F399459

General Info

Members Datasets Scaffolds Average Seq Length
307 221 246 166

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2966598605|2966604156
Length 173
Sequence SADPGTTLTVVLVKAGRTKIRYPAELVRDDGTRITVRAPWAAPGVRDFGFVRFEPGDVFTEHYWPDPSPGREGAGGAPMYAVKEVRAGDGELKGWYCDIIRPAVLRDGELLVEDLDLDLWVSADGSSVLRLDEDEFEESGLAGRDAPAAEAAVRALDELEHLARTGGLAGLLT

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2643221714 Streptomyces sp. Root264 Isolate Unclassified
13 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
14 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606448 Streptomyces sp. 193411 Isolate Unclassified
21 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
22 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
23 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
24 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
25 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
26 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
27 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
28 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
29 2867428634 Streptomyces sp. RP5T Isolate Unclassified
30 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
33 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
34 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
35 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
36 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
37 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
38 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
39 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
40 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
41 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
42 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
43 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
44 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
45 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
46 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
47 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
48 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
49 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
50 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
51 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
52 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
53 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
54 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
57 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
83 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
107 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
130 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
131 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
135 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
176 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
211 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
212 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
216 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
217 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
218 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
219 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
220 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
221 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.13
Metatranscriptomes 0
Isolates 19.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0.65
Rhizoplane 1.63
Rhizosphere 77.85
Stem 0
Stem Tuber 0
Unclassified 16.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10091011 3300001989 Bacteria 929
2 rootH1_10024610 3300003316 Bacteria 2487
3 rootH2_10019983 3300003320 Bacteria 10691
4 rootL2_10004911 3300003322 Bacteria 11269
5 rootL2_10137276 3300003322 Bacteria 4136
6 rootH1_10005527 3300003323 Bacteria 4610
7 rootH1_10172523 3300003323 Bacteria 3232
8 Ga0068853_100466313 3300005539 Bacteria 1189
9 Ga0068856_100519347 3300005614 Bacteria 1212
10 Ga0075363_100012417 3300006048 Bacteria 4105
11 Ga0075363_100224642 3300006048 Bacteria 1077
12 Ga0070715_10281141 3300006163 Bacteria 882
13 Ga0105250_10168687 3300009092 Bacteria 916
14 Ga0105245_10661078 3300009098 Bacteria 1076
15 Ga0114129_12707436 3300009147 Bacteria 591
16 Ga0157369_11163487 3300013105 Bacteria 788
17 Ga0157372_10467902 3300013307 Bacteria 1469
18 Ga0157375_11353178 3300013308 Bacteria 838
19 Ga0183367_1010 3300015688 Bacteria 416164
20 Ga0209758_1006079 3300025297 Bacteria 8885
21 Ga0207426_1053713 3300025302 Bacteria 1188
22 Ga0207696_1104526 3300025711 Bacteria 770
23 Ga0207713_1048050 3300025735 Bacteria 1721
24 Ga0207647_10083602 3300025904 Bacteria 1911
25 Ga0207685_10293115 3300025905 Bacteria 802
26 Ga0307517_10000749 3300028786 Bacteria 56100
27 Ga0268256_1046861 3300030500 Bacteria 934
28 Ga0307512_10005563 3300030522 Bacteria 13093
29 Ga0307513_10046535 3300031456 Bacteria 4728
30 Ga0307513_10076504 3300031456 Bacteria 3470
31 Ga0307509_10008459 3300031507 Bacteria 13110
32 Ga0307509_10050423 3300031507 Bacteria 4457
33 Ga0307508_10011515 3300031616 Bacteria 8081
34 Ga0307508_10014212 3300031616 Bacteria 7260
35 Ga0307508_10031291 3300031616 Bacteria 4811
36 Ga0307514_10001660 3300031649 Bacteria 25889
37 Ga0307514_10203418 3300031649 Bacteria 1240
38 Ga0316579_10147290 3300031691 Bacteria 1135
39 Ga0307516_10084124 3300031730 Bacteria 3021
40 Ga0316577_10129479 3300031733 Bacteria 1420
41 Ga0307518_10041833 3300031838 Bacteria 3336
42 Ga0307518_10112933 3300031838 Bacteria 1933
43 Ga0307518_10118784 3300031838 Bacteria 1874
44 Ga0307518_10465873 3300031838 Bacteria 668
45 Ga0307410_10492499 3300031852 Bacteria 1007
46 Ga0307412_11239668 3300031911 Bacteria 669
47 Ga0307507_10011018 3300033179 Bacteria 11507
48 Ga0307510_10062272 3300033180 Bacteria 3813
49 Ga0316582_0003186 3300036647 Bacteria 7966
50 Ga0316582_0645602 3300036647 Unclassified 728
51 Ga0316584_0046189 3300036712 Bacteria 3252
52 Ga0395900_0072640 3300037418 Bacteria 3537
53 Ga0395898_0002362 3300037466 Bacteria 22444
54 Ga0395898_0010216 3300037466 Bacteria 9828
55 Ga0395901_0065765 3300038443 Bacteria 3776
56 Ga0395901_0275669 3300038443 Bacteria 1749
57 Ga0439436_0003349 3300041404 Bacteria 4864
58 Ga0439439_0004355 3300041406 Bacteria 3184
59 Ga0439466_0092342 3300041411 Bacteria 948
60 Ga0451853_0189970 3300041512 Bacteria 4942
61 Ga0439442_010234 3300042002 Bacteria 1900
62 Ga0439449_0002929 3300042007 Bacteria 6640
63 Ga0439455_0000798 3300042012 Bacteria 4771
64 Ga0439457_000409 3300042014 Bacteria 12279
65 Ga0439457_001369 3300042014 Bacteria 7337
66 Ga0439462_0006345 3300042015 Bacteria 2936
67 Ga0450899_001439 3300042135 Bacteria 2656
68 Ga0450903_000009 3300042138 Bacteria 36840
69 Ga0450903_010359 3300042138 Bacteria 1510
70 Ga0439458_0004068 3300042157 Bacteria 3373
71 Ga0450908_002333 3300042184 Bacteria 3716
72 Ga0466969_0119502 3300044656 Bacteria 1228
73 Ga0466966_0002279 3300044684 Bacteria 12498
74 Ga0466961_0003360 3300044693 Bacteria 9987
75 Ga0466963_0000395 3300044694 Bacteria 19917
76 Ga0466963_0001388 3300044694 Bacteria 12982
77 Ga0466963_0004711 3300044694 Bacteria 7965
78 Ga0466964_0005069 3300044706 Bacteria 4873
79 Ga0466971_0000855 3300044719 Bacteria 12411
80 Ga0466970_0000952 3300044765 Bacteria 13964
81 Ga0466957_0001041 3300044842 Bacteria 14317
82 Ga0466957_0176911 3300044842 Bacteria 1392
83 Ga0466960_0179100 3300044901 Bacteria 1148
84 Ga0466959_0003724 3300045049 Bacteria 10070
85 Ga0466958_0000359 3300045836 Bacteria 18396
86 Ga0466967_0035226 3300045976 Bacteria 4258
87 Ga0466967_0164781 3300045976 Bacteria 2082
88 Ga0466967_0464676 3300045976 Bacteria 1238
89 Ga0495627_056793 3300046453 Bacteria 1166
90 Ga0495592_0098763 3300046454 Bacteria 2083
91 Ga0495592_0146827 3300046454 Bacteria 1634
92 Ga0495603_0001105 3300046455 Bacteria 15660
93 Ga0495603_0001710 3300046455 Bacteria 12929
94 Ga0495603_0003960 3300046455 Bacteria 8822
95 Ga0495603_0037479 3300046455 Bacteria 2909
96 Ga0495629_0001448 3300046459 Bacteria 18708
97 Ga0495629_0025194 3300046459 Bacteria 4231
98 Ga0495629_0028252 3300046459 Bacteria 3982
99 Ga0495629_0086371 3300046459 Bacteria 2188
100 Ga0495629_0150104 3300046459 Bacteria 1620
101 Ga0495638_0058507 3300046460 Bacteria 2388
102 Ga0495638_0102164 3300046460 Bacteria 1713
103 Ga0495651_0030024 3300046462 Bacteria 4238
104 Ga0495651_0309324 3300046462 Bacteria 1057
105 Ga0495582_0541782 3300046473 Bacteria 673
106 Ga0495605_0013750 3300046474 Bacteria 4448
107 Ga0495605_0041825 3300046474 Bacteria 2281
108 Ga0495639_0051750 3300046475 Bacteria 1868
109 Ga0495662_0011464 3300046476 Bacteria 4333
110 Ga0495662_0025730 3300046476 Bacteria 2841
111 Ga0495584_0486598 3300046491 Bacteria 628
112 Ga0495585_0007456 3300046492 Bacteria 6694
113 Ga0495585_0209202 3300046492 Bacteria 989
114 Ga0495594_0001178 3300046499 Bacteria 13684
115 Ga0495594_0004121 3300046499 Bacteria 7471
116 Ga0495594_0120067 3300046499 Bacteria 1485
117 Ga0495596_0113307 3300046500 Bacteria 1053
118 Ga0495607_0295798 3300046501 Bacteria 763
119 Ga0495583_0007811 3300046506 Bacteria 6646
120 Ga0495606_0052690 3300046507 Bacteria 2644
121 Ga0495606_0075170 3300046507 Bacteria 2114
122 Ga0495616_0035909 3300046513 Bacteria 2560
123 Ga0495618_0012744 3300046514 Bacteria 5110
124 Ga0495620_0003729 3300046515 Bacteria 8700
125 Ga0495628_0066648 3300046516 Bacteria 2814
126 Ga0495628_0392599 3300046516 Bacteria 1015
127 Ga0495631_0000896 3300046518 Bacteria 18620
128 Ga0495632_0036016 3300046519 Bacteria 2520
129 Ga0495637_0018422 3300046520 Bacteria 3239
130 Ga0495643_0121466 3300046522 Bacteria 1319
131 Ga0495643_0172259 3300046522 Bacteria 1058
132 Ga0495666_0049586 3300046526 Bacteria 2019
133 Ga0495642_0011933 3300046528 Bacteria 3347
134 Ga0495642_0145492 3300046528 Bacteria 1024
135 Ga0495652_0465665 3300046529 Bacteria 882
136 Ga0495640_0003285 3300046533 Bacteria 13006
137 Ga0495609_0131918 3300046538 Bacteria 1069
138 Ga0495622_0066351 3300046557 Bacteria 1668
139 Ga0495633_0060931 3300046558 Bacteria 1767
140 Ga0495667_0420485 3300046559 Bacteria 841
141 Ga0495611_0015650 3300046648 Bacteria 3242
142 Ga0495611_0050610 3300046648 Bacteria 1871
143 Ga0495625_0013091 3300046660 Bacteria 6682
144 Ga0495635_0257053 3300046663 Bacteria 1177
145 Ga0495588_0007870 3300046674 Bacteria 4868
146 Ga0495588_0043436 3300046674 Bacteria 2300
147 Ga0495657_0004911 3300046675 Bacteria 10639
148 Ga0495657_0085384 3300046675 Bacteria 2034
149 Ga0495613_0003867 3300046689 Bacteria 11203
150 Ga0495613_0007203 3300046689 Bacteria 8286
151 Ga0495613_0032608 3300046689 Bacteria 3870
152 Ga0495613_0033894 3300046689 Bacteria 3792
153 Ga0495613_0044612 3300046689 Bacteria 3279
154 Ga0495624_0069731 3300046690 Bacteria 2189
155 Ga0495589_0012772 3300046794 Bacteria 4342
156 Ga0495589_0044398 3300046794 Bacteria 2211
157 Ga0495589_0107125 3300046794 Bacteria 1350
158 Ga0495600_0099852 3300046809 Bacteria 1892
159 Ga0495660_0128844 3300046810 Bacteria 1271
160 Ga0495581_0066502 3300047315 Bacteria 2084
161 Ga0495581_0091459 3300047315 Bacteria 1765
162 Ga0495581_0704212 3300047315 Bacteria 582
163 Ga0495604_0020367 3300047317 Bacteria 5298
164 Ga0495604_0028970 3300047317 Bacteria 4405
165 Ga0495636_0000735 3300047318 Bacteria 12032
166 Ga0495636_0017971 3300047318 Bacteria 2834
167 Ga0495672_0208688 3300047320 Bacteria 972
168 Ga0495676_0008596 3300047321 Bacteria 9352
169 Ga0495676_0008914 3300047321 Bacteria 9162
170 Ga0495676_0035720 3300047321 Bacteria 4155
171 Ga0495680_0074080 3300047322 Bacteria 2586
172 Ga0495683_0119709 3300047323 Bacteria 1250
173 Ga0495687_008715 3300047443 Bacteria 5762
174 Ga0495675_0002626 3300047444 Bacteria 10766
175 Ga0495675_0103910 3300047444 Bacteria 1776
176 Ga0495677_0250662 3300047445 Bacteria 692
177 Ga0495685_029960 3300047447 Bacteria 1871
178 Ga0495685_037400 3300047447 Bacteria 1664
179 Ga0495681_0002967 3300047470 Bacteria 11957
180 Ga0495681_0077416 3300047470 Bacteria 1492
181 Ga0495684_0168019 3300047471 Bacteria 1633
182 Ga0495686_0030231 3300047472 Bacteria 3519
183 Ga0495593_0053377 3300047673 Bacteria 2133
184 Ga0495593_0224077 3300047673 Bacteria 943
185 Ga0495602_0347098 3300048088 Bacteria 1072
186 Ga0495614_0000574 3300048089 Bacteria 15272
187 Ga0495614_0027908 3300048089 Bacteria 2433
188 Ga0496104_0512920 3300048907 Bacteria 1110
189 Ga0496105_0685283 3300048908 Bacteria 788
190 Ga0496108_0578025 3300048911 Bacteria 979
191 Ga0496109_0015464 3300048912 Bacteria 6651
192 Ga0496110_0197775 3300048913 Bacteria 1826
193 Ga0496126_1075780 3300048929 Bacteria 599
194 Ga0495678_199069 3300049459 Bacteria 618
195 Ga0495682_0052508 3300049460 Bacteria 1481
196 Ga0501031_0123710 3300049568 Bacteria 1690
197 Ga0501032_0083913 3300049569 Bacteria 2118
198 Ga0501032_0425888 3300049569 Bacteria 851
199 Ga0501032_0619330 3300049569 Bacteria 688
200 Ga0501033_0060280 3300049570 Bacteria 2800
201 Ga0501033_0061323 3300049570 Bacteria 2772
202 Ga0501034_0087064 3300049571 Bacteria 3124
203 Ga0501034_0199744 3300049571 Bacteria 1958
204 Ga0501034_0275533 3300049571 Bacteria 1622
205 Ga0501034_0741674 3300049571 Bacteria 878
206 Ga0501036_0108517 3300049572 Bacteria 2346
207 Ga0501036_0114248 3300049572 Bacteria 2282
208 Ga0501037_0028100 3300049573 Bacteria 4154
209 Ga0501037_0030817 3300049573 Bacteria 3962
210 Ga0501037_0178850 3300049573 Bacteria 1506
211 Ga0501038_0105191 3300049574 Bacteria 2344
212 Ga0501038_0384541 3300049574 Bacteria 1088
213 Ga0501038_1085951 3300049574 Bacteria 585
214 Ga0501039_0172462 3300049575 Bacteria 1701
215 Ga0501042_0027527 3300049578 Bacteria 3998
216 Ga0501042_0146058 3300049578 Bacteria 1705
217 Ga0501043_0017844 3300049579 Bacteria 5564
218 Ga0501043_0138023 3300049579 Bacteria 1910
219 Ga0501046_0022501 3300049580 Bacteria 5193
220 Ga0501046_0113410 3300049580 Bacteria 2069
221 Ga0501047_0000029 3300049581 Bacteria 218396
222 Ga0501047_0013393 3300049581 Bacteria 7774
223 Ga0501047_0036363 3300049581 Bacteria 4759
224 Ga0501047_0136482 3300049581 Bacteria 2333
225 Ga0501047_0239735 3300049581 Bacteria 1664
226 Ga0501048_0030780 3300049582 Bacteria 3883
227 Ga0501048_0463218 3300049582 Bacteria 908
228 Ga0501070_0078214 3300049586 Bacteria 2738
229 Ga0501070_0318347 3300049586 Bacteria 1266
230 Ga0501073_0311101 3300049589 Bacteria 1087
231 Ga0501080_0351301 3300049742 Bacteria 1331
232 Ga0501035_0027738 3300049822 Bacteria 5174
233 Ga0501035_0129551 3300049822 Bacteria 2200
234 Ga0501035_0808813 3300049822 Bacteria 748
235 Ga0501044_0007675 3300049823 Bacteria 11861
236 Ga0501044_0087053 3300049823 Bacteria 3155
237 Ga0501044_0094391 3300049823 Bacteria 3016
238 Ga0501044_0235392 3300049823 Bacteria 1777
239 Ga0501044_0344996 3300049823 Bacteria 1409
240 nmdc:mga03n38_4026_c1 3300050490 Bacteria 4806
241 nmdc:mga07m45_17522_c1 3300050496 Bacteria 3848
242 Ga0500610_0419881 3300053079 Bacteria 536
243 Ga0500650_0243823 3300053098 Bacteria 808
244 Ga0500600_0104766 3300053149 Bacteria 1486
245 Ga0501084_0238463 3300054114 Bacteria 1535
246 Ga0466962_0003771 3300061719 Bacteria 7237

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0087064 Ga0501034_0087064_1407_1868 139
2 3300049573 Ga0501037_0030817 Ga0501037_0030817_627_1088 139
3 3300049581 Ga0501047_0036363 Ga0501047_0036363_1171_1632 139
4 3300049823 Ga0501044_0235392 Ga0501044_0235392_492_953 139
5 3300031691 Ga0316579_10147290 Ga0316579_101472902 145
6 3300031733 Ga0316577_10129479 Ga0316577_101294791 145
7 3300049580 Ga0501046_0113410 Ga0501046_0113410_135_614 145
8 3300036647 Ga0316582_0003186 Ga0316582_0003186_2432_2908 150
9 3300036647 Ga0316582_0645602 Ga0316582_0645602_38_514 150
10 3300036712 Ga0316584_0046189 Ga0316584_0046189_340_816 150
11 3300047447 Ga0495685_037400 Ga0495685_037400_1169_1645 153
12 3300053149 Ga0500600_0104766 Ga0500600_0104766_149_625 153
13 iso_pu_bacteria 2808606982 2811847200 154
14 iso_pu_bacteria 2582581312 2585296755 156
15 3300041512 Ga0451853_0189970 Ga0451853_0189970_3194_3706 157
16 iso_pu_bacteria 3006486233 3006488337 157
17 3300042007 Ga0439449_0002929 Ga0439449_0002929_3864_4364 158
18 3300047318 Ga0495636_0017971 Ga0495636_0017971_2226_2702 158
19 iso_pu_bacteria 8054160619 8054164499 158
20 3300031838 Ga0307518_10041833 Ga0307518_100418334 159
21 iso_pu_bacteria 2954691527 2954699146 159
22 iso_pu_bacteria 2954701450 2954703073 159
23 3300044694 Ga0466963_0004711 Ga0466963_0004711_5484_5984 160
24 3300044842 Ga0466957_0176911 Ga0466957_0176911_72_575 160
25 3300046455 Ga0495603_0001105 Ga0495603_0001105_5969_6478 160
26 3300046455 Ga0495603_0003960 Ga0495603_0003960_5515_6024 160
27 3300046459 Ga0495629_0001448 Ga0495629_0001448_12192_12701 160
28 3300046459 Ga0495629_0086371 Ga0495629_0086371_1528_2037 160
29 3300046460 Ga0495638_0058507 Ga0495638_0058507_424_933 160
30 3300046499 Ga0495594_0001178 Ga0495594_0001178_2138_2647 160
31 3300046557 Ga0495622_0066351 Ga0495622_0066351_19_528 160
32 3300046648 Ga0495611_0015650 Ga0495611_0015650_1137_1646 160
33 3300046674 Ga0495588_0043436 Ga0495588_0043436_836_1345 160
34 3300046689 Ga0495613_0007203 Ga0495613_0007203_1257_1766 160
35 3300046794 Ga0495589_0044398 Ga0495589_0044398_426_935 160
36 3300047321 Ga0495676_0008914 Ga0495676_0008914_5727_6236 160
37 3300047321 Ga0495676_0035720 Ga0495676_0035720_2112_2621 160
38 3300047673 Ga0495593_0224077 Ga0495593_0224077_30_539 160
39 3300049569 Ga0501032_0619330 Ga0501032_0619330_140_640 160
40 3300049823 Ga0501044_0007675 Ga0501044_0007675_6723_7223 160
41 iso_pu_bacteria 2616644941 2616900537 160
42 iso_pu_bacteria 2643221548 2643759936 160
43 iso_pu_bacteria 2643221682 2644460368 160
44 iso_pu_bacteria 2784746768 2785367438 160
45 iso_pu_bacteria 2786546132 2786668484 160
46 iso_pu_bacteria 2802429296 2804844041 160
47 iso_pu_bacteria 2862281513 2862289352 160
48 iso_pu_bacteria 2862507626 2862512905 160
49 iso_pu_bacteria 2867428634 2867433438 160
50 iso_pu_bacteria 2877676314 2877683114 160
51 iso_pu_bacteria 2954673503 2954674762 160
52 iso_pu_bacteria 2954682443 2954689371 160
53 iso_pu_bacteria 2954711539 2954718097 160
54 iso_pu_bacteria 2954721474 2954728065 160
55 iso_pu_bacteria 2954731030 2954733741 160
56 iso_pu_bacteria 2954740390 2954746962 160
57 iso_pu_bacteria 2954749733 2954752625 160
58 iso_pu_bacteria 2954759201 2954766075 160
59 iso_pu_bacteria 8025413630 8025419469 160
60 3300006048 Ga0075363_100224642 Ga0075363_1002246422 161
61 3300009098 Ga0105245_10661078 Ga0105245_106610781 161
62 3300025735 Ga0207713_1048050 Ga0207713_10480501 161
63 3300048911 Ga0496108_0578025 Ga0496108_0578025_357_857 161
64 3300048912 Ga0496109_0015464 Ga0496109_0015464_1101_1601 161
65 3300048913 Ga0496110_0197775 Ga0496110_0197775_56_556 161
66 3300049575 Ga0501039_0172462 Ga0501039_0172462_1107_1643 161
67 iso_pu_bacteria 2643221647 2644268327 161
68 iso_pu_bacteria 3006393351 3006395258 161
69 iso_pu_bacteria 8008574985 8008580500 161
70 3300031838 Ga0307518_10118784 Ga0307518_101187843 162
71 3300046454 Ga0495592_0146827 Ga0495592_0146827_791_1288 162
72 3300046462 Ga0495651_0030024 Ga0495651_0030024_106_603 162
73 3300046514 Ga0495618_0012744 Ga0495618_0012744_2393_2890 162
74 3300046516 Ga0495628_0066648 Ga0495628_0066648_1884_2381 162
75 3300046533 Ga0495640_0003285 Ga0495640_0003285_9224_9721 162
76 3300046675 Ga0495657_0004911 Ga0495657_0004911_7603_8100 162
77 3300046689 Ga0495613_0003867 Ga0495613_0003867_115_612 162
78 3300047317 Ga0495604_0020367 Ga0495604_0020367_1956_2453 162
79 3300047321 Ga0495676_0008596 Ga0495676_0008596_8803_9300 162
80 3300049569 Ga0501032_0425888 Ga0501032_0425888_77_613 162
81 3300049572 Ga0501036_0114248 Ga0501036_0114248_329_865 162
82 3300049581 Ga0501047_0013393 Ga0501047_0013393_3632_4168 162
83 3300049586 Ga0501070_0318347 Ga0501070_0318347_158_694 162
84 3300049742 Ga0501080_0351301 Ga0501080_0351301_73_609 162
85 3300049823 Ga0501044_0094391 Ga0501044_0094391_1996_2532 162
86 iso_pu_bacteria 2547132111 2547406776 162
87 iso_pu_bacteria 2582581314 2585315467 162
88 iso_pu_bacteria 2616644814 2616695921 162
89 iso_pu_bacteria 2643221678 2644438425 162
90 iso_pu_bacteria 2643221714 2644629291 162
91 iso_pu_bacteria 2784132148 2784586979 162
92 iso_pu_bacteria 2784746763 2785345443 162
93 iso_pu_bacteria 2808606359 2808847935 162
94 iso_pu_bacteria 2808606375 2808918691 162
95 iso_pu_bacteria 2808606448 2809230543 162
96 iso_pu_bacteria 2811994879 2812360053 162
97 iso_pu_bacteria 2811994917 2812482118 162
98 iso_pu_bacteria 2852635781 2852637970 162
99 iso_pu_bacteria 2862382967 2862386331 162
100 iso_pu_bacteria 2873151551 2873157433 162
101 iso_pu_bacteria 2912715099 2912722102 162
102 iso_pu_bacteria 2912723979 2912725863 162
103 iso_pu_bacteria 2919468124 2919473632 162
104 iso_pu_bacteria 2946064051 2946065838 162
105 iso_pu_bacteria 2946072368 2946074173 162
106 iso_pu_bacteria 2954002825 2954010776 162
107 iso_pu_bacteria 2966598605 2966604156 162
108 iso_pu_bacteria 2990059506 2990062642 162
109 iso_pu_bacteria 3006493962 3006495288 162
110 iso_pu_bacteria 8008558824 8008561601 162
111 iso_pu_bacteria 8023623736 8023624528 162
112 iso_pu_bacteria 8048406513 8048412052 162
113 iso_pu_bacteria 8056829672 8056835436 162
114 3300003316 rootH1_10024610 rootH1_100246106 163
115 3300046492 Ga0495585_0007456 Ga0495585_0007456_2683_3186 163
116 3300047317 Ga0495604_0028970 Ga0495604_0028970_2318_2821 163
117 3300049581 Ga0501047_0136482 Ga0501047_0136482_1353_1856 163
118 iso_pu_bacteria 2863404153 2863406708 163
119 3300030500 Ga0268256_1046861 Ga0268256_10468612 164
120 3300031616 Ga0307508_10014212 Ga0307508_100142126 164
121 3300042012 Ga0439455_0000798 Ga0439455_0000798_1822_2325 164
122 3300042138 Ga0450903_000009 Ga0450903_000009_29204_29707 164
123 3300042157 Ga0439458_0004068 Ga0439458_0004068_1860_2363 164
124 iso_pu_bacteria 2643221578 2643904723 164
125 iso_pu_bacteria 2643221673 2644406011 164
126 iso_pu_bacteria 2946045630 2946051780 164
127 3300042002 Ga0439442_010234 Ga0439442_010234_412_912 165
128 3300044694 Ga0466963_0000395 Ga0466963_0000395_1391_1906 165
129 3300045976 Ga0466967_0464676 Ga0466967_0464676_398_913 165
130 3300049569 Ga0501032_0083913 Ga0501032_0083913_482_985 165
131 3300049570 Ga0501033_0060280 Ga0501033_0060280_881_1384 165
132 3300049571 Ga0501034_0275533 Ga0501034_0275533_1097_1600 165
133 3300049572 Ga0501036_0108517 Ga0501036_0108517_983_1486 165
134 3300049573 Ga0501037_0028100 Ga0501037_0028100_2365_2868 165
135 3300049574 Ga0501038_0105191 Ga0501038_0105191_1374_1877 165
136 3300049578 Ga0501042_0027527 Ga0501042_0027527_2220_2723 165
137 3300049579 Ga0501043_0017844 Ga0501043_0017844_4020_4523 165
138 3300049580 Ga0501046_0022501 Ga0501046_0022501_2561_3064 165
139 3300049582 Ga0501048_0030780 Ga0501048_0030780_2242_2745 165
140 3300049589 Ga0501073_0311101 Ga0501073_0311101_61_564 165
141 3300049822 Ga0501035_0027738 Ga0501035_0027738_2118_2621 165
142 3300049823 Ga0501044_0344996 Ga0501044_0344996_620_1123 165
143 3300054114 Ga0501084_0238463 Ga0501084_0238463_435_938 165
144 iso_pu_bacteria 3006321560 3006324783 165
145 3300001989 JGI24739J22299_10091011 JGI24739J22299_100910112 166
146 3300003320 rootH2_10019983 rootH2_1001998310 166
147 3300003322 rootL2_10004911 rootL2_1000491110 166
148 3300003322 rootL2_10137276 rootL2_101372765 166
149 3300003323 rootH1_10005527 rootH1_100055273 166
150 3300003323 rootH1_10172523 rootH1_101725231 166
151 3300005539 Ga0068853_100466313 Ga0068853_1004663132 166
152 3300005614 Ga0068856_100519347 Ga0068856_1005193472 166
153 3300006048 Ga0075363_100012417 Ga0075363_1000124173 166
154 3300006163 Ga0070715_10281141 Ga0070715_102811412 166
155 3300009092 Ga0105250_10168687 Ga0105250_101686872 166
156 3300009147 Ga0114129_12707436 Ga0114129_127074361 166
157 3300013105 Ga0157369_11163487 Ga0157369_111634872 166
158 3300013307 Ga0157372_10467902 Ga0157372_104679022 166
159 3300013308 Ga0157375_11353178 Ga0157375_113531782 166
160 3300015688 Ga0183367_1010 Ga0183367_101082 166
161 3300025297 Ga0209758_1006079 Ga0209758_10060797 166
162 3300025302 Ga0207426_1053713 Ga0207426_10537132 166
163 3300025711 Ga0207696_1104526 Ga0207696_11045261 166
164 3300025904 Ga0207647_10083602 Ga0207647_100836022 166
165 3300025905 Ga0207685_10293115 Ga0207685_102931152 166
166 3300028786 Ga0307517_10000749 Ga0307517_1000074916 166
167 3300030522 Ga0307512_10005563 Ga0307512_100055636 166
168 3300031456 Ga0307513_10046535 Ga0307513_100465356 166
169 3300031456 Ga0307513_10076504 Ga0307513_100765044 166
170 3300031507 Ga0307509_10008459 Ga0307509_1000845915 166
171 3300031507 Ga0307509_10050423 Ga0307509_100504233 166
172 3300031616 Ga0307508_10011515 Ga0307508_100115155 166
173 3300031616 Ga0307508_10031291 Ga0307508_100312914 166
174 3300031649 Ga0307514_10001660 Ga0307514_100016609 166
175 3300031649 Ga0307514_10203418 Ga0307514_102034182 166
176 3300031730 Ga0307516_10084124 Ga0307516_100841244 166
177 3300031838 Ga0307518_10112933 Ga0307518_101129332 166
178 3300031838 Ga0307518_10465873 Ga0307518_104658732 166
179 3300031852 Ga0307410_10492499 Ga0307410_104924992 166
180 3300031911 Ga0307412_11239668 Ga0307412_112396681 166
181 3300033179 Ga0307507_10011018 Ga0307507_100110186 166
182 3300033180 Ga0307510_10062272 Ga0307510_100622726 166
183 3300037418 Ga0395900_0072640 Ga0395900_0072640_1559_2059 166
184 3300037466 Ga0395898_0002362 Ga0395898_0002362_4380_4880 166
185 3300037466 Ga0395898_0010216 Ga0395898_0010216_4003_4503 166
186 3300038443 Ga0395901_0065765 Ga0395901_0065765_1713_2213 166
187 3300038443 Ga0395901_0275669 Ga0395901_0275669_632_1132 166
188 3300041404 Ga0439436_0003349 Ga0439436_0003349_1048_1548 166
189 3300041406 Ga0439439_0004355 Ga0439439_0004355_2376_2876 166
190 3300041411 Ga0439466_0092342 Ga0439466_0092342_404_904 166
191 3300042014 Ga0439457_000409 Ga0439457_000409_10338_10838 166
192 3300042014 Ga0439457_001369 Ga0439457_001369_3218_3718 166
193 3300042015 Ga0439462_0006345 Ga0439462_0006345_2368_2868 166
194 3300042135 Ga0450899_001439 Ga0450899_001439_963_1466 166
195 3300042138 Ga0450903_010359 Ga0450903_010359_205_708 166
196 3300042184 Ga0450908_002333 Ga0450908_002333_3196_3699 166
197 3300044656 Ga0466969_0119502 Ga0466969_0119502_78_578 166
198 3300044684 Ga0466966_0002279 Ga0466966_0002279_11034_11534 166
199 3300044693 Ga0466961_0003360 Ga0466961_0003360_7487_7987 166
200 3300044694 Ga0466963_0001388 Ga0466963_0001388_1490_1990 166
201 3300044706 Ga0466964_0005069 Ga0466964_0005069_3426_3926 166
202 3300044719 Ga0466971_0000855 Ga0466971_0000855_2129_2629 166
203 3300044765 Ga0466970_0000952 Ga0466970_0000952_2471_2971 166
204 3300044842 Ga0466957_0001041 Ga0466957_0001041_2154_2654 166
205 3300044901 Ga0466960_0179100 Ga0466960_0179100_236_736 166
206 3300045049 Ga0466959_0003724 Ga0466959_0003724_6842_7342 166
207 3300045836 Ga0466958_0000359 Ga0466958_0000359_16511_17011 166
208 3300045976 Ga0466967_0035226 Ga0466967_0035226_333_833 166
209 3300045976 Ga0466967_0164781 Ga0466967_0164781_78_578 166
210 3300046453 Ga0495627_056793 Ga0495627_056793_99_599 166
211 3300046454 Ga0495592_0098763 Ga0495592_0098763_76_576 166
212 3300046455 Ga0495603_0001710 Ga0495603_0001710_1678_2178 166
213 3300046455 Ga0495603_0037479 Ga0495603_0037479_810_1310 166
214 3300046459 Ga0495629_0025194 Ga0495629_0025194_3362_3862 166
215 3300046459 Ga0495629_0028252 Ga0495629_0028252_146_667 166
216 3300046459 Ga0495629_0150104 Ga0495629_0150104_234_734 166
217 3300046460 Ga0495638_0102164 Ga0495638_0102164_1088_1588 166
218 3300046462 Ga0495651_0309324 Ga0495651_0309324_332_832 166
219 3300046473 Ga0495582_0541782 Ga0495582_0541782_123_623 166
220 3300046474 Ga0495605_0013750 Ga0495605_0013750_801_1301 166
221 3300046474 Ga0495605_0041825 Ga0495605_0041825_1099_1599 166
222 3300046475 Ga0495639_0051750 Ga0495639_0051750_391_891 166
223 3300046476 Ga0495662_0011464 Ga0495662_0011464_2450_2950 166
224 3300046476 Ga0495662_0025730 Ga0495662_0025730_201_701 166
225 3300046491 Ga0495584_0486598 Ga0495584_0486598_104_604 166
226 3300046492 Ga0495585_0209202 Ga0495585_0209202_234_734 166
227 3300046499 Ga0495594_0004121 Ga0495594_0004121_1605_2105 166
228 3300046499 Ga0495594_0120067 Ga0495594_0120067_150_650 166
229 3300046500 Ga0495596_0113307 Ga0495596_0113307_135_635 166
230 3300046501 Ga0495607_0295798 Ga0495607_0295798_141_641 166
231 3300046506 Ga0495583_0007811 Ga0495583_0007811_3148_3648 166
232 3300046507 Ga0495606_0052690 Ga0495606_0052690_1091_1591 166
233 3300046507 Ga0495606_0075170 Ga0495606_0075170_32_532 166
234 3300046513 Ga0495616_0035909 Ga0495616_0035909_130_630 166
235 3300046515 Ga0495620_0003729 Ga0495620_0003729_4083_4583 166
236 3300046516 Ga0495628_0392599 Ga0495628_0392599_177_698 166
237 3300046518 Ga0495631_0000896 Ga0495631_0000896_138_638 166
238 3300046519 Ga0495632_0036016 Ga0495632_0036016_572_1072 166
239 3300046520 Ga0495637_0018422 Ga0495637_0018422_2176_2676 166
240 3300046522 Ga0495643_0121466 Ga0495643_0121466_317_817 166
241 3300046522 Ga0495643_0172259 Ga0495643_0172259_221_721 166
242 3300046526 Ga0495666_0049586 Ga0495666_0049586_693_1193 166
243 3300046528 Ga0495642_0011933 Ga0495642_0011933_321_821 166
244 3300046528 Ga0495642_0145492 Ga0495642_0145492_361_861 166
245 3300046529 Ga0495652_0465665 Ga0495652_0465665_147_647 166
246 3300046538 Ga0495609_0131918 Ga0495609_0131918_552_1052 166
247 3300046558 Ga0495633_0060931 Ga0495633_0060931_310_810 166
248 3300046559 Ga0495667_0420485 Ga0495667_0420485_145_645 166
249 3300046648 Ga0495611_0050610 Ga0495611_0050610_1089_1589 166
250 3300046660 Ga0495625_0013091 Ga0495625_0013091_2017_2517 166
251 3300046663 Ga0495635_0257053 Ga0495635_0257053_473_973 166
252 3300046674 Ga0495588_0007870 Ga0495588_0007870_1063_1563 166
253 3300046675 Ga0495657_0085384 Ga0495657_0085384_299_799 166
254 3300046689 Ga0495613_0032608 Ga0495613_0032608_2777_3277 166
255 3300046689 Ga0495613_0033894 Ga0495613_0033894_875_1375 166
256 3300046689 Ga0495613_0044612 Ga0495613_0044612_2545_3045 166
257 3300046690 Ga0495624_0069731 Ga0495624_0069731_504_1004 166
258 3300046794 Ga0495589_0012772 Ga0495589_0012772_3042_3542 166
259 3300046794 Ga0495589_0107125 Ga0495589_0107125_407_907 166
260 3300046809 Ga0495600_0099852 Ga0495600_0099852_770_1270 166
261 3300046810 Ga0495660_0128844 Ga0495660_0128844_642_1142 166
262 3300047315 Ga0495581_0066502 Ga0495581_0066502_1446_1946 166
263 3300047315 Ga0495581_0091459 Ga0495581_0091459_123_623 166
264 3300047315 Ga0495581_0704212 Ga0495581_0704212_20_520 166
265 3300047318 Ga0495636_0000735 Ga0495636_0000735_4998_5498 166
266 3300047320 Ga0495672_0208688 Ga0495672_0208688_77_577 166
267 3300047322 Ga0495680_0074080 Ga0495680_0074080_1499_1999 166
268 3300047323 Ga0495683_0119709 Ga0495683_0119709_191_691 166
269 3300047443 Ga0495687_008715 Ga0495687_008715_4476_4976 166
270 3300047444 Ga0495675_0002626 Ga0495675_0002626_733_1233 166
271 3300047444 Ga0495675_0103910 Ga0495675_0103910_16_516 166
272 3300047445 Ga0495677_0250662 Ga0495677_0250662_28_528 166
273 3300047447 Ga0495685_029960 Ga0495685_029960_1116_1616 166
274 3300047470 Ga0495681_0002967 Ga0495681_0002967_1889_2389 166
275 3300047470 Ga0495681_0077416 Ga0495681_0077416_445_945 166
276 3300047471 Ga0495684_0168019 Ga0495684_0168019_39_539 166
277 3300047472 Ga0495686_0030231 Ga0495686_0030231_1941_2441 166
278 3300047673 Ga0495593_0053377 Ga0495593_0053377_964_1464 166
279 3300048088 Ga0495602_0347098 Ga0495602_0347098_420_920 166
280 3300048089 Ga0495614_0000574 Ga0495614_0000574_12693_13193 166
281 3300048089 Ga0495614_0027908 Ga0495614_0027908_871_1371 166
282 3300048907 Ga0496104_0512920 Ga0496104_0512920_410_910 166
283 3300048908 Ga0496105_0685283 Ga0496105_0685283_46_546 166
284 3300048929 Ga0496126_1075780 Ga0496126_1075780_39_539 166
285 3300049459 Ga0495678_199069 Ga0495678_199069_20_520 166
286 3300049460 Ga0495682_0052508 Ga0495682_0052508_409_909 166
287 3300049568 Ga0501031_0123710 Ga0501031_0123710_468_977 166
288 3300049570 Ga0501033_0061323 Ga0501033_0061323_560_1081 166
289 3300049571 Ga0501034_0199744 Ga0501034_0199744_1205_1726 166
290 3300049571 Ga0501034_0741674 Ga0501034_0741674_342_842 166
291 3300049573 Ga0501037_0178850 Ga0501037_0178850_96_611 166
292 3300049574 Ga0501038_0384541 Ga0501038_0384541_242_763 166
293 3300049574 Ga0501038_1085951 Ga0501038_1085951_16_516 166
294 3300049578 Ga0501042_0146058 Ga0501042_0146058_400_915 166
295 3300049579 Ga0501043_0138023 Ga0501043_0138023_137_646 166
296 3300049581 Ga0501047_0000029 Ga0501047_0000029_17956_18471 166
297 3300049581 Ga0501047_0239735 Ga0501047_0239735_874_1383 166
298 3300049582 Ga0501048_0463218 Ga0501048_0463218_251_760 166
299 3300049586 Ga0501070_0078214 Ga0501070_0078214_1951_2454 166
300 3300049822 Ga0501035_0129551 Ga0501035_0129551_1531_2040 166
301 3300049822 Ga0501035_0808813 Ga0501035_0808813_190_705 166
302 3300049823 Ga0501044_0087053 Ga0501044_0087053_463_963 166
303 3300050490 nmdc:mga03n38_4026_c1 nmdc:mga03n38_4026_c1_3308_3811 166
304 3300050496 nmdc:mga07m45_17522_c1 nmdc:mga07m45_17522_c1_697_1200 166
305 3300053079 Ga0500610_0419881 Ga0500610_0419881_14_514 166
306 3300053098 Ga0500650_0243823 Ga0500650_0243823_179_679 166
307 3300061719 Ga0466962_0003771 Ga0466962_0003771_4372_4872 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04167

DUF402

Protein of unknown function (DUF402)

78

136

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d8q-assembly1.cif.gz_A the structure of nucleotide phosphatase sa1684 complex with gdp analogue from staphylococcus aureus 0.798 6 161
3exm-assembly1.cif.gz_A crystal structure of the phosphatase sc4828 with the non-hydrolyzable nucleotide gpcp 0.7776 9 158
5zdn-assembly1.cif.gz_A the complex structure of fomd with cdp 0.7762 9 159
7kwq-assembly1.cif.gz_A spermidine n-acetyltransferase speg r149-k152 chimera from vibrio cholerae and hssat 0.7679 70 92
7d8q-assembly1.cif.gz_A the structure of nucleotide phosphatase sa1684 complex with gdp analogue from staphylococcus aureus 0.7482 6 161
ID Description Score Start End Superfamily
af_Q2G0C7_40_167_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.8332 49 162 2.40.380.10
af_Q2G2M8_8_173_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7904 9 161 2.40.380.10
3cbtA01 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7701 9 158 2.40.380.10
4jlyA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7579 70 92 3.40.630.30
af_Q2G0C7_40_167_2.40.380.10 Mainly Beta;Beta Barrel;FomD barrel-like fold;FomD-like 0.7451 49 162 2.40.380.10
ID Description Score Start End GO Terms
AF-A0A0S1UV97-F1-model_v4 deleted 0.9963 17 166
AF-A0A2G1XBI5-F1-model_v4 DUF402 domain-containing protein 0.9941 9 166 GO:0016787
AF-L8P6V0-F1-model_v4 DUF402 domain-containing protein 0.9935 15 166 GO:0016787
AF-A0A6A0C5G3-F1-model_v4 deleted 0.9926 9 166
AF-A0A6I6FV34-F1-model_v4 DUF402 domain-containing protein 0.9917 9 159 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.1 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map