F399391

General Info

Members Datasets Scaffolds Average Seq Length
307 212 614 167

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0128824|Ga0501038_0128824_961_1707
Length 194
Sequence MTDSSSATGSTPDHGSTDGRRRPLAVFDLDNTLADTAHRQRFLQRRPRDWDAFFAAAPADPPIPEGVRLARDSARECEVVYLTGRPERCRRDTLDWLAAHGLPPGPVHMRRDEDRRPARRTKLEVLRRLARDREIRVLVDDDELVCDDAERAGFRVLRARWAAASAELRGRAGARGPHLNSAREQDPARARARP

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
34 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
35 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
36 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
37 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
38 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
39 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
40 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
41 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
42 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
43 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
44 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
45 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
46 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
49 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
50 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
54 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
55 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
56 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
57 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
60 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
61 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
62 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
63 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
64 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
65 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
85 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
92 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
93 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
104 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
173 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
174 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
175 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
177 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
178 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
179 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
180 2643221647 Streptomyces sp. Root369 Isolate Unclassified
181 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
182 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
183 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
184 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
185 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
186 2808606448 Streptomyces sp. 193411 Isolate Unclassified
187 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
188 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
189 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
190 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
191 2867428634 Streptomyces sp. RP5T Isolate Unclassified
192 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
193 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
194 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
195 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
196 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
197 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
198 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
199 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
200 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
201 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
202 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
203 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
204 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
205 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
206 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
207 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
208 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
209 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
210 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
211 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
212 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.95
Metatranscriptomes 0.33
Isolates 11.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 2.28
Rhizosphere 81.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0128824 3300049574 Bacteria 2080
2 rootH1_10015850 3300003316 Bacteria 4025
3 rootH2_10063116 3300003320 Bacteria 1557
4 rootH1_10047637 3300003323 Bacteria 8162
5 Ga0006562J51391_1058095 3300003578 Bacteria 7111
6 Ga0068853_100122082 3300005539 Bacteria 2325
7 Ga0081455_10129436 3300005937 Bacteria 1976
8 Ga0075365_10329783 3300006038 Bacteria 1075
9 Ga0075363_100048310 3300006048 Bacteria 2262
10 Ga0075367_10001716 3300006178 Bacteria 9597
11 Ga0105251_10056420 3300009011 Bacteria 1859
12 Ga0105244_10162599 3300009036 Bacteria 1066
13 Ga0105250_10104785 3300009092 Bacteria 1156
14 Ga0105245_10668633 3300009098 Bacteria 1070
15 Ga0105243_11970034 3300009148 Bacteria 618
16 Ga0105238_11132922 3300009551 Bacteria 806
17 Ga0105239_10544153 3300010375 Bacteria 1322
18 Ga0157369_10159030 3300013105 Bacteria 2385
19 Ga0157375_12489156 3300013308 Bacteria 618
20 Ga0182008_10004015 3300014497 Bacteria 8695
21 Ga0182006_1037256 3300015261 Bacteria 1929
22 Ga0182007_10000563 3300015262 Bacteria 21840
23 Ga0207647_10317835 3300025904 Bacteria 885
24 Ga0207707_10600438 3300025912 Bacteria 932
25 Ga0207639_10158536 3300026041 Bacteria 1904
26 Ga0307515_10000325 3300028794 Bacteria 118141
27 Ga0307511_10318083 3300030521 Bacteria 690
28 Ga0307512_10040417 3300030522 Bacteria 3892
29 Ga0307512_10123845 3300030522 Bacteria 1649
30 Ga0307513_10141324 3300031456 Bacteria 2333
31 Ga0307513_10154125 3300031456 Bacteria 2200
32 Ga0307509_10007319 3300031507 Bacteria 14483
33 Ga0307508_10003278 3300031616 Bacteria 16503
34 Ga0307508_10004543 3300031616 Bacteria 13521
35 Ga0307514_10008776 3300031649 Bacteria 8559
36 Ga0307514_10103178 3300031649 Bacteria 2042
37 Ga0307518_10345224 3300031838 Bacteria 871
38 Ga0307507_10009781 3300033179 Bacteria 12655
39 Ga0307507_10096223 3300033179 Bacteria 2506
40 Ga0307510_10009726 3300033180 Bacteria 11444
41 Ga0307510_10020803 3300033180 Bacteria 7661
42 Ga0395898_0002046 3300037466 Bacteria 25206
43 Ga0395898_0007598 3300037466 Bacteria 11509
44 Ga0395905_0327970 3300037471 Bacteria 1421
45 Ga0395901_0102550 3300038443 Bacteria 3003
46 Ga0439436_0000329 3300041404 Bacteria 11642
47 Ga0439439_0024138 3300041406 Bacteria 1525
48 Ga0439439_0096499 3300041406 Bacteria 811
49 Ga0439465_0121962 3300041413 Bacteria 914
50 Ga0451800_0986007 3300041459 Bacteria 760
51 Ga0451837_0272146 3300041494 Bacteria 1281
52 Ga0451853_0347077 3300041512 Bacteria 10114
53 Ga0451853_0644947 3300041512 Bacteria 2290
54 Ga0439433_0001212 3300041999 Bacteria 5314
55 Ga0439442_005871 3300042002 Bacteria 2459
56 Ga0439448_0000998 3300042005 Bacteria 7044
57 Ga0439432_105986 3300042006 Bacteria 838
58 Ga0439450_041379 3300042008 Bacteria 1071
59 Ga0439455_0000753 3300042012 Bacteria 4860
60 Ga0439457_000080 3300042014 Bacteria 21388
61 Ga0439462_0003086 3300042015 Bacteria 3960
62 Ga0450894_000744 3300042131 Bacteria 5359
63 Ga0450896_001231 3300042133 Bacteria 3088
64 Ga0450898_086769 3300042134 Bacteria 642
65 Ga0450903_001241 3300042138 Bacteria 4788
66 Ga0439458_0000266 3300042157 Bacteria 12806
67 Ga0466969_0044935 3300044656 Bacteria 2194
68 Ga0466965_0009387 3300044683 Bacteria 4545
69 Ga0466966_0000456 3300044684 Bacteria 26320
70 Ga0466966_0253364 3300044684 Bacteria 1060
71 Ga0466961_0000862 3300044693 Bacteria 18935
72 Ga0466963_0001691 3300044694 Bacteria 12018
73 Ga0466964_0015148 3300044706 Bacteria 2935
74 Ga0466971_0000175 3300044719 Bacteria 24166
75 Ga0466971_0021309 3300044719 Bacteria 2885
76 Ga0466968_0099494 3300044735 Bacteria 1297
77 Ga0466970_0002379 3300044765 Bacteria 9090
78 Ga0466957_0000357 3300044842 Bacteria 22414
79 Ga0466959_0000302 3300045049 Bacteria 29272
80 Ga0466958_0000082 3300045836 Bacteria 29102
81 Ga0466958_0179342 3300045836 Bacteria 1344
82 Ga0466967_0011599 3300045976 Bacteria 6689
83 Ga0466967_0312272 3300045976 Bacteria 1514
84 Ga0466967_0758276 3300045976 Bacteria 963
85 Ga0466967_1265097 3300045976 Bacteria 735
86 Ga0495617_013629 3300046452 Bacteria 2765
87 Ga0495617_022623 3300046452 Bacteria 2125
88 Ga0495627_076482 3300046453 Bacteria 974
89 Ga0495592_0087125 3300046454 Bacteria 2247
90 Ga0495603_0010268 3300046455 Bacteria 5668
91 Ga0495603_0022460 3300046455 Bacteria 3818
92 Ga0495590_0138821 3300046457 Bacteria 877
93 Ga0495629_0016312 3300046459 Bacteria 5329
94 Ga0495629_0068073 3300046459 Bacteria 2484
95 Ga0495629_0135493 3300046459 Bacteria 1714
96 Ga0495638_0394612 3300046460 Bacteria 719
97 Ga0495651_0116395 3300046462 Bacteria 1969
98 Ga0495582_0025930 3300046473 Bacteria 3212
99 Ga0495582_0093088 3300046473 Bacteria 1682
100 Ga0495605_0001251 3300046474 Bacteria 16850
101 Ga0495662_0001297 3300046476 Bacteria 12369
102 Ga0495662_0003045 3300046476 Bacteria 8452
103 Ga0495662_0035156 3300046476 Bacteria 2418
104 Ga0495664_0291847 3300046477 Bacteria 985
105 Ga0495584_0533281 3300046491 Bacteria 598
106 Ga0495585_0059913 3300046492 Bacteria 2096
107 Ga0495585_0334041 3300046492 Bacteria 739
108 Ga0495594_0203132 3300046499 Bacteria 1129
109 Ga0495594_0222866 3300046499 Bacteria 1075
110 Ga0495596_0092918 3300046500 Bacteria 1171
111 Ga0495607_0023972 3300046501 Bacteria 3811
112 Ga0495583_0031320 3300046506 Bacteria 2579
113 Ga0495583_0040981 3300046506 Bacteria 2171
114 Ga0495606_0003973 3300046507 Bacteria 15146
115 Ga0495608_0145618 3300046511 Bacteria 1511
116 Ga0495616_0002179 3300046513 Bacteria 13097
117 Ga0495618_0124685 3300046514 Bacteria 1649
118 Ga0495620_0002640 3300046515 Bacteria 10363
119 Ga0495620_0021048 3300046515 Bacteria 3173
120 Ga0495628_0052247 3300046516 Bacteria 3228
121 Ga0495628_0156821 3300046516 Bacteria 1731
122 Ga0495630_0038818 3300046517 Bacteria 3562
123 Ga0495631_0013527 3300046518 Bacteria 3959
124 Ga0495632_0228445 3300046519 Bacteria 840
125 Ga0495643_0030335 3300046522 Bacteria 3020
126 Ga0495648_0064384 3300046524 Bacteria 2160
127 Ga0495652_0203213 3300046529 Bacteria 1502
128 Ga0495652_0526332 3300046529 Bacteria 816
129 Ga0495640_0000601 3300046533 Bacteria 26498
130 Ga0495640_0146857 3300046533 Bacteria 1517
131 Ga0495586_0288879 3300046535 Bacteria 939
132 Ga0495609_0116009 3300046538 Bacteria 1153
133 Ga0495597_0003532 3300046542 Bacteria 9040
134 Ga0495597_0006030 3300046542 Bacteria 6317
135 Ga0495622_0068079 3300046557 Bacteria 1644
136 Ga0495633_0168787 3300046558 Bacteria 1009
137 Ga0495667_0096721 3300046559 Bacteria 1911
138 Ga0495656_0076130 3300046615 Bacteria 1503
139 Ga0495668_0047654 3300046616 Bacteria 2379
140 Ga0495634_0003156 3300046642 Bacteria 13347
141 Ga0495634_0034929 3300046642 Bacteria 3447
142 Ga0495625_0148463 3300046660 Bacteria 1577
143 Ga0495625_0150379 3300046660 Bacteria 1565
144 Ga0495625_0215669 3300046660 Bacteria 1260
145 Ga0495625_0283006 3300046660 Bacteria 1066
146 Ga0495635_0000315 3300046663 Bacteria 31453
147 Ga0495635_0035256 3300046663 Bacteria 3469
148 Ga0495635_0535048 3300046663 Bacteria 769
149 Ga0495661_0293452 3300046665 Bacteria 816
150 Ga0495588_0012700 3300046674 Bacteria 3989
151 Ga0495657_0003809 3300046675 Bacteria 12210
152 Ga0495657_0005909 3300046675 Bacteria 9618
153 Ga0495657_0009737 3300046675 Bacteria 7255
154 Ga0495657_0076507 3300046675 Bacteria 2173
155 Ga0495623_0130404 3300046679 Bacteria 1506
156 Ga0495646_0029539 3300046680 Bacteria 3426
157 Ga0495613_0001781 3300046689 Bacteria 16365
158 Ga0495613_0004939 3300046689 Bacteria 10018
159 Ga0495613_0011361 3300046689 Bacteria 6616
160 Ga0495613_0013302 3300046689 Bacteria 6113
161 Ga0495613_0017792 3300046689 Bacteria 5296
162 Ga0495624_0111996 3300046690 Bacteria 1677
163 Ga0495624_0183958 3300046690 Bacteria 1272
164 Ga0495624_0249244 3300046690 Bacteria 1074
165 Ga0495670_0345555 3300046691 Bacteria 800
166 Ga0495671_0036960 3300046692 Bacteria 2472
167 Ga0495671_0224009 3300046692 Bacteria 910
168 Ga0495649_0213795 3300046694 Bacteria 999
169 Ga0495589_0021937 3300046794 Bacteria 3262
170 Ga0495589_0042823 3300046794 Bacteria 2255
171 Ga0495589_0107307 3300046794 Bacteria 1349
172 Ga0495589_0145433 3300046794 Bacteria 1133
173 Ga0495600_0383208 3300046809 Bacteria 877
174 Ga0495660_0045431 3300046810 Bacteria 2411
175 Ga0495660_0063969 3300046810 Bacteria 1967
176 Ga0495581_0008162 3300047315 Bacteria 6062
177 Ga0495581_0064428 3300047315 Bacteria 2117
178 Ga0495581_0234223 3300047315 Bacteria 1074
179 Ga0495581_0266299 3300047315 Bacteria 1002
180 Ga0495604_0000708 3300047317 Bacteria 28349
181 Ga0495604_0018254 3300047317 Bacteria 5617
182 Ga0495604_0318772 3300047317 Bacteria 1039
183 Ga0495636_0001078 3300047318 Bacteria 10256
184 Ga0495636_0041404 3300047318 Bacteria 1912
185 Ga0495636_0041939 3300047318 Bacteria 1900
186 Ga0495636_0227552 3300047318 Bacteria 857
187 Ga0495674_0688058 3300047319 Bacteria 803
188 Ga0495676_0009141 3300047321 Bacteria 9033
189 Ga0495676_0029953 3300047321 Bacteria 4626
190 Ga0495676_0089666 3300047321 Bacteria 2303
191 Ga0495680_0074573 3300047322 Bacteria 2576
192 Ga0495680_0228103 3300047322 Bacteria 1327
193 Ga0495683_0054189 3300047323 Bacteria 1999
194 Ga0495687_003376 3300047443 Bacteria 11653
195 Ga0495687_014353 3300047443 Bacteria 4082
196 Ga0495687_025373 3300047443 Bacteria 2803
197 Ga0495687_069112 3300047443 Bacteria 1423
198 Ga0495687_083794 3300047443 Bacteria 1240
199 Ga0495687_113452 3300047443 Bacteria 991
200 Ga0495675_0004010 3300047444 Bacteria 8924
201 Ga0495685_019844 3300047447 Bacteria 2310
202 Ga0495685_033365 3300047447 Bacteria 1768
203 Ga0495685_044360 3300047447 Bacteria 1516
204 Ga0495685_057600 3300047447 Bacteria 1312
205 Ga0495685_057962 3300047447 Bacteria 1307
206 Ga0495685_074184 3300047447 Bacteria 1137
207 Ga0495681_0003263 3300047470 Bacteria 11314
208 Ga0495681_0225041 3300047470 Bacteria 751
209 Ga0495684_0148937 3300047471 Bacteria 1751
210 Ga0495684_0750911 3300047471 Bacteria 642
211 Ga0495686_0005561 3300047472 Bacteria 9909
212 Ga0495686_0094294 3300047472 Bacteria 1814
213 Ga0495686_0116041 3300047472 Bacteria 1600
214 Ga0495593_0123882 3300047673 Bacteria 1314
215 Ga0495593_0213216 3300047673 Bacteria 969
216 Ga0495602_0087836 3300048088 Bacteria 2590
217 Ga0495614_0006496 3300048089 Bacteria 5247
218 Ga0495614_0011415 3300048089 Bacteria 3911
219 Ga0495614_0019582 3300048089 Bacteria 2928
220 Ga0495614_0131839 3300048089 Bacteria 1106
221 Ga0495626_0011919 3300048091 Bacteria 4577
222 Ga0496100_1202648 3300048903 Bacteria 598
223 Ga0496104_0426665 3300048907 Bacteria 1238
224 Ga0496105_0378428 3300048908 Bacteria 1127
225 Ga0496108_0740826 3300048911 Bacteria 850
226 Ga0496109_0051474 3300048912 Bacteria 3751
227 Ga0496110_0776202 3300048913 Bacteria 862
228 Ga0496121_0593570 3300048924 Bacteria 685
229 Ga0495678_123615 3300049459 Bacteria 866
230 Ga0501033_0024677 3300049570 Bacteria 4533
231 Ga0501033_0066043 3300049570 Bacteria 2660
232 Ga0501034_0037309 3300049571 Bacteria 4920
233 Ga0501034_0185604 3300049571 Bacteria 2043
234 Ga0501036_0008623 3300049572 Bacteria 8365
235 Ga0501036_0009238 3300049572 Bacteria 8105
236 Ga0501036_0171672 3300049572 Bacteria 1827
237 Ga0501038_0000755 3300049574 Bacteria 28852
238 Ga0501038_0144811 3300049574 Bacteria 1941
239 Ga0501038_0425303 3300049574 Bacteria 1024
240 Ga0501039_0015271 3300049575 Bacteria 5878
241 Ga0501042_0198537 3300049578 Bacteria 1447
242 Ga0501043_0002922 3300049579 Bacteria 14262
243 Ga0501047_0028670 3300049581 Bacteria 5369
244 Ga0501048_0222471 3300049582 Bacteria 1339
245 Ga0501070_0007029 3300049586 Bacteria 9575
246 Ga0501070_0052349 3300049586 Bacteria 3389
247 Ga0501070_0089542 3300049586 Bacteria 2547
248 Ga0501070_0336593 3300049586 Bacteria 1226
249 Ga0501071_1034078 3300049587 Bacteria 635
250 Ga0501073_0293841 3300049589 Bacteria 1121
251 Ga0501074_0015294 3300049590 Bacteria 5577
252 Ga0501035_0002137 3300049822 Bacteria 19655
253 Ga0501035_0038627 3300049822 Bacteria 4322
254 Ga0501035_0078755 3300049822 Bacteria 2911
255 Ga0501035_0307410 3300049822 Bacteria 1334
256 Ga0501044_0018221 3300049823 Bacteria 7530
257 Ga0501044_0031397 3300049823 Bacteria 5592
258 Ga0501044_0449824 3300049823 Bacteria 1195
259 nmdc:mga0yw44_55297_c1 3300050492 Bacteria 2414
260 nmdc:mga06z11_1188_c1 3300050494 Bacteria 9582
261 nmdc:mga04h51_4085_c1 3300050495 Bacteria 3597
262 Ga0495601_0341737 3300053077 Bacteria 974
263 Ga0495655_0027403 3300053083 Bacteria 1351
264 Ga0500578_0169667 3300053086 Bacteria 1350
265 Ga0500641_0037049 3300053096 Bacteria 1954
266 Ga0500553_041386 3300053101 Bacteria 2257
267 Ga0500573_0207251 3300053140 Bacteria 1037
268 Ga0500600_0195574 3300053149 Bacteria 958
269 Ga0500600_0228568 3300053149 Bacteria 852
270 Ga0500624_010093 3300053157 Bacteria 1354
271 Ga0466962_0000544 3300061719 Bacteria 16587
272 2547412243 2547132111 Bacteria 8013147
273 2585304360 2582581313 Bacteria 10042643
274 2616696037 2616644814 Bacteria 11555299
275 2644270581 2643221647 Bacteria 10741251
276 2644440742 2643221678 Bacteria 9540101
277 2784592116 2784132148 Bacteria 8627943
278 2785373432 2784746768 Bacteria 10036182
279 2786674566 2786546132 Bacteria 10419719
280 2808845540 2808606359 Bacteria 9866990
281 2809235800 2808606448 Bacteria 8656184
282 2811843085 2808606982 Bacteria 7791042
283 2812482979 2811994917 Bacteria 7761064
284 2852635826 2852635781 Bacteria 8251373
285 2862282860 2862281513 Bacteria 9621493
286 2867431403 2867428634 Bacteria 9590268
287 2877677488 2877676314 Bacteria 9512378
288 2912715740 2912715099 Bacteria 9460473
289 2919472889 2919468124 Bacteria 9133025
290 2946071560 2946064051 Bacteria 8957905
291 2947225222 2947224130 Bacteria 9938529
292 2954009402 2954002825 Bacteria 9173742
293 2954382221 2954380949 Bacteria 10050426
294 2954680837 2954673503 Bacteria 9685905
295 2954683318 2954682443 Bacteria 9862841
296 2954693046 2954691527 Bacteria 10720516
297 2954708120 2954701450 Bacteria 10834262
298 2954712722 2954711539 Bacteria 10867210
299 2954722681 2954721474 Bacteria 10456478
300 2954739180 2954731030 Bacteria 10243860
301 2954741560 2954740390 Bacteria 10229294
302 2954758008 2954749733 Bacteria 10366972
303 2954760572 2954759201 Bacteria 9358192
304 3006494416 3006493962 Bacteria 8825450
305 8023624205 8023623736 Bacteria 8593882
306 8048408627 8048406513 Bacteria 8936924
307 8056836358 8056829672 Bacteria 9045328
308 Ga0501038_0128824
309 rootH1_10015850
310 rootH2_10063116
311 rootH1_10047637
312 Ga0006562J51391_1058095
313 Ga0068853_100122082
314 Ga0081455_10129436
315 Ga0075365_10329783
316 Ga0075363_100048310
317 Ga0075367_10001716
318 Ga0105251_10056420
319 Ga0105244_10162599
320 Ga0105250_10104785
321 Ga0105245_10668633
322 Ga0105243_11970034
323 Ga0105238_11132922
324 Ga0105239_10544153
325 Ga0157369_10159030
326 Ga0157375_12489156
327 Ga0182008_10004015
328 Ga0182006_1037256
329 Ga0182007_10000563
330 Ga0207647_10317835
331 Ga0207707_10600438
332 Ga0207639_10158536
333 Ga0307515_10000325
334 Ga0307511_10318083
335 Ga0307512_10040417
336 Ga0307512_10123845
337 Ga0307513_10141324
338 Ga0307513_10154125
339 Ga0307509_10007319
340 Ga0307508_10003278
341 Ga0307508_10004543
342 Ga0307514_10008776
343 Ga0307514_10103178
344 Ga0307518_10345224
345 Ga0307507_10009781
346 Ga0307507_10096223
347 Ga0307510_10009726
348 Ga0307510_10020803
349 Ga0395898_0002046
350 Ga0395898_0007598
351 Ga0395905_0327970
352 Ga0395901_0102550
353 Ga0439436_0000329
354 Ga0439439_0024138
355 Ga0439439_0096499
356 Ga0439465_0121962
357 Ga0451800_0986007
358 Ga0451837_0272146
359 Ga0451853_0347077
360 Ga0451853_0644947
361 Ga0439433_0001212
362 Ga0439442_005871
363 Ga0439448_0000998
364 Ga0439432_105986
365 Ga0439450_041379
366 Ga0439455_0000753
367 Ga0439457_000080
368 Ga0439462_0003086
369 Ga0450894_000744
370 Ga0450896_001231
371 Ga0450898_086769
372 Ga0450903_001241
373 Ga0439458_0000266
374 Ga0466969_0044935
375 Ga0466965_0009387
376 Ga0466966_0000456
377 Ga0466966_0253364
378 Ga0466961_0000862
379 Ga0466963_0001691
380 Ga0466964_0015148
381 Ga0466971_0000175
382 Ga0466971_0021309
383 Ga0466968_0099494
384 Ga0466970_0002379
385 Ga0466957_0000357
386 Ga0466959_0000302
387 Ga0466958_0000082
388 Ga0466958_0179342
389 Ga0466967_0011599
390 Ga0466967_0312272
391 Ga0466967_0758276
392 Ga0466967_1265097
393 Ga0495617_013629
394 Ga0495617_022623
395 Ga0495627_076482
396 Ga0495592_0087125
397 Ga0495603_0010268
398 Ga0495603_0022460
399 Ga0495590_0138821
400 Ga0495629_0016312
401 Ga0495629_0068073
402 Ga0495629_0135493
403 Ga0495638_0394612
404 Ga0495651_0116395
405 Ga0495582_0025930
406 Ga0495582_0093088
407 Ga0495605_0001251
408 Ga0495662_0001297
409 Ga0495662_0003045
410 Ga0495662_0035156
411 Ga0495664_0291847
412 Ga0495584_0533281
413 Ga0495585_0059913
414 Ga0495585_0334041
415 Ga0495594_0203132
416 Ga0495594_0222866
417 Ga0495596_0092918
418 Ga0495607_0023972
419 Ga0495583_0031320
420 Ga0495583_0040981
421 Ga0495606_0003973
422 Ga0495608_0145618
423 Ga0495616_0002179
424 Ga0495618_0124685
425 Ga0495620_0002640
426 Ga0495620_0021048
427 Ga0495628_0052247
428 Ga0495628_0156821
429 Ga0495630_0038818
430 Ga0495631_0013527
431 Ga0495632_0228445
432 Ga0495643_0030335
433 Ga0495648_0064384
434 Ga0495652_0203213
435 Ga0495652_0526332
436 Ga0495640_0000601
437 Ga0495640_0146857
438 Ga0495586_0288879
439 Ga0495609_0116009
440 Ga0495597_0003532
441 Ga0495597_0006030
442 Ga0495622_0068079
443 Ga0495633_0168787
444 Ga0495667_0096721
445 Ga0495656_0076130
446 Ga0495668_0047654
447 Ga0495634_0003156
448 Ga0495634_0034929
449 Ga0495625_0148463
450 Ga0495625_0150379
451 Ga0495625_0215669
452 Ga0495625_0283006
453 Ga0495635_0000315
454 Ga0495635_0035256
455 Ga0495635_0535048
456 Ga0495661_0293452
457 Ga0495588_0012700
458 Ga0495657_0003809
459 Ga0495657_0005909
460 Ga0495657_0009737
461 Ga0495657_0076507
462 Ga0495623_0130404
463 Ga0495646_0029539
464 Ga0495613_0001781
465 Ga0495613_0004939
466 Ga0495613_0011361
467 Ga0495613_0013302
468 Ga0495613_0017792
469 Ga0495624_0111996
470 Ga0495624_0183958
471 Ga0495624_0249244
472 Ga0495670_0345555
473 Ga0495671_0036960
474 Ga0495671_0224009
475 Ga0495649_0213795
476 Ga0495589_0021937
477 Ga0495589_0042823
478 Ga0495589_0107307
479 Ga0495589_0145433
480 Ga0495600_0383208
481 Ga0495660_0045431
482 Ga0495660_0063969
483 Ga0495581_0008162
484 Ga0495581_0064428
485 Ga0495581_0234223
486 Ga0495581_0266299
487 Ga0495604_0000708
488 Ga0495604_0018254
489 Ga0495604_0318772
490 Ga0495636_0001078
491 Ga0495636_0041404
492 Ga0495636_0041939
493 Ga0495636_0227552
494 Ga0495674_0688058
495 Ga0495676_0009141
496 Ga0495676_0029953
497 Ga0495676_0089666
498 Ga0495680_0074573
499 Ga0495680_0228103
500 Ga0495683_0054189
501 Ga0495687_003376
502 Ga0495687_014353
503 Ga0495687_025373
504 Ga0495687_069112
505 Ga0495687_083794
506 Ga0495687_113452
507 Ga0495675_0004010
508 Ga0495685_019844
509 Ga0495685_033365
510 Ga0495685_044360
511 Ga0495685_057600
512 Ga0495685_057962
513 Ga0495685_074184
514 Ga0495681_0003263
515 Ga0495681_0225041
516 Ga0495684_0148937
517 Ga0495684_0750911
518 Ga0495686_0005561
519 Ga0495686_0094294
520 Ga0495686_0116041
521 Ga0495593_0123882
522 Ga0495593_0213216
523 Ga0495602_0087836
524 Ga0495614_0006496
525 Ga0495614_0011415
526 Ga0495614_0019582
527 Ga0495614_0131839
528 Ga0495626_0011919
529 Ga0496100_1202648
530 Ga0496104_0426665
531 Ga0496105_0378428
532 Ga0496108_0740826
533 Ga0496109_0051474
534 Ga0496110_0776202
535 Ga0496121_0593570
536 Ga0495678_123615
537 Ga0501033_0024677
538 Ga0501033_0066043
539 Ga0501034_0037309
540 Ga0501034_0185604
541 Ga0501036_0008623
542 Ga0501036_0009238
543 Ga0501036_0171672
544 Ga0501038_0000755
545 Ga0501038_0144811
546 Ga0501038_0425303
547 Ga0501039_0015271
548 Ga0501042_0198537
549 Ga0501043_0002922
550 Ga0501047_0028670
551 Ga0501048_0222471
552 Ga0501070_0007029
553 Ga0501070_0052349
554 Ga0501070_0089542
555 Ga0501070_0336593
556 Ga0501071_1034078
557 Ga0501073_0293841
558 Ga0501074_0015294
559 Ga0501035_0002137
560 Ga0501035_0038627
561 Ga0501035_0078755
562 Ga0501035_0307410
563 Ga0501044_0018221
564 Ga0501044_0031397
565 Ga0501044_0449824
566 nmdc:mga0yw44_55297_c1
567 nmdc:mga06z11_1188_c1
568 nmdc:mga04h51_4085_c1
569 Ga0495601_0341737
570 Ga0495655_0027403
571 Ga0500578_0169667
572 Ga0500641_0037049
573 Ga0500553_041386
574 Ga0500573_0207251
575 Ga0500600_0195574
576 Ga0500600_0228568
577 Ga0500624_010093
578 Ga0466962_0000544
579 2547412243
580 2585304360
581 2616696037
582 2644270581
583 2644440742
584 2784592116
585 2785373432
586 2786674566
587 2808845540
588 2809235800
589 2811843085
590 2812482979
591 2852635826
592 2862282860
593 2867431403
594 2877677488
595 2912715740
596 2919472889
597 2946071560
598 2947225222
599 2954009402
600 2954382221
601 2954680837
602 2954683318
603 2954693046
604 2954708120
605 2954712722
606 2954722681
607 2954739180
608 2954741560
609 2954758008
610 2954760572
611 3006494416
612 8023624205
613 8048408627
614 8056836358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24694

64

140

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xrp-assembly1.cif.gz_D structure of the pnkp1/rnl/hen1 rna repair complex 0.8652 7 126
4fyp-assembly1.cif.gz_B crystal structure of plant vegetative storage protein 0.8528 5 137
4xru-assembly1.cif.gz_D structure of pnkp1/rnl/hen1 complex 0.8133 6 126
4xru-assembly1.cif.gz_A structure of pnkp1/rnl/hen1 complex 0.7764 7 126
1rdf-assembly5.cif.gz_D g50p mutant of phosphonoacetaldehyde hydrolase in complex with substrate analogue vinyl sulfonate 0.7638 36 94
ID Description Score Start End Superfamily
af_Q3UHE1_742_841_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9058 45 116 3.40.50.1000
4fypB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8528 5 137 3.40.50.1000
af_P43125_846_1259_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.8251 7 123 2.60.40.1930
af_K7N2C4_55_272_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8166 8 139 3.40.50.1000
af_A0A1D6NVU1_81_299_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7947 7 139 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1C6R0C8-F1-model_v4 Nucleotidase 0.9731 6 130
AF-A0A4R7IQZ3-F1-model_v4 deleted 0.9709 6 130
AF-A0A1C4QNW4-F1-model_v4 deleted 0.9688 7 130
AF-A0A7L4Y8L2-F1-model_v4 Nucleotidase 0.9682 6 130
AF-A0A0W7WSZ9-F1-model_v4 Nucleotidase 0.9676 6 130

Map