F399389

General Info

Members Datasets Scaffolds Average Seq Length
307 180 614 252

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0014201|Ga0501034_0014201_6370_7272
Length 300
Sequence MVTAPVPTITSVMAPLFAGRVVCAAASRDILSEMPDSRRPEMRQSLKPDVPAARHTLGVLRYLATRSGPVRAATMARDLAVPRSSMYQLLAVMREEGFLVHYPEDGTYGLSGLVAELGTASRRTERLGRLARPLLERLVGAAAVPVVAHLAVLGGSDVIYAGRVQGFRAPTTVSSIGVRLPAHLTATGRAMLAALPPAQVRALYPSRVLLTHRNEAGPSTLPELDRLLAETRERGWAIETGDVTAEYASVGAAAADRNGYPVAAIGLTYRREAVDADTADRLGEAVVQTADALTARLTGG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2643221561 Nocardioides sp. Root151 Isolate Unclassified
167 2643221641 Nocardioides sp. Root122 Isolate Unclassified
168 2643221696 Nocardioides sp. Root140 Isolate Unclassified
169 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
170 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
171 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
172 2739367898 Nocardioides sp. CF479 Isolate Unclassified
173 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
174 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
175 2808606394 Promicromonospora sp. C35 Isolate Unclassified
176 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
177 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
178 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
179 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
180 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.79
Metatranscriptomes 0.33
Isolates 4.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0.33
Rhizoplane 13.03
Rhizosphere 77.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0014201 3300049571 Bacteria 8208
2 Ga0070658_10016015 3300005327 Bacteria 5998
3 Ga0070683_100030659 3300005329 Bacteria 4884
4 Ga0070683_100037718 3300005329 Bacteria 4425
5 Ga0070683_100053014 3300005329 Bacteria 3759
6 Ga0070683_100057168 3300005329 Bacteria 3624
7 Ga0070680_100039819 3300005336 Bacteria 3803
8 Ga0070682_100026302 3300005337 Bacteria 3481
9 Ga0068868_100167828 3300005338 Bacteria 1816
10 Ga0070691_10038017 3300005341 Bacteria 2272
11 Ga0070692_10094042 3300005345 Bacteria 1633
12 Ga0070674_100007435 3300005356 Bacteria 6462
13 Ga0070673_100273615 3300005364 Bacteria 1479
14 Ga0070659_100105406 3300005366 Bacteria 2272
15 Ga0070700_100003680 3300005441 Bacteria 7925
16 Ga0070700_100169271 3300005441 Bacteria 1511
17 Ga0070662_100115212 3300005457 Bacteria 2053
18 Ga0068867_100008968 3300005459 Bacteria 7056
19 Ga0070679_100271193 3300005530 Bacteria 1651
20 Ga0070684_100007685 3300005535 Bacteria 8407
21 Ga0070684_100134787 3300005535 Bacteria 2230
22 Ga0070684_100284994 3300005535 Bacteria 1514
23 Ga0068853_100141462 3300005539 Bacteria 2160
24 Ga0070686_100015726 3300005544 Bacteria 4390
25 Ga0070686_100064791 3300005544 Bacteria 2372
26 Ga0070665_100009735 3300005548 Bacteria 9716
27 Ga0070665_100083996 3300005548 Bacteria 3189
28 Ga0070704_100235525 3300005549 Bacteria 1496
29 Ga0070664_100746791 3300005564 Bacteria 913
30 Ga0068857_100043398 3300005577 Bacteria 3989
31 Ga0068856_100020714 3300005614 Bacteria 6388
32 Ga0070702_100011338 3300005615 Bacteria 4430
33 Ga0068852_100138674 3300005616 Bacteria 2248
34 Ga0068864_100027014 3300005618 Bacteria 4843
35 Ga0068864_100171541 3300005618 Bacteria 1978
36 Ga0068861_100328475 3300005719 Bacteria 1334
37 Ga0068870_10027692 3300005840 Bacteria 2837
38 Ga0068858_100057230 3300005842 Bacteria 3603
39 Ga0068860_100000571 3300005843 Bacteria 44338
40 Ga0068860_100033118 3300005843 Bacteria 4961
41 Ga0081539_10080603 3300005985 Bacteria 1712
42 Ga0075365_10053483 3300006038 Bacteria 2674
43 Ga0075365_10185638 3300006038 Bacteria 1454
44 Ga0075363_100084234 3300006048 Bacteria 1743
45 Ga0075364_10065739 3300006051 Bacteria 2381
46 Ga0070715_10021737 3300006163 Bacteria 2492
47 Ga0075367_10017547 3300006178 Bacteria 3931
48 Ga0068865_100046702 3300006881 Bacteria 2972
49 Ga0068865_100080186 3300006881 Bacteria 2340
50 Ga0068865_100301249 3300006881 Bacteria 1283
51 Ga0111539_10085560 3300009094 Bacteria 3705
52 Ga0105245_10011632 3300009098 Bacteria 7663
53 Ga0105243_10004475 3300009148 Bacteria 11049
54 Ga0105241_10195985 3300009174 Bacteria 1684
55 Ga0105242_10078978 3300009176 Bacteria 2748
56 Ga0105242_10087270 3300009176 Bacteria 2619
57 Ga0105248_10214142 3300009177 Bacteria 2170
58 Ga0105238_10202683 3300009551 Bacteria 1960
59 Ga0105249_10099783 3300009553 Bacteria 2729
60 Ga0105246_10011474 3300011119 Bacteria 5499
61 Ga0105246_10047346 3300011119 Bacteria 2936
62 Ga0163162_10026819 3300013306 Bacteria 5696
63 Ga0157372_10010406 3300013307 Bacteria 9889
64 Ga0157372_10066236 3300013307 Bacteria 4058
65 Ga0157375_10041383 3300013308 Bacteria 4449
66 Ga0157375_10059946 3300013308 Bacteria 3772
67 Ga0157375_10497273 3300013308 Bacteria 1384
68 Ga0157375_10586516 3300013308 Bacteria 1275
69 Ga0157380_10007502 3300014326 Bacteria 7745
70 Ga0182008_10023992 3300014497 Bacteria 3108
71 Ga0157377_10033337 3300014745 Bacteria 2811
72 Ga0157377_10196495 3300014745 Bacteria 1278
73 Ga0157379_10064331 3300014968 Bacteria 3278
74 Ga0213875_10109100 3300021388 Bacteria 1292
75 Ga0207688_10008375 3300025901 Bacteria 5624
76 Ga0207647_10015848 3300025904 Bacteria 5157
77 Ga0207647_10034594 3300025904 Bacteria 3224
78 Ga0207685_10143013 3300025905 Bacteria 1074
79 Ga0207643_10202610 3300025908 Bacteria 1209
80 Ga0207705_10019541 3300025909 Bacteria 4843
81 Ga0207654_10223630 3300025911 Bacteria 1250
82 Ga0207694_10222935 3300025924 Bacteria 1538
83 Ga0207687_10031509 3300025927 Bacteria 3584
84 Ga0207690_10018656 3300025932 Bacteria 4256
85 Ga0207686_10084002 3300025934 Bacteria 2085
86 Ga0207709_10021021 3300025935 Bacteria 3690
87 Ga0207709_10140231 3300025935 Bacteria 1661
88 Ga0207670_10154965 3300025936 Bacteria 1704
89 Ga0207670_10214583 3300025936 Bacteria 1469
90 Ga0207669_10017476 3300025937 Bacteria 3680
91 Ga0207704_10057062 3300025938 Bacteria 2396
92 Ga0207691_10223434 3300025940 Bacteria 1632
93 Ga0207691_10436758 3300025940 Bacteria 1115
94 Ga0207661_10005976 3300025944 Bacteria 8595
95 Ga0207661_10051131 3300025944 Bacteria 3296
96 Ga0207661_10846542 3300025944 Bacteria 842
97 Ga0207651_10221433 3300025960 Bacteria 1530
98 Ga0207712_10185917 3300025961 Bacteria 1636
99 Ga0207712_10206249 3300025961 Bacteria 1562
100 Ga0207658_10022609 3300025986 Bacteria 4380
101 Ga0207708_10000448 3300026075 Bacteria 32061
102 Ga0207702_10089009 3300026078 Bacteria 2699
103 Ga0207702_10597310 3300026078 Bacteria 1083
104 Ga0207676_10044723 3300026095 Bacteria 3418
105 Ga0207674_10017204 3300026116 Bacteria 7889
106 Ga0207674_10314696 3300026116 Bacteria 1514
107 Ga0207675_100208165 3300026118 Bacteria 1880
108 Ga0207698_10528431 3300026142 Bacteria 1152
109 Ga0207428_10108527 3300027907 Bacteria 2138
110 Ga0268266_10000596 3300028379 Bacteria 49462
111 Ga0268266_10118861 3300028379 Bacteria 2350
112 Ga0268264_10000573 3300028381 Bacteria 44555
113 Ga0268264_10347668 3300028381 Bacteria 1410
114 Ga0307405_10373035 3300031731 Bacteria 1108
115 Ga0307413_10147190 3300031824 Bacteria 1636
116 Ga0307413_10299725 3300031824 Bacteria 1218
117 Ga0307410_10128439 3300031852 Bacteria 1859
118 Ga0307410_10179140 3300031852 Bacteria 1603
119 Ga0307410_10318554 3300031852 Bacteria 1233
120 Ga0307406_10403673 3300031901 Bacteria 1084
121 Ga0307406_10423112 3300031901 Bacteria 1062
122 Ga0307407_10258173 3300031903 Bacteria 1197
123 Ga0307407_10322824 3300031903 Bacteria 1084
124 Ga0307409_100028056 3300031995 Bacteria 4003
125 Ga0307409_100122795 3300031995 Bacteria 2203
126 Ga0307409_100134645 3300031995 Bacteria 2118
127 Ga0307409_100140757 3300031995 Bacteria 2078
128 Ga0307409_100640198 3300031995 Bacteria 1056
129 Ga0307416_100010671 3300032002 Bacteria 6084
130 Ga0307416_100144269 3300032002 Bacteria 2170
131 Ga0307416_100195537 3300032002 Bacteria 1913
132 Ga0307416_100448167 3300032002 Bacteria 1342
133 Ga0307416_100624335 3300032002 Bacteria 1160
134 Ga0307414_10034100 3300032004 Bacteria 3371
135 Ga0307414_10077026 3300032004 Bacteria 2426
136 Ga0307414_10105270 3300032004 Bacteria 2133
137 Ga0307415_100022511 3300032126 Bacteria 3890
138 Ga0307415_100155064 3300032126 Bacteria 1767
139 Ga0307415_100375832 3300032126 Bacteria 1205
140 Ga0372808_009425 3300036459 Bacteria 1364
141 Ga0395900_0172654 3300037418 Bacteria 2200
142 Ga0395898_0016732 3300037466 Bacteria 7494
143 Ga0436364_1193194 3300037853 Bacteria 3036
144 Ga0395901_0083400 3300038443 Bacteria 3341
145 Ga0436365_1353952 3300039437 Bacteria 890
146 Ga0451853_2647144 3300041512 Bacteria 1005
147 Ga0466972_0026561 3300044658 Bacteria 2870
148 Ga0466965_0069475 3300044683 Bacteria 1770
149 Ga0466965_0125796 3300044683 Bacteria 1326
150 Ga0466966_0021385 3300044684 Bacteria 4247
151 Ga0466961_0043065 3300044693 Bacteria 2892
152 Ga0466961_0072293 3300044693 Bacteria 2188
153 Ga0466961_0093494 3300044693 Bacteria 1897
154 Ga0466961_0121045 3300044693 Bacteria 1643
155 Ga0466963_0014397 3300044694 Bacteria 4876
156 Ga0466963_0019220 3300044694 Bacteria 4281
157 Ga0466963_0059908 3300044694 Bacteria 2542
158 Ga0466963_0061568 3300044694 Bacteria 2509
159 Ga0466964_0005171 3300044706 Bacteria 4836
160 Ga0466971_0041645 3300044719 Bacteria 2063
161 Ga0466970_0023718 3300044765 Bacteria 3207
162 Ga0466970_0080837 3300044765 Bacteria 1757
163 Ga0466957_0036250 3300044842 Bacteria 2964
164 Ga0466960_0004046 3300044901 Bacteria 5696
165 Ga0466960_0013369 3300044901 Bacteria 3486
166 Ga0466960_0019879 3300044901 Bacteria 2966
167 Ga0466958_0017566 3300045836 Bacteria 4138
168 Ga0466967_0007432 3300045976 Bacteria 7902
169 Ga0466967_0023099 3300045976 Bacteria 5091
170 Ga0466967_0035079 3300045976 Bacteria 4265
171 Ga0466967_0047925 3300045976 Bacteria 3728
172 Ga0466967_0112926 3300045976 Bacteria 2498
173 Ga0466967_0469495 3300045976 Bacteria 1231
174 Ga0466967_0660119 3300045976 Bacteria 1034
175 Ga0495629_0223656 3300046459 Bacteria 1298
176 Ga0495582_0291101 3300046473 Bacteria 938
177 Ga0495658_0205959 3300046683 Bacteria 1227
178 Ga0496100_0017195 3300048903 Bacteria 4265
179 Ga0496100_0034670 3300048903 Bacteria 3169
180 Ga0496100_0410988 3300048903 Bacteria 1032
181 Ga0496101_0026777 3300048904 Bacteria 4009
182 Ga0496101_0125590 3300048904 Bacteria 1944
183 Ga0496101_0208314 3300048904 Bacteria 1514
184 Ga0496102_0012826 3300048905 Bacteria 7255
185 Ga0496102_0352381 3300048905 Bacteria 1386
186 Ga0496103_0019984 3300048906 Bacteria 4022
187 Ga0496103_0190662 3300048906 Bacteria 1318
188 Ga0496104_0036960 3300048907 Bacteria 4566
189 Ga0496105_0411200 3300048908 Bacteria 1072
190 Ga0496106_0012143 3300048909 Bacteria 6357
191 Ga0496107_0016403 3300048910 Bacteria 5200
192 Ga0496107_0032610 3300048910 Bacteria 3723
193 Ga0496107_0171079 3300048910 Bacteria 1612
194 Ga0496108_0044503 3300048911 Bacteria 3705
195 Ga0496108_0062193 3300048911 Bacteria 3144
196 Ga0496108_0194010 3300048911 Bacteria 1761
197 Ga0496108_0197928 3300048911 Bacteria 1743
198 Ga0496108_0272091 3300048911 Bacteria 1474
199 Ga0496109_0125173 3300048912 Bacteria 2396
200 Ga0496109_0147935 3300048912 Bacteria 2198
201 Ga0496109_0489171 3300048912 Bacteria 1161
202 Ga0496110_0067073 3300048913 Bacteria 3174
203 Ga0496111_0024163 3300048914 Bacteria 4276
204 Ga0496111_0160556 3300048914 Bacteria 1669
205 Ga0496111_0187308 3300048914 Bacteria 1538
206 Ga0496112_0281914 3300048915 Bacteria 1609
207 Ga0496112_0345872 3300048915 Bacteria 1430
208 Ga0496112_0788118 3300048915 Bacteria 876
209 Ga0496113_0209119 3300048916 Bacteria 1553
210 Ga0496113_0445480 3300048916 Bacteria 1040
211 Ga0496114_0009494 3300048917 Bacteria 7721
212 Ga0496114_0021908 3300048917 Bacteria 5202
213 Ga0496114_0027358 3300048917 Bacteria 4670
214 Ga0496114_0084627 3300048917 Bacteria 2685
215 Ga0496114_0406342 3300048917 Bacteria 1206
216 Ga0496114_0473333 3300048917 Bacteria 1108
217 Ga0496115_0017400 3300048918 Bacteria 5495
218 Ga0501031_0021285 3300049568 Bacteria 4227
219 Ga0501031_0253056 3300049568 Bacteria 1145
220 Ga0501032_0050218 3300049569 Bacteria 2813
221 Ga0501034_0004130 3300049571 Bacteria 16266
222 Ga0501034_0005817 3300049571 Bacteria 13410
223 Ga0501034_0020951 3300049571 Bacteria 6674
224 Ga0501034_0632145 3300049571 Bacteria 973
225 Ga0501036_0003358 3300049572 Bacteria 12786
226 Ga0501036_0124205 3300049572 Bacteria 2180
227 Ga0501036_0353127 3300049572 Bacteria 1228
228 Ga0501036_0393766 3300049572 Bacteria 1156
229 Ga0501036_0924422 3300049572 Bacteria 715
230 Ga0501037_0010033 3300049573 Bacteria 6947
231 Ga0501037_0297240 3300049573 Bacteria 1122
232 Ga0501037_0333930 3300049573 Bacteria 1048
233 Ga0501038_0001314 3300049574 Bacteria 22601
234 Ga0501038_0099980 3300049574 Bacteria 2417
235 Ga0501038_0217997 3300049574 Bacteria 1524
236 Ga0501038_0275396 3300049574 Bacteria 1326
237 Ga0501039_0022334 3300049575 Bacteria 4857
238 Ga0501039_0108732 3300049575 Bacteria 2167
239 Ga0501039_0126920 3300049575 Bacteria 2001
240 Ga0501040_0068421 3300049576 Bacteria 2449
241 Ga0501040_0136653 3300049576 Bacteria 1726
242 Ga0501040_0317158 3300049576 Bacteria 1115
243 Ga0501042_0609623 3300049578 Bacteria 794
244 Ga0501043_0007559 3300049579 Bacteria 8617
245 Ga0501043_0023966 3300049579 Bacteria 4788
246 Ga0501047_0009986 3300049581 Bacteria 8972
247 Ga0501047_0198384 3300049581 Bacteria 1868
248 Ga0501048_0011232 3300049582 Bacteria 6677
249 Ga0501048_0482227 3300049582 Bacteria 889
250 Ga0501067_0008496 3300049583 Bacteria 5692
251 Ga0501067_0036352 3300049583 Bacteria 2734
252 Ga0501068_0078453 3300049584 Bacteria 2024
253 Ga0501068_0094330 3300049584 Bacteria 1849
254 Ga0501070_0000874 3300049586 Bacteria 27417
255 Ga0501070_0005692 3300049586 Bacteria 10620
256 Ga0501070_0015038 3300049586 Bacteria 6512
257 Ga0501070_0231878 3300049586 Bacteria 1512
258 Ga0501070_0320930 3300049586 Bacteria 1260
259 Ga0501071_0037989 3300049587 Bacteria 3440
260 Ga0501071_0107961 3300049587 Bacteria 2056
261 Ga0501072_0223546 3300049588 Bacteria 1500
262 Ga0501072_0340610 3300049588 Bacteria 1191
263 Ga0501073_0012867 3300049589 Bacteria 6099
264 Ga0501073_0018799 3300049589 Bacteria 4995
265 Ga0501073_0182814 3300049589 Bacteria 1451
266 Ga0501073_0430536 3300049589 Bacteria 912
267 Ga0501074_0001031 3300049590 Bacteria 18073
268 Ga0501074_0013471 3300049590 Bacteria 5946
269 Ga0501075_0229064 3300049591 Bacteria 1417
270 Ga0501077_0214253 3300049593 Bacteria 1224
271 Ga0501079_0366291 3300049741 Bacteria 1130
272 Ga0501080_0000208 3300049742 Bacteria 43436
273 Ga0501080_0020743 3300049742 Bacteria 6086
274 Ga0501044_0088373 3300049823 Bacteria 3128
275 Ga0501045_0195528 3300049824 Bacteria 1507
276 nmdc:mga00v17_236694_c1 3300050491 Bacteria 1183
277 nmdc:mga0yw44_120064_c1 3300050492 Bacteria 1692
278 nmdc:mga0yw44_151624_c1 3300050492 Bacteria 1512
279 nmdc:mga0yw44_246258_c1 3300050492 Bacteria 1189
280 nmdc:mga08y16_35688_c2 3300050511 Bacteria 3779
281 nmdc:mga0rr50_642520_c1 3300050513 Bacteria 905
282 Ga0495595_0140618 3300053084 Bacteria 1184
283 Ga0500644_0021148 3300053088 Bacteria 1945
284 Ga0500568_0005223 3300053139 Bacteria 6761
285 Ga0500616_0000117 3300053153 Bacteria 145655
286 Ga0501084_0242773 3300054114 Bacteria 1520
287 Ga0501082_0178634 3300060353 Bacteria 1846
288 Ga0501082_0234918 3300060353 Bacteria 1596
289 Ga0501082_0288807 3300060353 Bacteria 1428
290 Ga0501082_0342571 3300060353 Bacteria 1303
291 Ga0466962_0079613 3300061719 Bacteria 1566
292 Ga0530510_0354607 3300061734 Bacteria 1102
293 2643826739 2643221561 Bacteria 4984412
294 2644228236 2643221641 Bacteria 4490190
295 2644534095 2643221696 Bacteria 5431823
296 2738696823 2738541272 Bacteria 6848551
297 2739324565 2738543027 Bacteria 6409078
298 2739606546 2739367654 Bacteria 6049412
299 2740165728 2739367898 Bacteria 4367674
300 2760306661 2758568522 Bacteria 5953541
301 2760624864 2758568621 Bacteria 5967089
302 2809029772 2808606394 Bacteria 6248540
303 2857484491 2857481737 Bacteria 4761446
304 3002999790 3002998708 Bacteria 11715108
305 8053946616 8053945823 Bacteria 8962862
306 8054612221 8054609563 Bacteria 5170090
307 8056582923 8056579771 Bacteria 5840325
308 Ga0501034_0014201
309 Ga0070658_10016015
310 Ga0070683_100030659
311 Ga0070683_100037718
312 Ga0070683_100053014
313 Ga0070683_100057168
314 Ga0070680_100039819
315 Ga0070682_100026302
316 Ga0068868_100167828
317 Ga0070691_10038017
318 Ga0070692_10094042
319 Ga0070674_100007435
320 Ga0070673_100273615
321 Ga0070659_100105406
322 Ga0070700_100003680
323 Ga0070700_100169271
324 Ga0070662_100115212
325 Ga0068867_100008968
326 Ga0070679_100271193
327 Ga0070684_100007685
328 Ga0070684_100134787
329 Ga0070684_100284994
330 Ga0068853_100141462
331 Ga0070686_100015726
332 Ga0070686_100064791
333 Ga0070665_100009735
334 Ga0070665_100083996
335 Ga0070704_100235525
336 Ga0070664_100746791
337 Ga0068857_100043398
338 Ga0068856_100020714
339 Ga0070702_100011338
340 Ga0068852_100138674
341 Ga0068864_100027014
342 Ga0068864_100171541
343 Ga0068861_100328475
344 Ga0068870_10027692
345 Ga0068858_100057230
346 Ga0068860_100000571
347 Ga0068860_100033118
348 Ga0081539_10080603
349 Ga0075365_10053483
350 Ga0075365_10185638
351 Ga0075363_100084234
352 Ga0075364_10065739
353 Ga0070715_10021737
354 Ga0075367_10017547
355 Ga0068865_100046702
356 Ga0068865_100080186
357 Ga0068865_100301249
358 Ga0111539_10085560
359 Ga0105245_10011632
360 Ga0105243_10004475
361 Ga0105241_10195985
362 Ga0105242_10078978
363 Ga0105242_10087270
364 Ga0105248_10214142
365 Ga0105238_10202683
366 Ga0105249_10099783
367 Ga0105246_10011474
368 Ga0105246_10047346
369 Ga0163162_10026819
370 Ga0157372_10010406
371 Ga0157372_10066236
372 Ga0157375_10041383
373 Ga0157375_10059946
374 Ga0157375_10497273
375 Ga0157375_10586516
376 Ga0157380_10007502
377 Ga0182008_10023992
378 Ga0157377_10033337
379 Ga0157377_10196495
380 Ga0157379_10064331
381 Ga0213875_10109100
382 Ga0207688_10008375
383 Ga0207647_10015848
384 Ga0207647_10034594
385 Ga0207685_10143013
386 Ga0207643_10202610
387 Ga0207705_10019541
388 Ga0207654_10223630
389 Ga0207694_10222935
390 Ga0207687_10031509
391 Ga0207690_10018656
392 Ga0207686_10084002
393 Ga0207709_10021021
394 Ga0207709_10140231
395 Ga0207670_10154965
396 Ga0207670_10214583
397 Ga0207669_10017476
398 Ga0207704_10057062
399 Ga0207691_10223434
400 Ga0207691_10436758
401 Ga0207661_10005976
402 Ga0207661_10051131
403 Ga0207661_10846542
404 Ga0207651_10221433
405 Ga0207712_10185917
406 Ga0207712_10206249
407 Ga0207658_10022609
408 Ga0207708_10000448
409 Ga0207702_10089009
410 Ga0207702_10597310
411 Ga0207676_10044723
412 Ga0207674_10017204
413 Ga0207674_10314696
414 Ga0207675_100208165
415 Ga0207698_10528431
416 Ga0207428_10108527
417 Ga0268266_10000596
418 Ga0268266_10118861
419 Ga0268264_10000573
420 Ga0268264_10347668
421 Ga0307405_10373035
422 Ga0307413_10147190
423 Ga0307413_10299725
424 Ga0307410_10128439
425 Ga0307410_10179140
426 Ga0307410_10318554
427 Ga0307406_10403673
428 Ga0307406_10423112
429 Ga0307407_10258173
430 Ga0307407_10322824
431 Ga0307409_100028056
432 Ga0307409_100122795
433 Ga0307409_100134645
434 Ga0307409_100140757
435 Ga0307409_100640198
436 Ga0307416_100010671
437 Ga0307416_100144269
438 Ga0307416_100195537
439 Ga0307416_100448167
440 Ga0307416_100624335
441 Ga0307414_10034100
442 Ga0307414_10077026
443 Ga0307414_10105270
444 Ga0307415_100022511
445 Ga0307415_100155064
446 Ga0307415_100375832
447 Ga0372808_009425
448 Ga0395900_0172654
449 Ga0395898_0016732
450 Ga0436364_1193194
451 Ga0395901_0083400
452 Ga0436365_1353952
453 Ga0451853_2647144
454 Ga0466972_0026561
455 Ga0466965_0069475
456 Ga0466965_0125796
457 Ga0466966_0021385
458 Ga0466961_0043065
459 Ga0466961_0072293
460 Ga0466961_0093494
461 Ga0466961_0121045
462 Ga0466963_0014397
463 Ga0466963_0019220
464 Ga0466963_0059908
465 Ga0466963_0061568
466 Ga0466964_0005171
467 Ga0466971_0041645
468 Ga0466970_0023718
469 Ga0466970_0080837
470 Ga0466957_0036250
471 Ga0466960_0004046
472 Ga0466960_0013369
473 Ga0466960_0019879
474 Ga0466958_0017566
475 Ga0466967_0007432
476 Ga0466967_0023099
477 Ga0466967_0035079
478 Ga0466967_0047925
479 Ga0466967_0112926
480 Ga0466967_0469495
481 Ga0466967_0660119
482 Ga0495629_0223656
483 Ga0495582_0291101
484 Ga0495658_0205959
485 Ga0496100_0017195
486 Ga0496100_0034670
487 Ga0496100_0410988
488 Ga0496101_0026777
489 Ga0496101_0125590
490 Ga0496101_0208314
491 Ga0496102_0012826
492 Ga0496102_0352381
493 Ga0496103_0019984
494 Ga0496103_0190662
495 Ga0496104_0036960
496 Ga0496105_0411200
497 Ga0496106_0012143
498 Ga0496107_0016403
499 Ga0496107_0032610
500 Ga0496107_0171079
501 Ga0496108_0044503
502 Ga0496108_0062193
503 Ga0496108_0194010
504 Ga0496108_0197928
505 Ga0496108_0272091
506 Ga0496109_0125173
507 Ga0496109_0147935
508 Ga0496109_0489171
509 Ga0496110_0067073
510 Ga0496111_0024163
511 Ga0496111_0160556
512 Ga0496111_0187308
513 Ga0496112_0281914
514 Ga0496112_0345872
515 Ga0496112_0788118
516 Ga0496113_0209119
517 Ga0496113_0445480
518 Ga0496114_0009494
519 Ga0496114_0021908
520 Ga0496114_0027358
521 Ga0496114_0084627
522 Ga0496114_0406342
523 Ga0496114_0473333
524 Ga0496115_0017400
525 Ga0501031_0021285
526 Ga0501031_0253056
527 Ga0501032_0050218
528 Ga0501034_0004130
529 Ga0501034_0005817
530 Ga0501034_0020951
531 Ga0501034_0632145
532 Ga0501036_0003358
533 Ga0501036_0124205
534 Ga0501036_0353127
535 Ga0501036_0393766
536 Ga0501036_0924422
537 Ga0501037_0010033
538 Ga0501037_0297240
539 Ga0501037_0333930
540 Ga0501038_0001314
541 Ga0501038_0099980
542 Ga0501038_0217997
543 Ga0501038_0275396
544 Ga0501039_0022334
545 Ga0501039_0108732
546 Ga0501039_0126920
547 Ga0501040_0068421
548 Ga0501040_0136653
549 Ga0501040_0317158
550 Ga0501042_0609623
551 Ga0501043_0007559
552 Ga0501043_0023966
553 Ga0501047_0009986
554 Ga0501047_0198384
555 Ga0501048_0011232
556 Ga0501048_0482227
557 Ga0501067_0008496
558 Ga0501067_0036352
559 Ga0501068_0078453
560 Ga0501068_0094330
561 Ga0501070_0000874
562 Ga0501070_0005692
563 Ga0501070_0015038
564 Ga0501070_0231878
565 Ga0501070_0320930
566 Ga0501071_0037989
567 Ga0501071_0107961
568 Ga0501072_0223546
569 Ga0501072_0340610
570 Ga0501073_0012867
571 Ga0501073_0018799
572 Ga0501073_0182814
573 Ga0501073_0430536
574 Ga0501074_0001031
575 Ga0501074_0013471
576 Ga0501075_0229064
577 Ga0501077_0214253
578 Ga0501079_0366291
579 Ga0501080_0000208
580 Ga0501080_0020743
581 Ga0501044_0088373
582 Ga0501045_0195528
583 nmdc:mga00v17_236694_c1
584 nmdc:mga0yw44_120064_c1
585 nmdc:mga0yw44_151624_c1
586 nmdc:mga0yw44_246258_c1
587 nmdc:mga08y16_35688_c2
588 nmdc:mga0rr50_642520_c1
589 Ga0495595_0140618
590 Ga0500644_0021148
591 Ga0500568_0005223
592 Ga0500616_0000117
593 Ga0501084_0242773
594 Ga0501082_0178634
595 Ga0501082_0234918
596 Ga0501082_0288807
597 Ga0501082_0342571
598 Ga0466962_0079613
599 Ga0530510_0354607
600 2643826739
601 2644228236
602 2644534095
603 2738696823
604 2739324565
605 2739606546
606 2740165728
607 2760306661
608 2760624864
609 2809029772
610 2857484491
611 3002999790
612 8053946616
613 8054612221
614 8056582923

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09339

HTH_IclR

IclR helix-turn-helix domain

52

103

0.94

PF01614

IclR

Bacterial transcriptional regulator

121

295

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2heo-assembly1.cif.gz_D general structure-based approach to the design of protein ligands: application to the design of kv1.2 potassium channel blockers. 0.9333 6 62
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9317 7 62
2lnb-assembly1.cif.gz_A solution nmr structure of n-terminal domain (6-74) of human zbp1 protein, northeast structural genomics consortium target hr8174a. 0.9289 3 62
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9212 4 61
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9162 7 61
ID Description Score Start End Superfamily
af_P77569_1_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.953 1 61 1.10.10.10
af_A0A1D6NJX1_369_456_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9485 6 51 1.10.10.10
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9482 4 62 1.10.10.10
af_O06806_1_76_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9469 2 62 1.10.10.10
af_Q5QM91_354_443_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9453 6 51 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D6BJA3-F1-model_v4 IclR-ED domain-containing protein 0.9316 74 241 GO:0003677
GO:0003700
GO:0045892
AF-A0A2V9QTZ5-F1-model_v4 IclR-ED domain-containing protein 0.9294 78 241 GO:0003677
GO:0003700
GO:0045892
AF-A0A6C7Z857-F1-model_v4 deleted 0.9228 78 223
AF-A0A6G3VGA1-F1-model_v4 deleted 0.9095 61 244
AF-X1T2F9-F1-model_v4 IclR-ED domain-containing protein 0.8983 86 248 GO:0003677
GO:0003700
GO:0045892

Map