | Ga0070697_10000004767 | 380 |
| 112 | 3300005843 | Ga0068860_100006272 | Ga0068860_1000062727 | 380 |
| 113 | 3300005844 | Ga0068862_100131893 | Ga0068862_1001318933 | 380 |
| 114 | 3300013297 | Ga0157378_10286369 | Ga0157378_102863691 | 380 |
| 115 | 3300013306 | Ga0163162_10005207 | Ga0163162_100052075 | 380 |
| 116 | 3300013308 | Ga0157375_10213046 | Ga0157375_102130463 | 380 |
| 117 | 3300028380 | Ga0268265_10145459 | Ga0268265_101454592 | 380 |
| 118 | 3300028381 | Ga0268264_10003455 | Ga0268264_1000345510 | 380 |
| 119 | 3300041406 | Ga0439439_0014146 | Ga0439439_0014146_686_1879 | 380 |
| 120 | 3300005295 | Ga0065707_10001905 | Ga0065707_100019059 | 381 |
| 121 | 3300005445 | Ga0070708_100010874 | Ga0070708_1000108747 | 381 |
| 122 | 3300005467 | Ga0070706_100025364 | Ga0070706_1000253642 | 381 |
| 123 | 3300005471 | Ga0070698_100054763 | Ga0070698_1000547632 | 381 |
| 124 | 3300005471 | Ga0070698_100085875 | Ga0070698_1000858753 | 381 |
| 125 | 3300005518 | Ga0070699_100066937 | Ga0070699_1000669372 | 381 |
| 126 | 3300005536 | Ga0070697_100068249 | Ga0070697_1000682492 | 381 |
| 127 | 3300025910 | Ga0207684_10105697 | Ga0207684_101056971 | 381 |
| 128 | 3300005295 | Ga0065707_10116128 | Ga0065707_101161283 | 383 |
| 129 | 3300005345 | Ga0070692_10023761 | Ga0070692_100237612 | 383 |
| 130 | 3300005441 | Ga0070700_100016710 | Ga0070700_1000167105 | 383 |
| 131 | 3300005444 | Ga0070694_100104321 | Ga0070694_1001043212 | 383 |
| 132 | 3300005719 | Ga0068861_100010722 | Ga0068861_1000107222 | 383 |
| 133 | 3300005844 | Ga0068862_100028030 | Ga0068862_1000280302 | 383 |
| 134 | 3300009094 | Ga0111539_10023715 | Ga0111539_100237155 | 383 |
| 135 | 3300009094 | Ga0111539_10095952 | Ga0111539_100959523 | 383 |
| 136 | 3300009553 | Ga0105249_10136224 | Ga0105249_101362242 | 383 |
| 137 | 3300013297 | Ga0157378_10041333 | Ga0157378_100413335 | 383 |
| 138 | 3300013308 | Ga0157375_10060081 | Ga0157375_100600814 | 383 |
| 139 | 3300014326 | Ga0157380_10067242 | Ga0157380_100672423 | 383 |
| 140 | 3300014745 | Ga0157377_10116665 | Ga0157377_101166652 | 383 |
| 141 | 3300025917 | Ga0207660_10172783 | Ga0207660_101727832 | 383 |
| 142 | 3300025940 | Ga0207691_10124785 | Ga0207691_101247852 | 383 |
| 143 | 3300026075 | Ga0207708_10030336 | Ga0207708_100303362 | 383 |
| 144 | 3300026118 | Ga0207675_100017033 | Ga0207675_1000170337 | 383 |
| 145 | 3300028380 | Ga0268265_10032593 | Ga0268265_100325935 | 383 |
| 146 | 3300050511 | nmdc:mga08y16_47497_c1 | nmdc:mga08y16_47497_c1_771_1964 | 383 |
| 147 | 3300005334 | Ga0068869_100230159 | Ga0068869_1002301592 | 384 |
| 148 | 3300005545 | Ga0070695_100238652 | Ga0070695_1002386521 | 384 |
| 149 | 3300006852 | Ga0075433_10083495 | Ga0075433_100834952 | 384 |
| 150 | 3300006914 | Ga0075436_100016798 | Ga0075436_1000167982 | 384 |
| 151 | 3300009094 | Ga0111539_10020310 | Ga0111539_100203101 | 384 |
| 152 | 3300009553 | Ga0105249_10163152 | Ga0105249_101631522 | 384 |
| 153 | 3300050511 | nmdc:mga08y16_19098_c1 | nmdc:mga08y16_19098_c1_70_1257 | 384 |
| 154 | 3300006358 | Ga0068871_100127889 | Ga0068871_1001278892 | 385 |
| 155 | 3300009094 | Ga0111539_10031059 | Ga0111539_100310596 | 385 |
| 156 | 3300049668 | Ga0501233_005436 | Ga0501233_005436_736_1959 | 385 |
| 157 | 3300049707 | Ga0501234_004746 | Ga0501234_004746_76_1299 | 385 |
| 158 | 3300049851 | Ga0501212_003317 | Ga0501212_003317_713_1936 | 385 |
| 159 | 3300005334 | Ga0068869_100045857 | Ga0068869_1000458573 | 386 |
| 160 | 3300005441 | Ga0070700_100080269 | Ga0070700_1000802692 | 386 |
| 161 | 3300005458 | Ga0070681_10420402 | Ga0070681_104204021 | 386 |
| 162 | 3300005617 | Ga0068859_100017979 | Ga0068859_1000179795 | 386 |
| 163 | 3300005617 | Ga0068859_100134948 | Ga0068859_1001349481 | 386 |
| 164 | 3300005618 | Ga0068864_100165097 | Ga0068864_1001650972 | 386 |
| 165 | 3300005844 | Ga0068862_100097366 | Ga0068862_1000973662 | 386 |
| 166 | 3300006931 | Ga0097620_100017978 | Ga0097620_1000179785 | 386 |
| 167 | 3300006931 | Ga0097620_100134948 | Ga0097620_1001349481 | 386 |
| 168 | 3300013100 | Ga0157373_10014643 | Ga0157373_100146432 | 386 |
| 169 | 3300025912 | Ga0207707_10085820 | Ga0207707_100858201 | 386 |
| 170 | 3300026075 | Ga0207708_10121509 | Ga0207708_101215092 | 386 |
| 171 | 3300026088 | Ga0207641_10026699 | Ga0207641_100266995 | 386 |
| 172 | 3300026095 | Ga0207676_10277195 | Ga0207676_102771952 | 386 |
| 173 | 3300028380 | Ga0268265_10139465 | Ga0268265_101394652 | 386 |
| 174 | 3300031911 | Ga0307412_10019547 | Ga0307412_100195472 | 386 |
| 175 | 3300048907 | Ga0496104_0243190 | Ga0496104_0243190_95_1270 | 386 |
| 176 | 3300005288 | Ga0065714_10064454 | Ga0065714_1006445430 | 387 |
| 177 | 3300005290 | Ga0065712_10000129 | Ga0065712_1000012939 | 387 |
| 178 | 3300005441 | Ga0070700_100000183 | Ga0070700_10000018331 | 387 |
| 179 | 3300005471 | Ga0070698_100009784 | Ga0070698_1000097844 | 387 |
| 180 | 3300005549 | Ga0070704_100053006 | Ga0070704_1000530064 | 387 |
| 181 | 3300005617 | Ga0068859_100020686 | Ga0068859_1000206865 | 387 |
| 182 | 3300005719 | Ga0068861_100000953 | Ga0068861_10000095317 | 387 |
| 183 | 3300006237 | Ga0097621_100023487 | Ga0097621_1000234874 | 387 |
| 184 | 3300006358 | Ga0068871_100081320 | Ga0068871_1000813203 | 387 |
| 185 | 3300006931 | Ga0097620_100020687 | Ga0097620_1000206875 | 387 |
| 186 | 3300009177 | Ga0105248_10183443 | Ga0105248_101834432 | 387 |
| 187 | 3300025941 | Ga0207711_10254127 | Ga0207711_102541272 | 387 |
| 188 | 3300026075 | Ga0207708_10000100 | Ga0207708_100001003 | 387 |
| 189 | 3300026116 | Ga0207674_10024268 | Ga0207674_100242684 | 387 |
| 190 | 3300026118 | Ga0207675_100002272 | Ga0207675_10000227217 | 387 |
| 191 | 3300005615 | Ga0070702_100027726 | Ga0070702_1000277263 | 388 |
| 192 | 3300005843 | Ga0068860_100087008 | Ga0068860_1000870081 | 388 |
| 193 | 3300006237 | Ga0097621_100206042 | Ga0097621_1002060421 | 388 |
| 194 | 3300009094 | Ga0111539_10003191 | Ga0111539_1000319117 | 388 |
| 195 | 3300009147 | Ga0114129_10402146 | Ga0114129_104021462 | 388 |
| 196 | 3300009176 | Ga0105242_10148070 | Ga0105242_101480702 | 388 |
| 197 | 3300025934 | Ga0207686_10055558 | Ga0207686_100555582 | 388 |
| 198 | 3300028381 | Ga0268264_10012599 | Ga0268264_100125997 | 388 |
| 199 | 3300050511 | nmdc:mga08y16_7194_c1 | nmdc:mga08y16_7194_c1_2256_3455 | 388 |
| 200 | 3300005334 | Ga0068869_100118887 | Ga0068869_1001188872 | 389 |
| 201 | 3300005335 | Ga0070666_10043421 | Ga0070666_100434213 | 389 |
| 202 | 3300005355 | Ga0070671_100228577 | Ga0070671_1002285771 | 389 |
| 203 | 3300005364 | Ga0070673_100035314 | Ga0070673_1000353144 | 389 |
| 204 | 3300005564 | Ga0070664_100304751 | Ga0070664_1003047511 | 389 |
| 205 | 3300005617 | Ga0068859_100040274 | Ga0068859_1000402746 | 389 |
| 206 | 3300005618 | Ga0068864_100027352 | Ga0068864_1000273523 | 389 |
| 207 | 3300005841 | Ga0068863_100348316 | Ga0068863_1003483162 | 389 |
| 208 | 3300005843 | Ga0068860_100105411 | Ga0068860_1001054113 | 389 |
| 209 | 3300006237 | Ga0097621_100002401 | Ga0097621_1000024014 | 389 |
| 210 | 3300006358 | Ga0068871_100015963 | Ga0068871_1000159633 | 389 |
| 211 | 3300006931 | Ga0097620_100040270 | Ga0097620_1000402701 | 389 |
| 212 | 3300009177 | Ga0105248_10005056 | Ga0105248_1000505613 | 389 |
| 213 | 3300013296 | Ga0157374_10009323 | Ga0157374_100093232 | 389 |
| 214 | 3300013308 | Ga0157375_10003749 | Ga0157375_100037494 | 389 |
| 215 | 3300014325 | Ga0163163_10004417 | Ga0163163_1000441713 | 389 |
| 216 | 3300014969 | Ga0157376_10070904 | Ga0157376_100709043 | 389 |
| 217 | 3300026035 | Ga0207703_10043765 | Ga0207703_100437655 | 389 |
| 218 | 3300026088 | Ga0207641_10059798 | Ga0207641_100597982 | 389 |
| 219 | 3300036401 | Ga0373937_0019888 | Ga0373937_0019888_79_1287 | 389 |
| 220 | 3300005340 | Ga0070689_100011753 | Ga0070689_1000117533 | 390 |
| 221 | 3300005353 | Ga0070669_100053633 | Ga0070669_1000536333 | 390 |
| 222 | 3300005547 | Ga0070693_100011085 | Ga0070693_1000110852 | 390 |
| 223 | 3300005618 | Ga0068864_100066388 | Ga0068864_1000663882 | 390 |
| 224 | 3300005719 | Ga0068861_100155557 | Ga0068861_1001555572 | 390 |
| 225 | 3300006852 | Ga0075433_10040433 | Ga0075433_100404333 | 390 |
| 226 | 3300026095 | Ga0207676_10081817 | Ga0207676_100818174 | 390 |
| 227 | 3300026118 | Ga0207675_100225530 | Ga0207675_1002255302 | 390 |
| 228 | 3300027907 | Ga0207428_10045943 | Ga0207428_100459434 | 390 |
| 229 | 3300050512 | nmdc:mga0n895_31440_c1 | nmdc:mga0n895_31440_c1_1407_2630 | 390 |
| 230 | 3300050515 | nmdc:mga0a205_17126_c1 | nmdc:mga0a205_17126_c1_4345_5568 | 390 |
| 231 | 3300005293 | Ga0065715_10092364 | Ga0065715_100923646 | 391 |
| 232 | 3300005336 | Ga0070680_100047474 | Ga0070680_1000474744 | 391 |
| 233 | 3300005364 | Ga0070673_100018481 | Ga0070673_1000184813 | 391 |
| 234 | 3300005440 | Ga0070705_100053708 | Ga0070705_1000537082 | 391 |
| 235 | 3300005441 | Ga0070700_100045523 | Ga0070700_1000455233 | 391 |
| 236 | 3300005444 | Ga0070694_100018725 | Ga0070694_1000187255 | 391 |
| 237 | 3300005458 | Ga0070681_10024675 | Ga0070681_100246754 | 391 |
| 238 | 3300005471 | Ga0070698_100048641 | Ga0070698_1000486412 | 391 |
| 239 | 3300005518 | Ga0070699_100162286 | Ga0070699_1001622862 | 391 |
| 240 | 3300005530 | Ga0070679_100319462 | Ga0070679_1003194622 | 391 |
| 241 | 3300005546 | Ga0070696_100016197 | Ga0070696_1000161973 | 391 |
| 242 | 3300005546 | Ga0070696_100073052 | Ga0070696_1000730522 | 391 |
| 243 | 3300005549 | Ga0070704_100079904 | Ga0070704_1000799043 | 391 |
| 244 | 3300005578 | Ga0068854_100083071 | Ga0068854_1000830712 | 391 |
| 245 | 3300005617 | Ga0068859_100028049 | Ga0068859_1000280496 | 391 |
| 246 | 3300006931 | Ga0097620_100028049 | Ga0097620_1000280492 | 391 |
| 247 | 3300014326 | Ga0157380_10091071 | Ga0157380_100910712 | 391 |
| 248 | 3300025914 | Ga0207671_10085197 | Ga0207671_100851973 | 391 |
| 249 | 3300025917 | Ga0207660_10022337 | Ga0207660_100223374 | 391 |
| 250 | 3300025933 | Ga0207706_10071662 | Ga0207706_100716622 | 391 |
| 251 | 3300025942 | Ga0207689_10234509 | Ga0207689_102345092 | 391 |
| 252 | 3300025960 | Ga0207651_10010066 | Ga0207651_100100663 | 391 |
| 253 | 3300025981 | Ga0207640_10124580 | Ga0207640_101245802 | 391 |
| 254 | 3300026075 | Ga0207708_10070298 | Ga0207708_100702983 | 391 |
| 255 | 3300026078 | Ga0207702_10331463 | Ga0207702_103314631 | 391 |
| 256 | 3300026088 | Ga0207641_10196086 | Ga0207641_101960861 | 391 |
| 257 | 3300026116 | Ga0207674_10062656 | Ga0207674_100626562 | 391 |
| 258 | 3300048909 | Ga0496106_0157305 | Ga0496106_0157305_568_1752 | 391 |
| 259 | 3300005459 | Ga0068867_100072109 | Ga0068867_1000721092 | 392 |
| 260 | 3300005467 | Ga0070706_100112225 | Ga0070706_1001122252 | 392 |
| 261 | 3300005617 | Ga0068859_100012730 | Ga0068859_1000127307 | 392 |
| 262 | 3300006844 | Ga0075428_100065354 | Ga0075428_1000653542 | 392 |
| 263 | 3300006931 | Ga0097620_100012730 | Ga0097620_1000127305 | 392 |
| 264 | 3300009101 | Ga0105247_10083365 | Ga0105247_100833652 | 392 |
| 265 | 3300009147 | Ga0114129_10046827 | Ga0114129_100468275 | 392 |
| 266 | 3300009148 | Ga0105243_10087951 | Ga0105243_100879512 | 392 |
| 267 | 3300011119 | Ga0105246_10056159 | Ga0105246_100561592 | 392 |
| 268 | 3300013307 | Ga0157372_10003705 | Ga0157372_1000370513 | 392 |
| 269 | 3300025913 | Ga0207695_10012301 | Ga0207695_1001230110 | 392 |
| 270 | 3300025935 | Ga0207709_10066185 | Ga0207709_100661852 | 392 |
| 271 | 3300026089 | Ga0207648_10014348 | Ga0207648_100143481 | 392 |
| 272 | 3300032005 | Ga0307411_10005717 | Ga0307411_100057172 | 393 |
| 273 | 3300005471 | Ga0070698_100009833 | Ga0070698_1000098334 | 394 |
| 274 | 3300005290 | Ga0065712_10072461 | Ga0065712_100724613 | 395 |
| 275 | 3300005293 | Ga0065715_10017966 | Ga0065715_100179663 | 395 |
| 276 | 3300005331 | Ga0070670_100125037 | Ga0070670_1001250372 | 395 |
| 277 | 3300005467 | Ga0070706_100000044 | Ga0070706_10000004478 | 395 |
| 278 | 3300009101 | Ga0105247_10045259 | Ga0105247_100452593 | 395 |
| 279 | 3300025900 | Ga0207710_10018751 | Ga0207710_100187513 | 395 |
| 280 | 3300025910 | Ga0207684_10003111 | Ga0207684_100031119 | 395 |
| 281 | 3300025925 | Ga0207650_10091366 | Ga0207650_100913662 | 395 |
| 282 | 3300050513 | nmdc:mga0rr50_33504_c2 | nmdc:mga0rr50_33504_c2_199_1401 | 395 |
| 283 | 3300003203 | JGI25406J46586_10001728 | JGI25406J46586_100017285 | 396 |
| 284 | 3300005985 | Ga0081539_10001299 | Ga0081539_100012996 | 396 |
| 285 | 3300035091 | Ga0373951_0001753 | Ga0373951_0001753_251_1453 | 396 |
| 286 | 3300035207 | Ga0373942_0004279 | Ga0373942_0004279_2017_3216 | 396 |
| 287 | 3300005441 | Ga0070700_100037499 | Ga0070700_1000374993 | 397 |
| 288 | 3300005444 | Ga0070694_100073415 | Ga0070694_1000734151 | 397 |
| 289 | 3300005618 | Ga0068864_100004786 | Ga0068864_1000047865 | 397 |
| 290 | 3300005841 | Ga0068863_100084998 | Ga0068863_1000849982 | 397 |
| 291 | 3300014325 | Ga0163163_10014244 | Ga0163163_100142445 | 397 |
| 292 | 3300014745 | Ga0157377_10057043 | Ga0157377_100570432 | 397 |
| 293 | 3300025940 | Ga0207691_10077284 | Ga0207691_100772842 | 397 |
| 294 | 3300026075 | Ga0207708_10005351 | Ga0207708_100053514 | 397 |
| 295 | 3300026095 | Ga0207676_10004285 | Ga0207676_100042858 | 397 |
| 296 | 3300026095 | Ga0207676_10184981 | Ga0207676_101849812 | 397 |
| 297 | 3300002459 | JGI24751J29686_10000006 | JGI24751J29686_1000000630 | 398 |
| 298 | 3300005331 | Ga0070670_100007756 | Ga0070670_1000077564 | 398 |
| 299 | 3300005353 | Ga0070669_100023412 | Ga0070669_1000234123 | 398 |
| 300 | 3300005518 | Ga0070699_100006601 | Ga0070699_1000066016 | 398 |
| 301 | 3300005536 | Ga0070697_100021222 | Ga0070697_1000212224 | 398 |
| 302 | 3300005616 | Ga0068852_100105642 | Ga0068852_1001056423 | 398 |
| 303 | 3300009551 | Ga0105238_10028161 | Ga0105238_100281616 | 398 |
| 304 | 3300009553 | Ga0105249_10033305 | Ga0105249_100333052 | 398 |
| 305 | 3300013306 | Ga0163162_10275842 | Ga0163162_102758422 | 398 |
| 306 | 3300014325 | Ga0163163_10007544 | Ga0163163_100075445 | 398 |
| 307 | 3300025923 | Ga0207681_10039186 | Ga0207681_100391863 | 398 |
| 308 | 3300025925 | Ga0207650_10000028 | Ga0207650_10000028114 | 398 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4m0n-assembly1.cif.gz_A | crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 1.65 a resolution | 0.7318 | 149 | 284 |
| 4m0h-assembly2.cif.gz_B | crystal structure of a putative anti-sigma factor (bdi_1681) from parabacteroides distasonis atcc 8503 at 2.50 a resolution | 0.7292 | 149 | 284 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6946 | 3 | 55 |
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.6581 | 6 | 68 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6562 | 3 | 55 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4m0hB01 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7877 | 149 | 265 | 2.60.120.1440 |
| af_P23485_97_238_2.60.120.1440 | Mainly Beta;Sandwich;Jelly Rolls; | 0.7831 | 151 | 275 | 2.60.120.1440 |
| af_F4HSZ1_1_345_1.25.10.10 | Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant | 0.7032 | 276 | 335 | 1.25.10.10 |
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6946 | 3 | 55 | 1.10.10.1320 |
| af_P23485_97_238_2.60.120.1440 | Mainly Beta;Sandwich;Jelly Rolls; | 0.6945 | 151 | 275 | 2.60.120.1440 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8ZB06-F1-model_v4 | FecR domain-containing protein | 0.9658 | 121 | 366 |
|
| AF-A0A2V7S9B5-F1-model_v4 | FecR protein domain-containing protein | 0.9425 | 124 | 366 |
|
| AF-A0A7V8ZB06-F1-model_v4 | FecR domain-containing protein | 0.9288 | 121 | 366 |
|
| AF-A0A2V7PJQ8-F1-model_v4 | FecR protein domain-containing protein | 0.9227 | 149 | 360 |
|
| AF-A0A1L6LE89-F1-model_v4 | deleted | 0.9216 | 112 | 364 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar