F399486

General Info

Members Datasets Scaffolds Average Seq Length
308 237 616 119

Family's Representative Sequence

Representative Sequence 3300002075|JGI24738J21930_10054305|JGI24738J21930_100543052
Length 123
Sequence MHPKDAIGRYGEQLAAHHLRRTGLTLLARNWRCPEGEVDIVASDGDVLVFCEVKTRSSTAFGWPAEAVGSAKAARLRRLAACYLAEQRPMTRRGFWPDVRFDVVSVVQERPGVAQVEHLQGVL

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
234 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
235 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
236 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
237 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.97
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 5.52
Nodule 0
Rhizoplane 6.17
Rhizosphere 86.04
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10054305 3300002075 Bacteria 818
2 Ga0070658_10003761 3300005327 Bacteria 12421
3 Ga0070658_10102536 3300005327 Bacteria 2366
4 Ga0070658_10284948 3300005327 Bacteria 1407
5 Ga0070658_10342605 3300005327 Bacteria 1278
6 Ga0070658_10958673 3300005327 Bacteria 744
7 Ga0070676_10430149 3300005328 Unclassified 924
8 Ga0070683_102041016 3300005329 Bacteria 551
9 Ga0070670_102263442 3300005331 Bacteria 501
10 Ga0068869_100145175 3300005334 Bacteria 1836
11 Ga0070666_11080095 3300005335 Bacteria 596
12 Ga0070680_100009555 3300005336 Bacteria 7449
13 Ga0070680_100324951 3300005336 Bacteria 1306
14 Ga0070682_101480620 3300005337 Bacteria 583
15 Ga0068868_100044924 3300005338 Bacteria 3455
16 Ga0070660_100018239 3300005339 Bacteria 5125
17 Ga0070660_100100432 3300005339 Bacteria 2292
18 Ga0070660_100153820 3300005339 Bacteria 1851
19 Ga0070660_100320836 3300005339 Bacteria 1272
20 Ga0070660_100331608 3300005339 Unclassified 1251
21 Ga0070689_100401332 3300005340 Bacteria 1159
22 Ga0070661_100361739 3300005344 Bacteria 1141
23 Ga0070668_100038685 3300005347 Bacteria 3647
24 Ga0070668_100126996 3300005347 Bacteria 2043
25 Ga0070669_100566216 3300005353 Bacteria 949
26 Ga0070675_100333130 3300005354 Bacteria 1343
27 Ga0070671_100188997 3300005355 Bacteria 1745
28 Ga0070671_100614282 3300005355 Unclassified 940
29 Ga0070674_100128676 3300005356 Bacteria 1885
30 Ga0070673_100316401 3300005364 Bacteria 1378
31 Ga0070659_100494860 3300005366 Unclassified 1042
32 Ga0070667_100828099 3300005367 Bacteria 860
33 Ga0070667_101952571 3300005367 Unclassified 553
34 Ga0070709_10297177 3300005434 Bacteria 1178
35 Ga0070714_100196518 3300005435 Bacteria 1843
36 Ga0070714_101029054 3300005435 Bacteria 802
37 Ga0070713_101113091 3300005436 Unclassified 763
38 Ga0070710_10033418 3300005437 Bacteria 2793
39 Ga0070701_10864647 3300005438 Bacteria 622
40 Ga0070711_100069492 3300005439 Bacteria 2477
41 Ga0070705_100204491 3300005440 Bacteria 1356
42 Ga0070700_100210789 3300005441 Bacteria 1371
43 Ga0070694_100115759 3300005444 Bacteria 1916
44 Ga0070678_100365487 3300005456 Bacteria 1244
45 Ga0070678_100794179 3300005456 Bacteria 859
46 Ga0070662_100019585 3300005457 Bacteria 4595
47 Ga0070681_10031054 3300005458 Bacteria 5362
48 Ga0070681_10286688 3300005458 Bacteria 1557
49 Ga0068867_100752277 3300005459 Bacteria 865
50 Ga0070685_10065276 3300005466 Bacteria 2142
51 Ga0070699_100742958 3300005518 Bacteria 897
52 Ga0070679_100022758 3300005530 Bacteria 6129
53 Ga0070679_100966821 3300005530 Unclassified 795
54 Ga0070684_101520274 3300005535 Bacteria 631
55 Ga0070697_100318915 3300005536 Bacteria 1338
56 Ga0068853_100075759 3300005539 Bacteria 2937
57 Ga0070686_100637380 3300005544 Bacteria 844
58 Ga0070695_101218741 3300005545 Bacteria 619
59 Ga0070696_100557801 3300005546 Bacteria 919
60 Ga0070665_101951816 3300005548 Unclassified 592
61 Ga0070704_100098455 3300005549 Bacteria 2197
62 Ga0068855_100030934 3300005563 Bacteria 6397
63 Ga0068857_101077471 3300005577 Bacteria 775
64 Ga0068854_100105175 3300005578 Bacteria 2121
65 Ga0068856_100349812 3300005614 Bacteria 1496
66 Ga0070702_100054662 3300005615 Bacteria 2299
67 Ga0068852_100734766 3300005616 Bacteria 998
68 Ga0068864_100046091 3300005618 Bacteria 3740
69 Ga0068866_10108967 3300005718 Bacteria 1541
70 Ga0068851_10440332 3300005834 Bacteria 773
71 Ga0068863_100484747 3300005841 Bacteria 1216
72 Ga0068858_100130676 3300005842 Bacteria 2354
73 Ga0068862_100428617 3300005844 Bacteria 1243
74 Ga0081540_1000870 3300005983 Bacteria 27348
75 Ga0070717_10305679 3300006028 Bacteria 1414
76 Ga0075365_10086651 3300006038 Bacteria 2129
77 Ga0075365_10345234 3300006038 Bacteria 1049
78 Ga0075368_10567603 3300006042 Bacteria 511
79 Ga0070716_100054774 3300006173 Bacteria 2280
80 Ga0070712_100154895 3300006175 Bacteria 1763
81 Ga0075362_10639385 3300006177 Bacteria 552
82 Ga0075367_10156315 3300006178 Bacteria 1417
83 Ga0075367_10434176 3300006178 Bacteria 832
84 Ga0097621_100325837 3300006237 Bacteria 1361
85 Ga0075433_10099539 3300006852 Bacteria 2574
86 Ga0075436_100075821 3300006914 Bacteria 2329
87 Ga0075435_100108910 3300007076 Bacteria 2302
88 Ga0075435_100305448 3300007076 Bacteria 1361
89 Ga0105251_10124062 3300009011 Bacteria 1172
90 Ga0105244_10007233 3300009036 Bacteria 7076
91 Ga0105240_10212196 3300009093 Bacteria 2261
92 Ga0105245_10009072 3300009098 Bacteria 8665
93 Ga0105245_10091388 3300009098 Bacteria 2801
94 Ga0105245_10771825 3300009098 Bacteria 998
95 Ga0105247_11076389 3300009101 Unclassified 633
96 Ga0105243_10169066 3300009148 Bacteria 1892
97 Ga0105242_10019384 3300009176 Bacteria 5330
98 Ga0105242_10034967 3300009176 Bacteria 4029
99 Ga0105242_10037963 3300009176 Bacteria 3871
100 Ga0105248_10083098 3300009177 Bacteria 3603
101 Ga0105248_12073283 3300009177 Bacteria 646
102 Ga0105237_11182212 3300009545 Unclassified 771
103 Ga0105238_10095736 3300009551 Bacteria 2955
104 Ga0105249_10148652 3300009553 Bacteria 2253
105 Ga0105239_10060316 3300010375 Bacteria 4163
106 Ga0105239_10249897 3300010375 Bacteria 1992
107 Ga0105239_10996855 3300010375 Bacteria 963
108 Ga0105246_10139115 3300011119 Bacteria 1824
109 Ga0157338_1026836 3300012515 Bacteria 710
110 Ga0157371_10702042 3300013102 Bacteria 757
111 Ga0157370_10132437 3300013104 Bacteria 2325
112 Ga0157369_10287358 3300013105 Bacteria 1712
113 Ga0157369_10615187 3300013105 Bacteria 1121
114 Ga0157374_10206212 3300013296 Bacteria 1926
115 Ga0157374_11269245 3300013296 Bacteria 758
116 Ga0157374_11873085 3300013296 Bacteria 625
117 Ga0157378_10225095 3300013297 Bacteria 1785
118 Ga0157378_10366652 3300013297 Bacteria 1411
119 Ga0157378_13064509 3300013297 Bacteria 519
120 Ga0163162_10012630 3300013306 Bacteria 8246
121 Ga0163162_12562269 3300013306 Unclassified 587
122 Ga0157372_10017208 3300013307 Bacteria 7760
123 Ga0157372_10478691 3300013307 Bacteria 1451
124 Ga0163163_10989187 3300014325 Bacteria 904
125 Ga0157380_10108137 3300014326 Bacteria 2330
126 Ga0157377_10099388 3300014745 Bacteria 1731
127 Ga0157377_10965979 3300014745 Bacteria 642
128 Ga0157376_10033773 3300014969 Bacteria 4123
129 Ga0157376_10274294 3300014969 Bacteria 1586
130 Ga0163161_10001605 3300017792 Bacteria 16683
131 Ga0206354_11388424 3300020081 Unclassified 1031
132 Ga0154015_1027305 3300020610 Bacteria 700
133 Ga0213873_10079387 3300021358 Bacteria 916
134 Ga0213871_10051447 3300021441 Bacteria 1130
135 Ga0224712_10424323 3300022467 Unclassified 636
136 Ga0207680_10096600 3300025903 Bacteria 1890
137 Ga0207647_10067204 3300025904 Bacteria 2173
138 Ga0207699_10239736 3300025906 Bacteria 1245
139 Ga0207705_10000693 3300025909 Bacteria 27904
140 Ga0207705_10271038 3300025909 Bacteria 1298
141 Ga0207705_10672584 3300025909 Bacteria 805
142 Ga0207707_10094818 3300025912 Bacteria 2608
143 Ga0207707_10713951 3300025912 Bacteria 841
144 Ga0207695_10849766 3300025913 Bacteria 793
145 Ga0207671_10046104 3300025914 Bacteria 3225
146 Ga0207693_10016991 3300025915 Bacteria 5810
147 Ga0207660_10036387 3300025917 Bacteria 3422
148 Ga0207660_10793969 3300025917 Bacteria 773
149 Ga0207657_10026432 3300025919 Bacteria 5336
150 Ga0207657_10052330 3300025919 Bacteria 3544
151 Ga0207657_10150436 3300025919 Bacteria 1896
152 Ga0207657_10393503 3300025919 Bacteria 1090
153 Ga0207652_10025321 3300025921 Bacteria 4932
154 Ga0207694_11834700 3300025924 Unclassified 509
155 Ga0207659_10153613 3300025926 Bacteria 1800
156 Ga0207687_10021957 3300025927 Bacteria 4244
157 Ga0207687_10045364 3300025927 Bacteria 3038
158 Ga0207700_10993434 3300025928 Bacteria 751
159 Ga0207664_10350686 3300025929 Bacteria 1306
160 Ga0207644_10458671 3300025931 Bacteria 1048
161 Ga0207690_10375071 3300025932 Unclassified 1129
162 Ga0207706_10007555 3300025933 Bacteria 10057
163 Ga0207686_10033556 3300025934 Bacteria 3065
164 Ga0207686_10204408 3300025934 Unclassified 1416
165 Ga0207709_10228040 3300025935 Bacteria 1348
166 Ga0207670_10730326 3300025936 Unclassified 821
167 Ga0207669_10917090 3300025937 Bacteria 733
168 Ga0207704_10051045 3300025938 Bacteria 2499
169 Ga0207665_10001259 3300025939 Bacteria 17081
170 Ga0207665_10536665 3300025939 Bacteria 907
171 Ga0207711_10311532 3300025941 Bacteria 1453
172 Ga0207689_10069677 3300025942 Bacteria 2890
173 Ga0207661_11384739 3300025944 Bacteria 646
174 Ga0207667_10108501 3300025949 Bacteria 2863
175 Ga0207651_10147142 3300025960 Bacteria 1829
176 Ga0207651_11044768 3300025960 Bacteria 731
177 Ga0207712_10710982 3300025961 Unclassified 878
178 Ga0207640_10170032 3300025981 Bacteria 1623
179 Ga0207658_10737534 3300025986 Bacteria 892
180 Ga0207658_11037029 3300025986 Bacteria 749
181 Ga0207677_10019814 3300026023 Bacteria 4071
182 Ga0207703_10356199 3300026035 Bacteria 1348
183 Ga0207639_10044308 3300026041 Bacteria 3345
184 Ga0207678_10120277 3300026067 Bacteria 2241
185 Ga0207708_10117186 3300026075 Bacteria 2072
186 Ga0207702_10310733 3300026078 Bacteria 1499
187 Ga0207648_10149997 3300026089 Bacteria 2057
188 Ga0207676_10035974 3300026095 Bacteria 3764
189 Ga0207674_10123843 3300026116 Bacteria 2551
190 Ga0207683_10018859 3300026121 Bacteria 5886
191 Ga0207683_10828940 3300026121 Bacteria 859
192 Ga0207698_10096346 3300026142 Bacteria 2438
193 Ga0207698_10747115 3300026142 Bacteria 977
194 Ga0207698_12515164 3300026142 Bacteria 525
195 Ga0209813_10484884 3300027866 Bacteria 511
196 Ga0207428_10276993 3300027907 Bacteria 1246
197 Ga0268266_11720591 3300028379 Unclassified 602
198 Ga0268265_10122128 3300028380 Bacteria 2148
199 Ga0307515_10041669 3300028794 Bacteria 7209
200 Ga0373930_0012597 3300034816 Bacteria 1546
201 Ga0373948_0089206 3300034817 Bacteria 713
202 Ga0373941_0323065 3300035115 Bacteria 621
203 Ga0373960_0028635 3300035121 Bacteria 1539
204 Ga0373961_0051757 3300035241 Bacteria 1220
205 Ga0373961_0133420 3300035241 Bacteria 833
206 Ga0373962_0004994 3300035242 Bacteria 3207
207 Ga0373947_1099744 3300035725 Bacteria 542
208 Ga0373937_0645496 3300036401 Bacteria 1004
209 Ga0436360_0138220 3300039438 Bacteria 3397
210 Ga0436361_0190195 3300039447 Bacteria 630
211 Ga0436361_0589259 3300039447 Bacteria 2220
212 Ga0436363_1255943 3300039450 Unclassified 864
213 Ga0436362_0359813 3300039453 Bacteria 1403
214 Ga0436362_1287763 3300039453 Bacteria 8712
215 Ga0466972_0001690 3300044658 Bacteria 10799
216 Ga0466966_0263530 3300044684 Bacteria 1037
217 Ga0466961_0003066 3300044693 Bacteria 10379
218 Ga0466970_0051197 3300044765 Bacteria 2204
219 Ga0466970_0784377 3300044765 Bacteria 558
220 Ga0466957_0629686 3300044842 Bacteria 753
221 Ga0466959_0025183 3300045049 Bacteria 4408
222 Ga0466959_0288995 3300045049 Bacteria 1124
223 Ga0466959_0493809 3300045049 Bacteria 828
224 Ga0466958_0043074 3300045836 Bacteria 2718
225 Ga0466967_1169850 3300045976 Bacteria 766
226 Ga0466967_1353702 3300045976 Bacteria 709
227 Ga0495592_0371409 3300046454 Bacteria 912
228 Ga0495651_0692262 3300046462 Unclassified 636
229 Ga0495630_0091533 3300046517 Bacteria 2298
230 Ga0495587_0343843 3300046536 Bacteria 832
231 Ga0495646_0122139 3300046680 Bacteria 1473
232 Ga0495647_0553615 3300046681 Bacteria 538
233 Ga0495613_0520628 3300046689 Bacteria 799
234 Ga0495624_0158735 3300046690 Bacteria 1382
235 Ga0495624_0885494 3300046690 Bacteria 526
236 Ga0495674_0372764 3300047319 Bacteria 1156
237 Ga0495676_0609260 3300047321 Bacteria 711
238 Ga0495676_1059906 3300047321 Bacteria 516
239 Ga0496100_1674495 3300048903 Bacteria 503
240 Ga0496101_0967219 3300048904 Bacteria 670
241 Ga0496102_0055804 3300048905 Bacteria 3602
242 Ga0496102_1568241 3300048905 Unclassified 577
243 Ga0496104_0132930 3300048907 Bacteria 2390
244 Ga0496104_0415161 3300048907 Bacteria 1258
245 Ga0496105_0021915 3300048908 Bacteria 5171
246 Ga0496106_0021854 3300048909 Bacteria 4752
247 Ga0496107_0066777 3300048910 Bacteria 2608
248 Ga0496108_0026307 3300048911 Bacteria 4798
249 Ga0496109_0004259 3300048912 Bacteria 11953
250 Ga0496110_0119624 3300048913 Bacteria 2372
251 Ga0496110_1130922 3300048913 Bacteria 691
252 Ga0496111_0050957 3300048914 Bacteria 2988
253 Ga0496111_0640596 3300048914 Bacteria 776
254 Ga0496113_0442216 3300048916 Bacteria 1044
255 Ga0496114_0303540 3300048917 Bacteria 1409
256 Ga0496114_0926208 3300048917 Bacteria 753
257 Ga0496115_0014841 3300048918 Bacteria 5909
258 Ga0496122_0551439 3300048925 Bacteria 549
259 Ga0495678_170565 3300049459 Bacteria 689
260 Ga0501031_0099012 3300049568 Bacteria 1903
261 Ga0501036_0050242 3300049572 Bacteria 3532
262 Ga0501037_0126955 3300049573 Bacteria 1831
263 Ga0501039_0080866 3300049575 Bacteria 2529
264 Ga0501040_0137623 3300049576 Bacteria 1719
265 Ga0501041_0018675 3300049577 Bacteria 4130
266 Ga0501042_0005665 3300049578 Bacteria 8062
267 Ga0501043_0175656 3300049579 Bacteria 1670
268 Ga0501046_0137384 3300049580 Bacteria 1851
269 Ga0501048_0005771 3300049582 Bacteria 9409
270 Ga0501068_0334507 3300049584 Bacteria 972
271 Ga0501069_0001004 3300049585 Bacteria 13435
272 Ga0501070_0000001 3300049586 Bacteria 519187
273 Ga0501071_0049406 3300049587 Bacteria 3028
274 Ga0501071_0067228 3300049587 Bacteria 2606
275 Ga0501072_0012650 3300049588 Bacteria 6452
276 Ga0501075_0046048 3300049591 Bacteria 3276
277 Ga0501076_0035639 3300049592 Bacteria 3893
278 Ga0501077_0450483 3300049593 Bacteria 824
279 Ga0501079_0044078 3300049741 Bacteria 3443
280 Ga0501080_0023115 3300049742 Bacteria 5764
281 Ga0501080_0379990 3300049742 Bacteria 1273
282 Ga0501081_0064814 3300049743 Bacteria 2538
283 Ga0501035_0064000 3300049822 Bacteria 3270
284 Ga0501045_0258694 3300049824 Bacteria 1295
285 nmdc:mga03683_190064_c1 3300050489 Bacteria 939
286 nmdc:mga00v17_856644_c1 3300050491 Bacteria 577
287 nmdc:mga0yw44_1173546_c1 3300050492 Bacteria 518
288 nmdc:mga0yw44_53055_c1 3300050492 Bacteria 2460
289 nmdc:mga0yw44_765164_c1 3300050492 Bacteria 656
290 nmdc:mga06z11_164501_c1 3300050494 Bacteria 1270
291 nmdc:mga06z11_611383_c1 3300050494 Bacteria 663
292 nmdc:mga04h51_518895_c1 3300050495 Bacteria 511
293 nmdc:mga0n895_91951_c1 3300050512 Bacteria 3037
294 nmdc:mga08x19_55116_c1 3300050514 Bacteria 2561
295 nmdc:mga0a205_17502_c2 3300050515 Bacteria 5155
296 Ga0495601_0802896 3300053077 Bacteria 597
297 Ga0495619_0033107 3300053085 Bacteria 3356
298 Ga0495619_0696337 3300053085 Bacteria 691
299 Ga0500559_0002003 3300053136 Bacteria 10955
300 Ga0500559_0076249 3300053136 Bacteria 1517
301 Ga0501084_0112970 3300054114 Bacteria 2283
302 Ga0501082_0055523 3300060353 Bacteria 3412
303 Ga0466962_0241174 3300061719 Bacteria 887
304 Ga0530510_0051519 3300061734 Bacteria 2974
305 2808885788 2808606368 Bacteria 3174172
306 2917738941 2917736166 Bacteria 9690793
307 2977266811 2977264416 Bacteria 3750737
308 2984595124 2984592036 Bacteria 3670284
309 JGI24738J21930_10054305
310 Ga0070658_10003761
311 Ga0070658_10102536
312 Ga0070658_10284948
313 Ga0070658_10342605
314 Ga0070658_10958673
315 Ga0070676_10430149
316 Ga0070683_102041016
317 Ga0070670_102263442
318 Ga0068869_100145175
319 Ga0070666_11080095
320 Ga0070680_100009555
321 Ga0070680_100324951
322 Ga0070682_101480620
323 Ga0068868_100044924
324 Ga0070660_100018239
325 Ga0070660_100100432
326 Ga0070660_100153820
327 Ga0070660_100320836
328 Ga0070660_100331608
329 Ga0070689_100401332
330 Ga0070661_100361739
331 Ga0070668_100038685
332 Ga0070668_100126996
333 Ga0070669_100566216
334 Ga0070675_100333130
335 Ga0070671_100188997
336 Ga0070671_100614282
337 Ga0070674_100128676
338 Ga0070673_100316401
339 Ga0070659_100494860
340 Ga0070667_100828099
341 Ga0070667_101952571
342 Ga0070709_10297177
343 Ga0070714_100196518
344 Ga0070714_101029054
345 Ga0070713_101113091
346 Ga0070710_10033418
347 Ga0070701_10864647
348 Ga0070711_100069492
349 Ga0070705_100204491
350 Ga0070700_100210789
351 Ga0070694_100115759
352 Ga0070678_100365487
353 Ga0070678_100794179
354 Ga0070662_100019585
355 Ga0070681_10031054
356 Ga0070681_10286688
357 Ga0068867_100752277
358 Ga0070685_10065276
359 Ga0070699_100742958
360 Ga0070679_100022758
361 Ga0070679_100966821
362 Ga0070684_101520274
363 Ga0070697_100318915
364 Ga0068853_100075759
365 Ga0070686_100637380
366 Ga0070695_101218741
367 Ga0070696_100557801
368 Ga0070665_101951816
369 Ga0070704_100098455
370 Ga0068855_100030934
371 Ga0068857_101077471
372 Ga0068854_100105175
373 Ga0068856_100349812
374 Ga0070702_100054662
375 Ga0068852_100734766
376 Ga0068864_100046091
377 Ga0068866_10108967
378 Ga0068851_10440332
379 Ga0068863_100484747
380 Ga0068858_100130676
381 Ga0068862_100428617
382 Ga0081540_1000870
383 Ga0070717_10305679
384 Ga0075365_10086651
385 Ga0075365_10345234
386 Ga0075368_10567603
387 Ga0070716_100054774
388 Ga0070712_100154895
389 Ga0075362_10639385
390 Ga0075367_10156315
391 Ga0075367_10434176
392 Ga0097621_100325837
393 Ga0075433_10099539
394 Ga0075436_100075821
395 Ga0075435_100108910
396 Ga0075435_100305448
397 Ga0105251_10124062
398 Ga0105244_10007233
399 Ga0105240_10212196
400 Ga0105245_10009072
401 Ga0105245_10091388
402 Ga0105245_10771825
403 Ga0105247_11076389
404 Ga0105243_10169066
405 Ga0105242_10019384
406 Ga0105242_10034967
407 Ga0105242_10037963
408 Ga0105248_10083098
409 Ga0105248_12073283
410 Ga0105237_11182212
411 Ga0105238_10095736
412 Ga0105249_10148652
413 Ga0105239_10060316
414 Ga0105239_10249897
415 Ga0105239_10996855
416 Ga0105246_10139115
417 Ga0157338_1026836
418 Ga0157371_10702042
419 Ga0157370_10132437
420 Ga0157369_10287358
421 Ga0157369_10615187
422 Ga0157374_10206212
423 Ga0157374_11269245
424 Ga0157374_11873085
425 Ga0157378_10225095
426 Ga0157378_10366652
427 Ga0157378_13064509
428 Ga0163162_10012630
429 Ga0163162_12562269
430 Ga0157372_10017208
431 Ga0157372_10478691
432 Ga0163163_10989187
433 Ga0157380_10108137
434 Ga0157377_10099388
435 Ga0157377_10965979
436 Ga0157376_10033773
437 Ga0157376_10274294
438 Ga0163161_10001605
439 Ga0206354_11388424
440 Ga0154015_1027305
441 Ga0213873_10079387
442 Ga0213871_10051447
443 Ga0224712_10424323
444 Ga0207680_10096600
445 Ga0207647_10067204
446 Ga0207699_10239736
447 Ga0207705_10000693
448 Ga0207705_10271038
449 Ga0207705_10672584
450 Ga0207707_10094818
451 Ga0207707_10713951
452 Ga0207695_10849766
453 Ga0207671_10046104
454 Ga0207693_10016991
455 Ga0207660_10036387
456 Ga0207660_10793969
457 Ga0207657_10026432
458 Ga0207657_10052330
459 Ga0207657_10150436
460 Ga0207657_10393503
461 Ga0207652_10025321
462 Ga0207694_11834700
463 Ga0207659_10153613
464 Ga0207687_10021957
465 Ga0207687_10045364
466 Ga0207700_10993434
467 Ga0207664_10350686
468 Ga0207644_10458671
469 Ga0207690_10375071
470 Ga0207706_10007555
471 Ga0207686_10033556
472 Ga0207686_10204408
473 Ga0207709_10228040
474 Ga0207670_10730326
475 Ga0207669_10917090
476 Ga0207704_10051045
477 Ga0207665_10001259
478 Ga0207665_10536665
479 Ga0207711_10311532
480 Ga0207689_10069677
481 Ga0207661_11384739
482 Ga0207667_10108501
483 Ga0207651_10147142
484 Ga0207651_11044768
485 Ga0207712_10710982
486 Ga0207640_10170032
487 Ga0207658_10737534
488 Ga0207658_11037029
489 Ga0207677_10019814
490 Ga0207703_10356199
491 Ga0207639_10044308
492 Ga0207678_10120277
493 Ga0207708_10117186
494 Ga0207702_10310733
495 Ga0207648_10149997
496 Ga0207676_10035974
497 Ga0207674_10123843
498 Ga0207683_10018859
499 Ga0207683_10828940
500 Ga0207698_10096346
501 Ga0207698_10747115
502 Ga0207698_12515164
503 Ga0209813_10484884
504 Ga0207428_10276993
505 Ga0268266_11720591
506 Ga0268265_10122128
507 Ga0307515_10041669
508 Ga0373930_0012597
509 Ga0373948_0089206
510 Ga0373941_0323065
511 Ga0373960_0028635
512 Ga0373961_0051757
513 Ga0373961_0133420
514 Ga0373962_0004994
515 Ga0373947_1099744
516 Ga0373937_0645496
517 Ga0436360_0138220
518 Ga0436361_0190195
519 Ga0436361_0589259
520 Ga0436363_1255943
521 Ga0436362_0359813
522 Ga0436362_1287763
523 Ga0466972_0001690
524 Ga0466966_0263530
525 Ga0466961_0003066
526 Ga0466970_0051197
527 Ga0466970_0784377
528 Ga0466957_0629686
529 Ga0466959_0025183
530 Ga0466959_0288995
531 Ga0466959_0493809
532 Ga0466958_0043074
533 Ga0466967_1169850
534 Ga0466967_1353702
535 Ga0495592_0371409
536 Ga0495651_0692262
537 Ga0495630_0091533
538 Ga0495587_0343843
539 Ga0495646_0122139
540 Ga0495647_0553615
541 Ga0495613_0520628
542 Ga0495624_0158735
543 Ga0495624_0885494
544 Ga0495674_0372764
545 Ga0495676_0609260
546 Ga0495676_1059906
547 Ga0496100_1674495
548 Ga0496101_0967219
549 Ga0496102_0055804
550 Ga0496102_1568241
551 Ga0496104_0132930
552 Ga0496104_0415161
553 Ga0496105_0021915
554 Ga0496106_0021854
555 Ga0496107_0066777
556 Ga0496108_0026307
557 Ga0496109_0004259
558 Ga0496110_0119624
559 Ga0496110_1130922
560 Ga0496111_0050957
561 Ga0496111_0640596
562 Ga0496113_0442216
563 Ga0496114_0303540
564 Ga0496114_0926208
565 Ga0496115_0014841
566 Ga0496122_0551439
567 Ga0495678_170565
568 Ga0501031_0099012
569 Ga0501036_0050242
570 Ga0501037_0126955
571 Ga0501039_0080866
572 Ga0501040_0137623
573 Ga0501041_0018675
574 Ga0501042_0005665
575 Ga0501043_0175656
576 Ga0501046_0137384
577 Ga0501048_0005771
578 Ga0501068_0334507
579 Ga0501069_0001004
580 Ga0501070_0000001
581 Ga0501071_0049406
582 Ga0501071_0067228
583 Ga0501072_0012650
584 Ga0501075_0046048
585 Ga0501076_0035639
586 Ga0501077_0450483
587 Ga0501079_0044078
588 Ga0501080_0023115
589 Ga0501080_0379990
590 Ga0501081_0064814
591 Ga0501035_0064000
592 Ga0501045_0258694
593 nmdc:mga03683_190064_c1
594 nmdc:mga00v17_856644_c1
595 nmdc:mga0yw44_1173546_c1
596 nmdc:mga0yw44_53055_c1
597 nmdc:mga0yw44_765164_c1
598 nmdc:mga06z11_164501_c1
599 nmdc:mga06z11_611383_c1
600 nmdc:mga04h51_518895_c1
601 nmdc:mga0n895_91951_c1
602 nmdc:mga08x19_55116_c1
603 nmdc:mga0a205_17502_c2
604 Ga0495601_0802896
605 Ga0495619_0033107
606 Ga0495619_0696337
607 Ga0500559_0002003
608 Ga0500559_0076249
609 Ga0501084_0112970
610 Ga0501082_0055523
611 Ga0466962_0241174
612 Ga0530510_0051519
613 2808885788
614 2917738941
615 2977266811
616 2984595124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

11

106

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8678 11 123
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8204 11 123
1ob8-assembly2.cif.gz_B holliday junction resolving enzyme 0.7018 7 118
5gke-assembly1.cif.gz_B structure of endoms-dsdna1 complex 0.6917 11 58
2wcz-assembly1.cif.gz_A 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.6912 12 120
ID Description Score Start End Superfamily
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8823 12 123 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8788 11 123 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8678 11 121 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8532 11 121 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8369 12 123 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A1V5J9D9-F1-model_v4 UPF0102 protein BWY90_00802 0.959 4 123 GO:0003676
AF-A0A1H1SXC6-F1-model_v4 UPF0102 protein SAMN04489834_1641 0.957 4 123 GO:0003676
GO:0004519
AF-B8HA88-F1-model_v4 UPF0102 protein Achl_2213 0.9566 1 122 GO:0003676
AF-A0A6I2XC37-F1-model_v4 UPF0102 protein F2520_07250 0.9554 4 123 GO:0003676
AF-A0A449DAB6-F1-model_v4 UPF0102 protein NCTC12391_02654 0.9546 4 123 GO:0003676

Map