F399362

General Info

Members Datasets Scaffolds Average Seq Length
307 258 194 206

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0536038|Ga0496104_0536038_318_995
Length 225
Sequence LIRQSRLGILRKKGRHIMKALLLIDIQNGFCPGGNLAVADGDAVVPIANALIDNGGYDLIVASQDWHPENHGSFASQHPGKQPFDMGELSGKPQMMWPDHCVQGTPDAEFHPDLNMEAFDYIQQKGENPAIDSYSAFRDNDQVATTGLSDYLARQGVTQLDVCGLATDYCVSFSVQDALDMLPGVKVRFIEDASRGIDPQGIKAAVAAMREKGAVILKSRDILRN

Samples

Sample ID Description Type Environment
1 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
2 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
3 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
4 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
5 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
6 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
7 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
8 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
9 2519899620 Rhizobium sp. Pop5 Isolate Nodule
10 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
11 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
12 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
13 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
14 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
15 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
16 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
17 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
18 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
19 2643221568 Rhizobium sp. Root564 Isolate Unclassified
20 2643221582 Rhizobium sp. Root651 Isolate Unclassified
21 2643221693 Rhizobium sp. Root491 Isolate Unclassified
22 2718217882 Rhizobium sp. N741 Isolate Nodule
23 2718217927 Rhizobium sp. N324 Isolate Nodule
24 2718218009 Rhizobium sp. N561 Isolate Nodule
25 2718218363 Rhizobium sp. N113 Isolate Nodule
26 2718218366 Rhizobium sp. N621 Isolate Nodule
27 2718218423 Rhizobium sp. N941 Isolate Nodule
28 2721755514 Rhizobium sp. N6212 Isolate Nodule
29 2721755809 Rhizobium sp. N541 Isolate Nodule
30 2721755810 Rhizobium sp. N871 Isolate Nodule
31 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
32 2728369365 Rhizobium sp. N1341 Isolate Nodule
33 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
34 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
35 2791355256 Rhizobium sp. M10 Isolate Nodule
36 2791355261 Rhizobium sp. J15 Isolate Nodule
37 2791355262 Rhizobium sp. M1 Isolate Nodule
38 2791355265 Rhizobium sp. H4 Isolate Nodule
39 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
40 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
41 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
42 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
43 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
44 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
45 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
46 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
47 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
48 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
49 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
50 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
51 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
52 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
53 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
54 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
55 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
56 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
57 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
58 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
59 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
60 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
61 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
62 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
63 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
64 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
65 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
66 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
67 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
68 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
69 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
70 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
71 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
72 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
73 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
74 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
75 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
76 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
77 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
78 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
79 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
80 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
81 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
82 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
83 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
84 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
85 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
86 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
87 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
88 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
89 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
90 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
91 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
92 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
93 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
94 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
95 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
96 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
97 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
98 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
99 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
100 2996893221 Rhizobium sp. R635 Isolate Nodule
101 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
102 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
103 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
104 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
105 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
106 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
107 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
108 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
109 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
110 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
111 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
112 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
113 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
114 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
115 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
116 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
117 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
118 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
121 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
122 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
127 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
222 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
230 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
238 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
239 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
246 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
247 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
248 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
249 8005275841 Rhizobium sp. N4311 Isolate Nodule
250 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
251 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
252 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
253 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
254 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
255 8018176218 Rhizobium sp. N122 Isolate Nodule
256 8024501048 Rhizobium sp. H4 Isolate Nodule
257 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
258 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.19
Metatranscriptomes 0
Isolates 36.81

Biome Distribution

Category Percentage (%)
Aerial Root 1.63
Bulb 0
Endosphere 27.69
Nodule 23.78
Rhizoplane 2.61
Rhizosphere 28.01
Stem 0
Stem Tuber 0
Unclassified 16.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004084 3300002067 Bacteria 4926
2 JGI25158J39367_1000301 3300002739 Bacteria 11181
3 JGI25152J39213_1000926 3300002773 Bacteria 14391
4 JGI25152J39213_1002989 3300002773 Bacteria 5996
5 JGI25159J45721_1004264 3300002987 Bacteria 4805
6 JGI25151J46595_10016817 3300003187 Bacteria 3191
7 JGI25151J46595_10034363 3300003187 Bacteria 1940
8 JGI25153J46596_10002269 3300003215 Bacteria 11210
9 JGI25161J50226_1000174 3300003374 Bacteria 43080
10 Ga0055526_1000975 3300003771 Bacteria 21080
11 Ga0055524_1009433 3300003775 Bacteria 3968
12 Ga0055524_1010017 3300003775 Bacteria 3808
13 Ga0055528_1000499 3300003790 Bacteria 30914
14 Ga0055528_1002999 3300003790 Bacteria 8727
15 Ga0055540_1006287 3300003792 Bacteria 4752
16 Ga0058692_1004552 3300003856 Bacteria 4092
17 Ga0055543_1000350 3300004625 Bacteria 31311
18 Ga0065165_1018116 3300005262 Bacteria 2564
19 Ga0070658_10359727 3300005327 Bacteria 1246
20 Ga0070690_100005779 3300005330 Bacteria 6969
21 Ga0070682_100313815 3300005337 Bacteria 1155
22 Ga0070689_100066129 3300005340 Bacteria 2816
23 Ga0070669_100105689 3300005353 Bacteria 2130
24 Ga0070705_100346677 3300005440 Bacteria 1081
25 Ga0070678_100805642 3300005456 Bacteria 853
26 Ga0070665_100161078 3300005548 Bacteria 2246
27 Ga0070665_100359341 3300005548 Bacteria 1462
28 Ga0068859_101011227 3300005617 Bacteria 913
29 Ga0068863_100007391 3300005841 Bacteria 10754
30 Ga0068860_100150053 3300005843 Bacteria 2244
31 Ga0070717_10101937 3300006028 Bacteria 2438
32 Ga0075368_10018283 3300006042 Bacteria 2633
33 Ga0075368_10070261 3300006042 Bacteria 1413
34 Ga0075363_100093732 3300006048 Bacteria 1655
35 Ga0075364_10000852 3300006051 Bacteria 16069
36 Ga0075364_10313746 3300006051 Bacteria 1068
37 Ga0075362_10000688 3300006177 Bacteria 9992
38 Ga0075367_10178077 3300006178 Bacteria 1325
39 Ga0075369_10153785 3300006186 Bacteria 1052
40 Ga0075366_10151831 3300006195 Bacteria 1403
41 Ga0075370_10033247 3300006353 Bacteria 2887
42 Ga0075370_10080026 3300006353 Bacteria 1877
43 Ga0097620_101011287 3300006931 Bacteria 913
44 Ga0099826_10000198 3300006948 Bacteria 25811
45 Ga0099826_10008381 3300006948 Bacteria 7689
46 Ga0105244_10103644 3300009036 Bacteria 1389
47 Ga0105245_10849925 3300009098 Bacteria 952
48 Ga0105243_10039841 3300009148 Bacteria 3666
49 Ga0105243_10040412 3300009148 Bacteria 3643
50 Ga0105243_10869898 3300009148 Bacteria 894
51 Ga0105249_10278344 3300009553 Bacteria 1670
52 Ga0157373_10002528 3300013100 Bacteria 13921
53 Ga0157371_10000017 3300013102 Bacteria 320830
54 Ga0157370_10009441 3300013104 Bacteria 10420
55 Ga0157378_10469427 3300013297 Bacteria 1252
56 Ga0163163_10650378 3300014325 Bacteria 1118
57 Ga0209436_100192 3300025208 Bacteria 28415
58 Ga0207425_1031523 3300025245 Bacteria 1055
59 Ga0209129_1000488 3300025258 Bacteria 28880
60 Ga0209129_1001024 3300025258 Bacteria 16664
61 Ga0209673_1000010 3300025273 Bacteria 596656
62 Ga0209673_1002830 3300025273 Bacteria 11164
63 Ga0209130_1000020 3300025284 Bacteria 379297
64 Ga0209025_1001339 3300025294 Bacteria 33228
65 Ga0209025_1001781 3300025294 Bacteria 25621
66 Ga0209564_1000647 3300025295 Bacteria 52658
67 Ga0209564_1004385 3300025295 Bacteria 8659
68 Ga0209758_1000989 3300025297 Bacteria 38114
69 Ga0209256_1002011 3300025299 Bacteria 18152
70 Ga0209256_1005120 3300025299 Bacteria 7766
71 Ga0207426_1000008 3300025302 Bacteria 848730
72 Ga0209051_1002860 3300025303 Bacteria 11873
73 Ga0209051_1078037 3300025303 Bacteria 967
74 Ga0209257_1039069 3300025304 Bacteria 1430
75 Ga0207642_10378352 3300025899 Bacteria 842
76 Ga0207662_10317301 3300025918 Bacteria 1040
77 Ga0207709_10040101 3300025935 Bacteria 2801
78 Ga0207670_10254652 3300025936 Bacteria 1358
79 Ga0207712_10224412 3300025961 Bacteria 1504
80 Ga0207668_10239137 3300025972 Bacteria 1468
81 Ga0207641_10006402 3300026088 Bacteria 9926
82 Ga0209371_1000022 3300027312 Bacteria 536342
83 Ga0209371_1001750 3300027312 Bacteria 13683
84 Ga0209282_1000315 3300027666 Bacteria 24042
85 Ga0268266_10242546 3300028379 Bacteria 1664
86 Ga0307517_10042650 3300028786 Bacteria 4858
87 Ga0307515_10008524 3300028794 Bacteria 19966
88 Ga0268256_1000019 3300030500 Bacteria 587949
89 Ga0268256_1009527 3300030500 Bacteria 3212
90 Ga0316181_1062527 3300030744 Bacteria 3029
91 Ga0316181_1288063 3300030744 Bacteria 1895
92 Ga0307513_10019929 3300031456 Bacteria 7968
93 Ga0307513_10031493 3300031456 Bacteria 6004
94 Ga0307509_10024611 3300031507 Bacteria 6739
95 Ga0307509_10090948 3300031507 Bacteria 3125
96 Ga0307508_10178873 3300031616 Bacteria 1724
97 Ga0307516_10141117 3300031730 Bacteria 2179
98 Ga0307516_10166092 3300031730 Bacteria 1952
99 Ga0373936_0000020 3300035113 Bacteria 142589
100 Ga0373961_0000088 3300035241 Bacteria 49704
101 Ga0436360_0909394 3300039438 Bacteria 2696
102 Ga0439465_0007892 3300041413 Bacteria 3372
103 Ga0451791_0858608 3300041451 Bacteria 888
104 Ga0451837_1787381 3300041494 Bacteria 1060
105 Ga0451841_0809707 3300041498 Bacteria 715
106 Ga0450905_012478 3300042142 Bacteria 1197
107 Ga0495638_0251422 3300046460 Bacteria 974
108 Ga0495638_0338470 3300046460 Bacteria 798
109 Ga0495632_0185770 3300046519 Bacteria 951
110 Ga0495643_0103043 3300046522 Bacteria 1460
111 Ga0495648_0147721 3300046524 Bacteria 1229
112 Ga0495633_0021520 3300046558 Bacteria 3224
113 Ga0495633_0024915 3300046558 Bacteria 2951
114 Ga0495633_0032102 3300046558 Bacteria 2539
115 Ga0495611_0205146 3300046648 Bacteria 919
116 Ga0495588_0002339 3300046674 Bacteria 8130
117 Ga0495681_0006228 3300047470 Bacteria 7866
118 Ga0495686_0005292 3300047472 Bacteria 10229
119 Ga0495686_0333091 3300047472 Bacteria 829
120 Ga0496104_0536038 3300048907 Bacteria 1081
121 Ga0496107_0556763 3300048910 Bacteria 849
122 Ga0496113_0121465 3300048916 Bacteria 2043
123 Ga0496116_0118611 3300048919 Bacteria 1537
124 Ga0496116_0129083 3300048919 Bacteria 1445
125 Ga0496117_0000002 3300048920 Bacteria 2483758
126 Ga0496117_0002202 3300048920 Bacteria 25303
127 Ga0496118_0000087 3300048921 Bacteria 176693
128 Ga0496118_0001387 3300048921 Bacteria 36508
129 Ga0496118_0026814 3300048921 Bacteria 4896
130 Ga0496119_0015225 3300048922 Bacteria 5946
131 Ga0496119_0017836 3300048922 Bacteria 5321
132 Ga0496120_0000180 3300048923 Bacteria 107518
133 Ga0496121_0166359 3300048924 Bacteria 1607
134 Ga0496121_0295947 3300048924 Bacteria 1100
135 Ga0496122_0000004 3300048925 Bacteria 645283
136 Ga0496122_0080079 3300048925 Bacteria 2279
137 Ga0496123_0000007 3300048926 Bacteria 645283
138 Ga0496124_0006158 3300048927 Bacteria 13150
139 Ga0496124_0170122 3300048927 Bacteria 1689
140 Ga0496124_0253043 3300048927 Bacteria 1301
141 Ga0496125_0006980 3300048928 Bacteria 12086
142 Ga0496125_0050144 3300048928 Bacteria 3459
143 Ga0496125_0098287 3300048928 Bacteria 2166
144 Ga0495682_0050137 3300049460 Bacteria 1520
145 Ga0501034_0004927 3300049571 Bacteria 14705
146 Ga0501034_0084434 3300049571 Bacteria 3177
147 Ga0501037_0180452 3300049573 Bacteria 1498
148 Ga0501043_0205701 3300049579 Bacteria 1526
149 Ga0501046_0231606 3300049580 Bacteria 1365
150 Ga0501047_0090939 3300049581 Bacteria 2929
151 Ga0501073_0334125 3300049589 Bacteria 1046
152 Ga0501035_0193546 3300049822 Bacteria 1747
153 Ga0501044_0016929 3300049823 Bacteria 7821
154 nmdc:mga03683_58404_c1 3300050489 Bacteria 1626
155 nmdc:mga03n38_37750_c1 3300050490 Bacteria 2086
156 nmdc:mga00v17_121852_c1 3300050491 Bacteria 1661
157 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
158 nmdc:mga00v17_234_c2 3300050491 Bacteria 15863
159 nmdc:mga0yw44_37031_c1 3300050492 Bacteria 2879
160 nmdc:mga0k408_20752_c1 3300050493 Bacteria 3686
161 nmdc:mga06z11_167209_c1 3300050494 Bacteria 1261
162 nmdc:mga04h51_97369_c1 3300050495 Bacteria 1067
163 nmdc:mga07m45_82533_c1 3300050496 Bacteria 1836
164 nmdc:mga0n895_615806_c1 3300050512 Bacteria 1087
165 nmdc:mga0sz30_1253_c1 3300050516 Bacteria 9080
166 Ga0500646_0071669 3300053090 Bacteria 1040
167 Ga0500647_0067199 3300053091 Unclassified 1724
168 Ga0500647_0140590 3300053091 Bacteria 1133
169 Ga0500583_0062023 3300053092 Bacteria 1767
170 Ga0500566_0008102 3300053094 Bacteria 6218
171 Ga0500566_0053468 3300053094 Bacteria 2305
172 Ga0500640_000092 3300053095 Bacteria 15475
173 Ga0500560_000390 3300053107 Bacteria 5892
174 Ga0500560_047134 3300053107 Bacteria 1372
175 Ga0500572_001339 3300053111 Bacteria 6832
176 Ga0500572_008418 3300053111 Bacteria 2410
177 Ga0500594_0014104 3300053118 Bacteria 1910
178 Ga0500595_000048 3300053119 Bacteria 88786
179 Ga0500597_012755 3300053120 Bacteria 3095
180 Ga0500642_0059397 3300053130 Bacteria 1712
181 Ga0500559_0039579 3300053136 Unclassified 2051
182 Ga0500561_0000078 3300053137 Bacteria 18897
183 Ga0500603_002739 3300053150 Bacteria 3832
184 Ga0500619_098630 3300053154 Unclassified 990
185 Ga0500622_0001213 3300053156 Bacteria 21213
186 Ga0500622_0136300 3300053156 Bacteria 1175
187 Ga0500622_0211835 3300053156 Unclassified 874
188 Ga0500624_000176 3300053157 Bacteria 25371
189 Ga0500634_0002928 3300053161 Bacteria 7424
190 Ga0500634_0072096 3300053161 Bacteria 1804
191 Ga0500636_0001850 3300053177 Bacteria 11573
192 Ga0500636_0195542 3300053177 Bacteria 1074
193 Ga0500637_0058115 3300053178 Bacteria 2212
194 Ga0500601_002016 3300053737 Unclassified 2179

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0071669 Ga0500646_0071669_67_585 171
2 3300041498 Ga0451841_0809707 Ga0451841_0809707_20_586 183
3 3300003775 Ga0055524_1010017 Ga0055524_10100172 187
4 3300003790 Ga0055528_1000499 Ga0055528_100049923 187
5 3300025273 Ga0209673_1000010 Ga0209673_1000010180 187
6 3300025295 Ga0209564_1004385 Ga0209564_10043858 187
7 3300025299 Ga0209256_1002011 Ga0209256_100201115 187
8 3300005617 Ga0068859_101011227 Ga0068859_1010112271 188
9 3300006931 Ga0097620_101011287 Ga0097620_1010112871 188
10 iso_pu_bacteria 2643221568 2643856807 191
11 iso_pu_bacteria 2895511927 2895513074 196
12 iso_pu_bacteria 2895522137 2895523086 196
13 iso_pu_bacteria 2895525241 2895526989 196
14 iso_pu_bacteria 2895498888 2895503035 197
15 3300030744 Ga0316181_1062527 Ga0316181_10625272 199
16 3300041494 Ga0451837_1787381 Ga0451837_1787381_240_866 199
17 3300048920 Ga0496117_0002202 Ga0496117_0002202_7179_7805 199
18 3300048921 Ga0496118_0001387 Ga0496118_0001387_18463_19089 199
19 3300048927 Ga0496124_0006158 Ga0496124_0006158_7002_7628 199
20 3300048928 Ga0496125_0098287 Ga0496125_0098287_235_861 199
21 3300053156 Ga0500622_0136300 Ga0500622_0136300_71_697 199
22 iso_pu_bacteria 2510461076 2510895337 199
23 iso_pu_bacteria 2513237084 2513568010 199
24 iso_pu_bacteria 2513237103 2513708084 199
25 iso_pu_bacteria 2515075009 2515112962 199
26 iso_pu_bacteria 2515154114 2515640926 199
27 iso_pu_bacteria 2515154116 2515655391 199
28 iso_pu_bacteria 2516653077 2517036667 199
29 iso_pu_bacteria 2517287029 2517407365 199
30 iso_pu_bacteria 2519899620 2520377225 199
31 iso_pu_bacteria 2529292951 2530645994 199
32 iso_pu_bacteria 2537561587 2537875594 199
33 iso_pu_bacteria 2554235003 2554248196 199
34 iso_pu_bacteria 2558860242 2559295312 199
35 iso_pu_bacteria 2599185210 2599601625 199
36 iso_pu_bacteria 2600255279 2601610115 199
37 iso_pu_bacteria 2600255308 2601746889 199
38 iso_pu_bacteria 2643221582 2643920380 199
39 iso_pu_bacteria 2643221693 2644521994 199
40 iso_pu_bacteria 2718217882 2719181772 199
41 iso_pu_bacteria 2718217927 2719386376 199
42 iso_pu_bacteria 2718218009 2719732436 199
43 iso_pu_bacteria 2718218363 2721147863 199
44 iso_pu_bacteria 2718218366 2721164699 199
45 iso_pu_bacteria 2718218423 2721400080 199
46 iso_pu_bacteria 2721755514 2722840869 199
47 iso_pu_bacteria 2721755809 2724038893 199
48 iso_pu_bacteria 2721755810 2724045192 199
49 iso_pu_bacteria 2724679232 2725952596 199
50 iso_pu_bacteria 2728369365 2730165007 199
51 iso_pu_bacteria 2765235942 2766065833 199
52 iso_pu_bacteria 2791355256 2793294472 199
53 iso_pu_bacteria 2791355261 2793329577 199
54 iso_pu_bacteria 2791355262 2793334455 199
55 iso_pu_bacteria 2791355265 2793351868 199
56 iso_pu_bacteria 2802429605 2805928838 199
57 iso_pu_bacteria 2802429606 2805935119 199
58 iso_pu_bacteria 2808606387 2808987954 199
59 iso_pu_bacteria 2818991439 2819559026 199
60 iso_pu_bacteria 2838022645 2838028956 199
61 iso_pu_bacteria 2838042994 2838043933 199
62 iso_pu_bacteria 2838668709 2838670325 199
63 iso_pu_bacteria 2838675328 2838675812 199
64 iso_pu_bacteria 2838701080 2838702696 199
65 iso_pu_bacteria 2838714209 2838714694 199
66 iso_pu_bacteria 2838719591 2838721505 199
67 iso_pu_bacteria 2838724970 2838725454 199
68 iso_pu_bacteria 2841846520 2841848457 199
69 iso_pu_bacteria 2841859092 2841862088 199
70 iso_pu_bacteria 2842110456 2842114948 199
71 iso_pu_bacteria 2842124991 2842125512 199
72 iso_pu_bacteria 2842130223 2842130707 199
73 iso_pu_bacteria 2842146304 2842148046 199
74 iso_pu_bacteria 2842152218 2842154123 199
75 iso_pu_bacteria 2842170452 2842170938 199
76 iso_pu_bacteria 2842175837 2842177743 199
77 iso_pu_bacteria 2842187318 2842187803 199
78 iso_pu_bacteria 2842192696 2842197321 199
79 iso_pu_bacteria 2842198810 2842205070 199
80 iso_pu_bacteria 2842211629 2842212114 199
81 iso_pu_bacteria 2842217011 2842217899 199
82 iso_pu_bacteria 2842224351 2842226267 199
83 iso_pu_bacteria 2842250916 2842253112 199
84 iso_pu_bacteria 2842317721 2842320673 199
85 iso_pu_bacteria 2842489311 2842491942 199
86 iso_pu_bacteria 2842495871 2842496863 199
87 iso_pu_bacteria 2842515876 2842518872 199
88 iso_pu_bacteria 2857516855 2857517471 199
89 iso_pu_bacteria 2891048133 2891050432 199
90 iso_pu_bacteria 2899792073 2899796088 199
91 iso_pu_bacteria 2899845264 2899850668 199
92 iso_pu_bacteria 2919114240 2919114732 199
93 iso_pu_bacteria 2926754445 2926755748 199
94 iso_pu_bacteria 2926760298 2926762864 199
95 iso_pu_bacteria 2933006813 2933008768 199
96 iso_pu_bacteria 2933011516 2933014954 199
97 iso_pu_bacteria 2933586486 2933591320 199
98 iso_pu_bacteria 2933594066 2933596632 199
99 iso_pu_bacteria 2936367885 2936372081 199
100 iso_pu_bacteria 2936375103 2936379945 199
101 iso_pu_bacteria 2979089926 2979094643 199
102 iso_pu_bacteria 2979095461 2979100792 199
103 iso_pu_bacteria 2979100975 2979103878 199
104 iso_pu_bacteria 2984509177 2984511554 199
105 iso_pu_bacteria 2984518228 2984522085 199
106 iso_pu_bacteria 2984537506 2984541383 199
107 iso_pu_bacteria 2984587000 2984589902 199
108 iso_pu_bacteria 2984601300 2984603660 199
109 iso_pu_bacteria 2995392953 2995396898 199
110 iso_pu_bacteria 2996893221 2996894367 199
111 iso_pu_bacteria 650716007 650740521 199
112 iso_pu_bacteria 8003570095 8003571588 199
113 iso_pu_bacteria 8005275841 8005281173 199
114 iso_pu_bacteria 8005301065 8005303085 199
115 iso_pu_bacteria 8005376324 8005380888 199
116 iso_pu_bacteria 8005460587 8005463641 199
117 iso_pu_bacteria 8005563573 8005567953 199
118 iso_pu_bacteria 8005688590 8005692146 199
119 iso_pu_bacteria 8018176218 8018181362 199
120 iso_pu_bacteria 8024501048 8024504382 199
121 iso_pu_bacteria 8054460903 8054462940 199
122 iso_pu_bacteria 8057874678 8057877715 199
123 3300041451 Ga0451791_0858608 Ga0451791_0858608_89_718 200
124 iso_pu_bacteria 2558860983 2561468412 200
125 iso_pu_bacteria 2738541317 2738947377 200
126 iso_pu_bacteria 2913308742 2913312526 200
127 iso_pu_bacteria 639633055 639649154 200
128 3300006051 Ga0075364_10000852 Ga0075364_100008527 201
129 3300042142 Ga0450905_012478 Ga0450905_012478_409_1053 201
130 3300050491 nmdc:mga00v17_234_c2 nmdc:mga00v17_234_c2_10760_11404 201
131 3300002739 JGI25158J39367_1000301 JGI25158J39367_10003015 203
132 3300002773 JGI25152J39213_1000926 JGI25152J39213_100092612 203
133 3300002773 JGI25152J39213_1002989 JGI25152J39213_10029895 203
134 3300002987 JGI25159J45721_1004264 JGI25159J45721_10042641 203
135 3300003187 JGI25151J46595_10016817 JGI25151J46595_100168173 203
136 3300003187 JGI25151J46595_10034363 JGI25151J46595_100343631 203
137 3300003215 JGI25153J46596_10002269 JGI25153J46596_1000226911 203
138 3300003374 JGI25161J50226_1000174 JGI25161J50226_10001745 203
139 3300003771 Ga0055526_1000975 Ga0055526_100097515 203
140 3300003775 Ga0055524_1009433 Ga0055524_10094333 203
141 3300003790 Ga0055528_1002999 Ga0055528_10029995 203
142 3300003792 Ga0055540_1006287 Ga0055540_10062875 203
143 3300003856 Ga0058692_1004552 Ga0058692_10045524 203
144 3300004625 Ga0055543_1000350 Ga0055543_100035028 203
145 3300005262 Ga0065165_1018116 Ga0065165_10181164 203
146 3300005327 Ga0070658_10359727 Ga0070658_103597272 203
147 3300005337 Ga0070682_100313815 Ga0070682_1003138152 203
148 3300005353 Ga0070669_100105689 Ga0070669_1001056893 203
149 3300005456 Ga0070678_100805642 Ga0070678_1008056421 203
150 3300005548 Ga0070665_100161078 Ga0070665_1001610781 203
151 3300005548 Ga0070665_100359341 Ga0070665_1003593412 203
152 3300006042 Ga0075368_10018283 Ga0075368_100182833 203
153 3300006042 Ga0075368_10070261 Ga0075368_100702612 203
154 3300006048 Ga0075363_100093732 Ga0075363_1000937322 203
155 3300006051 Ga0075364_10313746 Ga0075364_103137461 203
156 3300006177 Ga0075362_10000688 Ga0075362_1000068810 203
157 3300006178 Ga0075367_10178077 Ga0075367_101780771 203
158 3300006186 Ga0075369_10153785 Ga0075369_101537851 203
159 3300006195 Ga0075366_10151831 Ga0075366_101518312 203
160 3300006353 Ga0075370_10033247 Ga0075370_100332473 203
161 3300006353 Ga0075370_10080026 Ga0075370_100800262 203
162 3300006948 Ga0099826_10000198 Ga0099826_1000019819 203
163 3300006948 Ga0099826_10008381 Ga0099826_100083812 203
164 3300009036 Ga0105244_10103644 Ga0105244_101036442 203
165 3300009148 Ga0105243_10040412 Ga0105243_100404122 203
166 3300009148 Ga0105243_10869898 Ga0105243_108698982 203
167 3300013100 Ga0157373_10002528 Ga0157373_1000252812 203
168 3300013102 Ga0157371_10000017 Ga0157371_1000001720 203
169 3300013104 Ga0157370_10009441 Ga0157370_1000944112 203
170 3300025208 Ga0209436_100192 Ga0209436_10019223 203
171 3300025245 Ga0207425_1031523 Ga0207425_10315232 203
172 3300025258 Ga0209129_1000488 Ga0209129_100048823 203
173 3300025258 Ga0209129_1001024 Ga0209129_10010247 203
174 3300025273 Ga0209673_1002830 Ga0209673_10028309 203
175 3300025284 Ga0209130_1000020 Ga0209130_1000020285 203
176 3300025294 Ga0209025_1001339 Ga0209025_100133915 203
177 3300025294 Ga0209025_1001781 Ga0209025_10017816 203
178 3300025295 Ga0209564_1000647 Ga0209564_100064746 203
179 3300025297 Ga0209758_1000989 Ga0209758_100098922 203
180 3300025299 Ga0209256_1005120 Ga0209256_10051208 203
181 3300025302 Ga0207426_1000008 Ga0207426_1000008353 203
182 3300025303 Ga0209051_1002860 Ga0209051_100286012 203
183 3300025303 Ga0209051_1078037 Ga0209051_10780372 203
184 3300025304 Ga0209257_1039069 Ga0209257_10390691 203
185 3300025972 Ga0207668_10239137 Ga0207668_102391373 203
186 3300027312 Ga0209371_1000022 Ga0209371_100002250 203
187 3300027312 Ga0209371_1001750 Ga0209371_10017507 203
188 3300027666 Ga0209282_1000315 Ga0209282_100031510 203
189 3300028379 Ga0268266_10242546 Ga0268266_102425461 203
190 3300028794 Ga0307515_10008524 Ga0307515_1000852414 203
191 3300030500 Ga0268256_1000019 Ga0268256_1000019470 203
192 3300030500 Ga0268256_1009527 Ga0268256_10095275 203
193 3300030744 Ga0316181_1288063 Ga0316181_12880632 203
194 3300031456 Ga0307513_10019929 Ga0307513_100199297 203
195 3300041413 Ga0439465_0007892 Ga0439465_0007892_786_1409 203
196 3300046460 Ga0495638_0251422 Ga0495638_0251422_91_717 203
197 3300046519 Ga0495632_0185770 Ga0495632_0185770_177_803 203
198 3300046522 Ga0495643_0103043 Ga0495643_0103043_788_1414 203
199 3300046524 Ga0495648_0147721 Ga0495648_0147721_313_939 203
200 3300046558 Ga0495633_0021520 Ga0495633_0021520_1407_2033 203
201 3300046558 Ga0495633_0024915 Ga0495633_0024915_2246_2872 203
202 3300046558 Ga0495633_0032102 Ga0495633_0032102_774_1400 203
203 3300046648 Ga0495611_0205146 Ga0495611_0205146_262_888 203
204 3300046674 Ga0495588_0002339 Ga0495588_0002339_1810_2436 203
205 3300047470 Ga0495681_0006228 Ga0495681_0006228_4876_5502 203
206 3300047472 Ga0495686_0005292 Ga0495686_0005292_8661_9290 203
207 3300047472 Ga0495686_0333091 Ga0495686_0333091_131_757 203
208 3300048910 Ga0496107_0556763 Ga0496107_0556763_53_679 203
209 3300048916 Ga0496113_0121465 Ga0496113_0121465_1003_1629 203
210 3300048919 Ga0496116_0129083 Ga0496116_0129083_199_825 203
211 3300048920 Ga0496117_0000002 Ga0496117_0000002_508702_509328 203
212 3300048921 Ga0496118_0000087 Ga0496118_0000087_120261_120887 203
213 3300048921 Ga0496118_0026814 Ga0496118_0026814_3035_3661 203
214 3300048922 Ga0496119_0017836 Ga0496119_0017836_3645_4271 203
215 3300048923 Ga0496120_0000180 Ga0496120_0000180_80525_81151 203
216 3300048924 Ga0496121_0295947 Ga0496121_0295947_177_803 203
217 3300048925 Ga0496122_0000004 Ga0496122_0000004_80530_81156 203
218 3300048925 Ga0496122_0080079 Ga0496122_0080079_46_672 203
219 3300048926 Ga0496123_0000007 Ga0496123_0000007_80530_81156 203
220 3300048927 Ga0496124_0170122 Ga0496124_0170122_426_1049 203
221 3300048927 Ga0496124_0253043 Ga0496124_0253043_381_1007 203
222 3300048928 Ga0496125_0050144 Ga0496125_0050144_1482_2108 203
223 3300050489 nmdc:mga03683_58404_c1 nmdc:mga03683_58404_c1_73_699 203
224 3300050490 nmdc:mga03n38_37750_c1 nmdc:mga03n38_37750_c1_437_1063 203
225 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_56554_57180 203
226 3300050492 nmdc:mga0yw44_37031_c1 nmdc:mga0yw44_37031_c1_701_1327 203
227 3300050493 nmdc:mga0k408_20752_c1 nmdc:mga0k408_20752_c1_120_746 203
228 3300050494 nmdc:mga06z11_167209_c1 nmdc:mga06z11_167209_c1_166_792 203
229 3300050495 nmdc:mga04h51_97369_c1 nmdc:mga04h51_97369_c1_366_992 203
230 3300050496 nmdc:mga07m45_82533_c1 nmdc:mga07m45_82533_c1_438_1064 203
231 3300050516 nmdc:mga0sz30_1253_c1 nmdc:mga0sz30_1253_c1_3406_4032 203
232 3300053107 Ga0500560_000390 Ga0500560_000390_1804_2430 203
233 3300053107 Ga0500560_047134 Ga0500560_047134_540_1166 203
234 3300053118 Ga0500594_0014104 Ga0500594_0014104_406_1032 203
235 3300053137 Ga0500561_0000078 Ga0500561_0000078_15307_15933 203
236 3300053156 Ga0500622_0001213 Ga0500622_0001213_18178_18804 203
237 3300053157 Ga0500624_000176 Ga0500624_000176_3701_4327 203
238 3300053161 Ga0500634_0002928 Ga0500634_0002928_3590_4216 203
239 3300053161 Ga0500634_0072096 Ga0500634_0072096_207_833 203
240 3300053177 Ga0500636_0001850 Ga0500636_0001850_3788_4414 203
241 3300005330 Ga0070690_100005779 Ga0070690_1000057796 204
242 3300005340 Ga0070689_100066129 Ga0070689_1000661292 204
243 3300005440 Ga0070705_100346677 Ga0070705_1003466772 204
244 3300005841 Ga0068863_100007391 Ga0068863_1000073913 204
245 3300005843 Ga0068860_100150053 Ga0068860_1001500532 204
246 3300006028 Ga0070717_10101937 Ga0070717_101019373 204
247 3300009148 Ga0105243_10039841 Ga0105243_100398413 204
248 3300009553 Ga0105249_10278344 Ga0105249_102783441 204
249 3300013297 Ga0157378_10469427 Ga0157378_104694271 204
250 3300014325 Ga0163163_10650378 Ga0163163_106503782 204
251 3300025899 Ga0207642_10378352 Ga0207642_103783521 204
252 3300025935 Ga0207709_10040101 Ga0207709_100401013 204
253 3300025936 Ga0207670_10254652 Ga0207670_102546521 204
254 3300025961 Ga0207712_10224412 Ga0207712_102244121 204
255 3300026088 Ga0207641_10006402 Ga0207641_100064025 204
256 3300028786 Ga0307517_10042650 Ga0307517_100426504 204
257 3300031456 Ga0307513_10031493 Ga0307513_100314934 204
258 3300031507 Ga0307509_10024611 Ga0307509_100246116 204
259 3300031507 Ga0307509_10090948 Ga0307509_100909482 204
260 3300031616 Ga0307508_10178873 Ga0307508_101788733 204
261 3300031730 Ga0307516_10141117 Ga0307516_101411174 204
262 3300031730 Ga0307516_10166092 Ga0307516_101660922 204
263 3300035113 Ga0373936_0000020 Ga0373936_0000020_46490_47107 204
264 3300035241 Ga0373961_0000088 Ga0373961_0000088_1007_1624 204
265 3300046460 Ga0495638_0338470 Ga0495638_0338470_17_634 204
266 3300049571 Ga0501034_0004927 Ga0501034_0004927_1483_2124 204
267 3300053091 Ga0500647_0067199 Ga0500647_0067199_818_1435 204
268 3300053091 Ga0500647_0140590 Ga0500647_0140590_383_1000 204
269 3300053092 Ga0500583_0062023 Ga0500583_0062023_480_1097 204
270 3300053094 Ga0500566_0008102 Ga0500566_0008102_1813_2430 204
271 3300053095 Ga0500640_000092 Ga0500640_000092_4840_5457 204
272 3300053111 Ga0500572_001339 Ga0500572_001339_1304_1921 204
273 3300053119 Ga0500595_000048 Ga0500595_000048_68753_69370 204
274 3300053120 Ga0500597_012755 Ga0500597_012755_1955_2572 204
275 3300053130 Ga0500642_0059397 Ga0500642_0059397_173_790 204
276 3300053136 Ga0500559_0039579 Ga0500559_0039579_1356_1973 204
277 3300053150 Ga0500603_002739 Ga0500603_002739_1504_2121 204
278 3300053154 Ga0500619_098630 Ga0500619_098630_25_642 204
279 3300053156 Ga0500622_0211835 Ga0500622_0211835_104_721 204
280 3300053178 Ga0500637_0058115 Ga0500637_0058115_577_1194 204
281 3300053737 Ga0500601_002016 Ga0500601_002016_1414_2031 204
282 3300025918 Ga0207662_10317301 Ga0207662_103173012 205
283 iso_pu_bacteria 2547132103 2547375395 206
284 iso_pu_bacteria 2843690924 2843694478 206
285 iso_pu_bacteria 2846037992 2846038995 206
286 3300009098 Ga0105245_10849925 Ga0105245_108499251 207
287 3300039438 Ga0436360_0909394 Ga0436360_0909394_1558_2181 207
288 3300048907 Ga0496104_0536038 Ga0496104_0536038_318_995 207
289 3300048919 Ga0496116_0118611 Ga0496116_0118611_457_1134 207
290 3300048922 Ga0496119_0015225 Ga0496119_0015225_4564_5241 207
291 3300048924 Ga0496121_0166359 Ga0496121_0166359_74_751 207
292 3300048928 Ga0496125_0006980 Ga0496125_0006980_8286_8963 207
293 3300049460 Ga0495682_0050137 Ga0495682_0050137_732_1358 207
294 3300049571 Ga0501034_0084434 Ga0501034_0084434_666_1298 207
295 3300049573 Ga0501037_0180452 Ga0501037_0180452_470_1102 207
296 3300049579 Ga0501043_0205701 Ga0501043_0205701_78_710 207
297 3300049580 Ga0501046_0231606 Ga0501046_0231606_711_1343 207
298 3300049581 Ga0501047_0090939 Ga0501047_0090939_1300_1932 207
299 3300049589 Ga0501073_0334125 Ga0501073_0334125_198_830 207
300 3300049822 Ga0501035_0193546 Ga0501035_0193546_736_1368 207
301 3300049823 Ga0501044_0016929 Ga0501044_0016929_1129_1761 207
302 3300050491 nmdc:mga00v17_121852_c1 nmdc:mga00v17_121852_c1_385_1173 207
303 3300050512 nmdc:mga0n895_615806_c1 nmdc:mga0n895_615806_c1_24_656 207
304 3300053094 Ga0500566_0053468 Ga0500566_0053468_893_1519 207
305 3300053111 Ga0500572_008418 Ga0500572_008418_1037_1678 207
306 3300053177 Ga0500636_0195542 Ga0500636_0195542_211_837 207
307 3300002067 JGI24735J21928_10004084 JGI24735J21928_100040844 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

19

221

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.9959 1 205
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.9816 1 205
2h0r-assembly7.cif.gz_G structure of the yeast nicotinamidase pnc1p 0.9409 6 202
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.9407 3 204
3v8e-assembly7.cif.gz_G crystal structure of the yeast nicotinamidase pnc1p bound to the inhibitor nicotinaldehyde 0.9283 6 201
ID Description Score Start End Superfamily
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9959 1 205 3.40.50.850
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9816 1 205 3.40.50.850
af_P21369_4_203_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9503 7 200 3.40.50.850
af_Q54BH7_1_207_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9447 6 207 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9379 3 204 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A3D4UXZ4-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 1 6 173 GO:0016811
GO:0019363
GO:0046872
AF-A0A537TEM0-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9996 106 204 GO:0016811
GO:0019363
GO:0046872
AF-A0A7Y2XZG3-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9995 7 130 GO:0016811
GO:0019363
GO:0046872
AF-A0A059L9A9-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9993 3 202 GO:0016811
GO:0019363
GO:0046872
AF-A0A316BKK5-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9992 5 201 GO:0016811
GO:0019363
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.82 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map