F399210

General Info

Members Datasets Scaffolds Average Seq Length
307 162 307 109

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10004368|Ga0163161_1000436812
Length 135
Sequence MSRAYSTEIKNNFGSFHINRNIAIYIMGITKTEIFTDEQNKLAVQLKAIAHPARIAILQHIIAAKACICGDLADELGLAQPTISQHLKELKNAGLIQGTIEGVSVCYCIEPKAWNNLQTELNVLFSSYKDLNSCC

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
53 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
86 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
87 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
88 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
107 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
108 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
109 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
110 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
153 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
158 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
161 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.12
Nodule 0
Rhizoplane 0.33
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001399 3300001990 Bacteria 8551
2 JGI24737J22298_10019217 3300001990 Bacteria 2186
3 JGI24735J21928_10000004 3300002067 Bacteria 381713
4 JGI25162J39368_1000650 3300002737 Bacteria 24576
5 JGI25162J39368_1003960 3300002737 Bacteria 3777
6 JGI25164J39214_1000862 3300002772 Bacteria 10351
7 JGI25165J46597_1001427 3300003214 Bacteria 12848
8 rootH1_10061908 3300003316 Bacteria 8102
9 rootH2_10010808 3300003320 Bacteria 73638
10 rootH2_10071179 3300003320 Bacteria 2883
11 rootH2_10287756 3300003320 Bacteria 2340
12 rootL2_10064606 3300003322 Bacteria 1552
13 rootL2_10175893 3300003322 Bacteria 4945
14 rootL2_10265490 3300003322 Bacteria 2484
15 rootH1_10005288 3300003323 Bacteria 25229
16 rootH1_10193406 3300003323 Bacteria 1058
17 rootH1_10290119 3300003323 Bacteria 1499
18 Ga0065714_10136798 3300005288 Bacteria 1202
19 Ga0065704_10284346 3300005289 Unclassified 916
20 Ga0070658_11677159 3300005327 Unclassified 550
21 Ga0070680_100027733 3300005336 Bacteria 4537
22 Ga0070680_100510035 3300005336 Bacteria 1029
23 Ga0068868_100118087 3300005338 Bacteria 2161
24 Ga0070660_101373726 3300005339 Bacteria 600
25 Ga0070675_100822520 3300005354 Bacteria 849
26 Ga0070710_11401612 3300005437 Bacteria 522
27 Ga0070663_100020487 3300005455 Bacteria 4380
28 Ga0070662_100000031 3300005457 Bacteria 79515
29 Ga0070681_10007952 3300005458 Bacteria 10380
30 Ga0070679_100018424 3300005530 Bacteria 6775
31 Ga0070679_102028686 3300005530 Bacteria 524
32 Ga0070684_100087904 3300005535 Bacteria 2760
33 Ga0070684_101243797 3300005535 Bacteria 700
34 Ga0068853_101618219 3300005539 Unclassified 628
35 Ga0070665_100001665 3300005548 Bacteria 25606
36 Ga0070665_101381959 3300005548 Bacteria 713
37 Ga0068855_100000226 3300005563 Bacteria 72130
38 Ga0068855_100036771 3300005563 Bacteria 5826
39 Ga0068855_100074393 3300005563 Bacteria 3946
40 Ga0068855_100076670 3300005563 Bacteria 3879
41 Ga0068857_102342262 3300005577 Bacteria 524
42 Ga0068854_100436795 3300005578 Bacteria 1090
43 Ga0068854_100691014 3300005578 Bacteria 880
44 Ga0068856_100194156 3300005614 Bacteria 2044
45 Ga0068856_100442487 3300005614 Bacteria 1320
46 Ga0068852_101091819 3300005616 Bacteria 818
47 Ga0068852_102467309 3300005616 Bacteria 540
48 Ga0068866_10357937 3300005718 Bacteria 929
49 Ga0068858_100089313 3300005842 Bacteria 2867
50 Ga0075366_10000660 3300006195 Bacteria 16235
51 Ga0075366_10000727 3300006195 Bacteria 15649
52 Ga0075366_10003622 3300006195 Bacteria 8184
53 Ga0105240_10002198 3300009093 Bacteria 31833
54 Ga0105240_10044728 3300009093 Bacteria 5623
55 Ga0105240_10054898 3300009093 Bacteria 4990
56 Ga0105240_10079666 3300009093 Bacteria 4030
57 Ga0105240_10218018 3300009093 Bacteria 2225
58 Ga0105240_10225706 3300009093 Bacteria 2179
59 Ga0105240_10312009 3300009093 Bacteria 1795
60 Ga0105240_10583789 3300009093 Unclassified 1232
61 Ga0105240_10950344 3300009093 Bacteria 922
62 Ga0105240_11465747 3300009093 Bacteria 716
63 Ga0105240_12254273 3300009093 Bacteria 564
64 Ga0105241_10001360 3300009174 Bacteria 18620
65 Ga0105241_10002608 3300009174 Bacteria 13519
66 Ga0105241_10047598 3300009174 Bacteria 3261
67 Ga0105242_10900046 3300009176 Bacteria 885
68 Ga0105237_10000143 3300009545 Bacteria 101515
69 Ga0105237_10003402 3300009545 Bacteria 18918
70 Ga0105237_10019933 3300009545 Bacteria 6923
71 Ga0105237_10111475 3300009545 Bacteria 2728
72 Ga0105237_10159423 3300009545 Bacteria 2254
73 Ga0105237_10372846 3300009545 Unclassified 1432
74 Ga0105237_10804965 3300009545 Bacteria 946
75 Ga0105237_10973695 3300009545 Unclassified 855
76 Ga0105237_11708120 3300009545 Unclassified 637
77 Ga0105237_11840310 3300009545 Unclassified 613
78 Ga0105238_10036985 3300009551 Bacteria 4963
79 Ga0105238_10091415 3300009551 Bacteria 3031
80 Ga0105238_10862622 3300009551 Unclassified 923
81 Ga0105238_10873521 3300009551 Bacteria 917
82 Ga0105249_10277460 3300009553 Unclassified 1672
83 Ga0105239_10000036 3300010375 Bacteria 212090
84 Ga0105239_10000195 3300010375 Bacteria 88195
85 Ga0105239_10003569 3300010375 Bacteria 19023
86 Ga0105239_10005136 3300010375 Bacteria 15457
87 Ga0105239_10035617 3300010375 Bacteria 5465
88 Ga0105239_10058799 3300010375 Bacteria 4219
89 Ga0105239_10064942 3300010375 Bacteria 4007
90 Ga0105239_10093530 3300010375 Bacteria 3319
91 Ga0105239_10137557 3300010375 Bacteria 2720
92 Ga0105239_10410523 3300010375 Bacteria 1533
93 Ga0105239_11491907 3300010375 Unclassified 781
94 Ga0105246_10245450 3300011119 Bacteria 1418
95 Ga0157373_10000134 3300013100 Bacteria 58266
96 Ga0157373_10000360 3300013100 Bacteria 36657
97 Ga0157373_10006702 3300013100 Bacteria 8573
98 Ga0157373_10214320 3300013100 Bacteria 1358
99 Ga0157373_10914186 3300013100 Bacteria 652
100 Ga0157371_10004775 3300013102 Bacteria 11681
101 Ga0157371_10013694 3300013102 Bacteria 6151
102 Ga0157371_10077589 3300013102 Bacteria 2352
103 Ga0157371_10445105 3300013102 Bacteria 952
104 Ga0157371_10688523 3300013102 Bacteria 765
105 Ga0157370_10007964 3300013104 Bacteria 11480
106 Ga0157370_10047268 3300013104 Bacteria 4126
107 Ga0157370_10088078 3300013104 Bacteria 2915
108 Ga0157370_10245118 3300013104 Unclassified 1658
109 Ga0157370_10401515 3300013104 Bacteria 1261
110 Ga0157370_10573296 3300013104 Bacteria 1034
111 Ga0157369_10001726 3300013105 Bacteria 26600
112 Ga0157369_10088799 3300013105 Bacteria 3300
113 Ga0157369_10157382 3300013105 Bacteria 2399
114 Ga0157374_10000051 3300013296 Bacteria 126876
115 Ga0157374_11135297 3300013296 Unclassified 802
116 Ga0157374_11722114 3300013296 Unclassified 652
117 Ga0157378_10006153 3300013297 Bacteria 10506
118 Ga0163162_10000459 3300013306 Bacteria 37749
119 Ga0163162_10016960 3300013306 Bacteria 7124
120 Ga0163162_10195355 3300013306 Unclassified 2152
121 Ga0163162_11499365 3300013306 Bacteria 768
122 Ga0157372_10000286 3300013307 Bacteria 56140
123 Ga0157372_10000725 3300013307 Bacteria 35931
124 Ga0157372_10008804 3300013307 Bacteria 10717
125 Ga0157372_10022408 3300013307 Bacteria 6835
126 Ga0157372_10036110 3300013307 Bacteria 5446
127 Ga0157375_10019874 3300013308 Bacteria 6122
128 Ga0182008_10001648 3300014497 Bacteria 14754
129 Ga0157377_10048866 3300014745 Bacteria 2376
130 Ga0182006_1000904 3300015261 Bacteria 19844
131 Ga0182006_1058829 3300015261 Bacteria 1456
132 Ga0182006_1150567 3300015261 Bacteria 789
133 Ga0182007_10015221 3300015262 Bacteria 2876
134 Ga0163161_10004368 3300017792 Bacteria 9855
135 Ga0163161_10005047 3300017792 Bacteria 9183
136 Ga0209563_111698 3300025230 Unclassified 1230
137 Ga0207427_100152 3300025231 Bacteria 78389
138 Ga0209437_100030 3300025233 Bacteria 532466
139 Ga0209437_100164 3300025233 Bacteria 145317
140 Ga0209026_1001646 3300025250 Bacteria 9480
141 Ga0209026_1005925 3300025250 Bacteria 3135
142 Ga0209026_1035961 3300025250 Bacteria 726
143 Ga0209148_1022874 3300025254 Bacteria 1000
144 Ga0209233_1000038 3300025261 Bacteria 548972
145 Ga0209455_1035984 3300025272 Bacteria 792
146 Ga0207647_10000081 3300025904 Bacteria 71603
147 Ga0207647_10004768 3300025904 Bacteria 10040
148 Ga0207705_10000028 3300025909 Bacteria 240636
149 Ga0207654_10001489 3300025911 Bacteria 12377
150 Ga0207654_10003258 3300025911 Bacteria 8200
151 Ga0207654_10040975 3300025911 Bacteria 2612
152 Ga0207707_10019673 3300025912 Bacteria 5892
153 Ga0207695_10000183 3300025913 Bacteria 181350
154 Ga0207695_10005810 3300025913 Bacteria 16238
155 Ga0207695_10007301 3300025913 Bacteria 14110
156 Ga0207695_10033140 3300025913 Bacteria 5641
157 Ga0207695_10176531 3300025913 Bacteria 2058
158 Ga0207695_10206600 3300025913 Bacteria 1876
159 Ga0207695_10270311 3300025913 Bacteria 1595
160 Ga0207695_10287867 3300025913 Bacteria 1536
161 Ga0207695_10669741 3300025913 Bacteria 918
162 Ga0207695_11446302 3300025913 Bacteria 568
163 Ga0207695_11474625 3300025913 Bacteria 561
164 Ga0207671_10000968 3300025914 Bacteria 35551
165 Ga0207671_10003362 3300025914 Bacteria 16046
166 Ga0207671_10006318 3300025914 Bacteria 10576
167 Ga0207671_10009918 3300025914 Bacteria 7916
168 Ga0207671_10012780 3300025914 Bacteria 6731
169 Ga0207671_10285121 3300025914 Bacteria 1303
170 Ga0207671_10472272 3300025914 Unclassified 999
171 Ga0207671_10598316 3300025914 Unclassified 879
172 Ga0207671_10932903 3300025914 Bacteria 685
173 Ga0207660_10018829 3300025917 Bacteria 4609
174 Ga0207660_10952602 3300025917 Bacteria 700
175 Ga0207657_11264611 3300025919 Bacteria 559
176 Ga0207652_10083321 3300025921 Bacteria 2800
177 Ga0207652_10108913 3300025921 Bacteria 2455
178 Ga0207652_10757033 3300025921 Bacteria 864
179 Ga0207694_10056725 3300025924 Bacteria 3043
180 Ga0207694_11293948 3300025924 Unclassified 617
181 Ga0207706_10000124 3300025933 Bacteria 83568
182 Ga0207686_10457689 3300025934 Bacteria 983
183 Ga0207667_10000039 3300025949 Bacteria 278843
184 Ga0207667_10020040 3300025949 Bacteria 7447
185 Ga0207667_10060640 3300025949 Bacteria 3959
186 Ga0207667_10185355 3300025949 Bacteria 2137
187 Ga0207712_10764658 3300025961 Unclassified 847
188 Ga0207640_10548332 3300025981 Bacteria 971
189 Ga0207677_10195082 3300026023 Bacteria 1605
190 Ga0207678_10040879 3300026067 Bacteria 4020
191 Ga0207702_10154585 3300026078 Bacteria 2090
192 Ga0207674_10650136 3300026116 Bacteria 1018
193 Ga0207698_11563991 3300026142 Bacteria 675
194 Ga0268266_10151799 3300028379 Bacteria 2088
195 Ga0307517_10013164 3300028786 Bacteria 11264
196 Ga0307515_10000318 3300028794 Bacteria 118891
197 Ga0307515_10017059 3300028794 Bacteria 13257
198 Ga0316177_1201147 3300030731 Bacteria 11810
199 Ga0316183_1007655 3300030742 Bacteria 9211
200 Ga0316181_1013171 3300030744 Bacteria 9975
201 Ga0316181_1152293 3300030744 Bacteria 1359
202 Ga0316182_1078015 3300030745 Unclassified 1224
203 Ga0265327_10239445 3300031251 Bacteria 811
204 Ga0307509_10592645 3300031507 Bacteria 782
205 Ga0307408_100001128 3300031548 Bacteria 20333
206 Ga0307408_100001444 3300031548 Bacteria 17663
207 Ga0307405_10548721 3300031731 Bacteria 935
208 Ga0307413_10036639 3300031824 Bacteria 2826
209 Ga0307412_10001170 3300031911 Bacteria 15010
210 Ga0307412_10025342 3300031911 Bacteria 3673
211 Ga0307412_11494550 3300031911 Bacteria 614
212 Ga0307409_100507066 3300031995 Bacteria 1176
213 Ga0307416_100039708 3300032002 Bacteria 3648
214 Ga0307414_10000710 3300032004 Bacteria 16998
215 Ga0307414_10017087 3300032004 Bacteria 4431
216 Ga0307414_10028488 3300032004 Bacteria 3624
217 Ga0307507_10000159 3300033179 Bacteria 120125
218 Ga0307510_10005630 3300033180 Bacteria 14934
219 Ga0395899_0000434 3300037312 Bacteria 48146
220 Ga0395899_0000751 3300037312 Bacteria 32145
221 Ga0395900_0000153 3300037418 Bacteria 115432
222 Ga0395900_1008500 3300037418 Unclassified 752
223 Ga0395898_0078437 3300037466 Bacteria 3187
224 Ga0395905_0003545 3300037471 Bacteria 16635
225 Ga0395901_0000330 3300038443 Bacteria 58380
226 Ga0439436_0081900 3300041404 Bacteria 898
227 Ga0451789_0716494 3300041443 Bacteria 631
228 Ga0451841_1079460 3300041498 Bacteria 586
229 Ga0439455_0077145 3300042012 Bacteria 902
230 Ga0439457_013754 3300042014 Bacteria 1816
231 Ga0450906_087677 3300042145 Unclassified 563
232 Ga0466969_0014294 3300044656 Bacteria 4174
233 Ga0466966_0003138 3300044684 Bacteria 10876
234 Ga0466961_0054087 3300044693 Bacteria 2561
235 Ga0466961_0315933 3300044693 Bacteria 953
236 Ga0495629_0221173 3300046459 Bacteria 1306
237 Ga0495650_0000050 3300046471 Bacteria 318894
238 Ga0495585_0000167 3300046492 Bacteria 70874
239 Ga0495585_0000477 3300046492 Bacteria 38276
240 Ga0495596_0263693 3300046500 Bacteria 669
241 Ga0495607_0109685 3300046501 Bacteria 1465
242 Ga0495583_0169627 3300046506 Bacteria 897
243 Ga0495606_0000036 3300046507 Bacteria 234596
244 Ga0495608_0608068 3300046511 Bacteria 656
245 Ga0495610_0001572 3300046512 Bacteria 20100
246 Ga0495616_0000271 3300046513 Bacteria 42005
247 Ga0495631_0004810 3300046518 Bacteria 7117
248 Ga0495631_0386014 3300046518 Bacteria 596
249 Ga0495632_0041937 3300046519 Bacteria 2297
250 Ga0495637_0047058 3300046520 Bacteria 1823
251 Ga0495648_0007084 3300046524 Bacteria 9028
252 Ga0495648_0062608 3300046524 Bacteria 2202
253 Ga0495652_0831991 3300046529 Bacteria 613
254 Ga0495654_0166734 3300046530 Bacteria 963
255 Ga0495609_0005232 3300046538 Bacteria 6903
256 Ga0495609_0006151 3300046538 Bacteria 6174
257 Ga0495609_0008801 3300046538 Bacteria 4913
258 Ga0495622_0138466 3300046557 Bacteria 1106
259 Ga0495633_0000295 3300046558 Bacteria 56870
260 Ga0495633_0002805 3300046558 Bacteria 12052
261 Ga0495633_0108880 3300046558 Bacteria 1285
262 Ga0495668_0000121 3300046616 Bacteria 116234
263 Ga0495668_0094882 3300046616 Bacteria 1633
264 Ga0495625_0000105 3300046660 Bacteria 126078
265 Ga0495625_0001033 3300046660 Bacteria 36654
266 Ga0495625_0003507 3300046660 Bacteria 15548
267 Ga0495625_0055219 3300046660 Bacteria 2833
268 Ga0495625_0125478 3300046660 Bacteria 1743
269 Ga0495661_0065499 3300046665 Bacteria 2141
270 Ga0495661_0219272 3300046665 Bacteria 986
271 Ga0495661_0268244 3300046665 Bacteria 865
272 Ga0495669_0593725 3300046684 Bacteria 539
273 Ga0495670_0306670 3300046691 Bacteria 851
274 Ga0495671_0179310 3300046692 Bacteria 1029
275 Ga0495649_0000011 3300046694 Bacteria 416695
276 Ga0495683_0182702 3300047323 Bacteria 956
277 Ga0495683_0211886 3300047323 Bacteria 868
278 Ga0495687_033512 3300047443 Bacteria 2328
279 Ga0495687_047678 3300047443 Bacteria 1842
280 Ga0495677_0059332 3300047445 Bacteria 1417
281 Ga0495679_069844 3300047446 Bacteria 1014
282 Ga0495685_281161 3300047447 Bacteria 524
283 Ga0495673_0046491 3300047469 Bacteria 1923
284 Ga0495686_0008205 3300047472 Bacteria 7701
285 Ga0495686_0062033 3300047472 Bacteria 2319
286 Ga0495686_0133146 3300047472 Bacteria 1472
287 Ga0495614_0079542 3300048089 Bacteria 1419
288 Ga0496122_0000391 3300048925 Bacteria 93479
289 Ga0496123_0012360 3300048926 Bacteria 7288
290 Ga0496125_0123875 3300048928 Bacteria 1837
291 Ga0496126_0921052 3300048929 Bacteria 661
292 Ga0501198_004789 3300049649 Bacteria 1890
293 Ga0501269_009096 3300049766 Bacteria 1204
294 nmdc:mga0k408_2016_c1 3300050493 Bacteria 10890
295 nmdc:mga0k408_710_c1 3300050493 Bacteria 18223
296 nmdc:mga0k408_88196_c1 3300050493 Bacteria 1140
297 nmdc:mga07m45_293865_c2 3300050496 Bacteria 534
298 Ga0500635_0003096 3300053080 Bacteria 4160
299 Ga0500635_0028495 3300053080 Unclassified 1784
300 Ga0500608_049037 3300053122 Bacteria 2029
301 Ga0500608_052638 3300053122 Bacteria 1955
302 Ga0500614_037853 3300053123 Bacteria 1212
303 Ga0500618_000012 3300053125 Bacteria 185382
304 Ga0500618_017964 3300053125 Bacteria 1755
305 Ga0500642_0011646 3300053130 Bacteria 3155
306 Ga0500564_092359 3300053138 Bacteria 1346
307 Ga0500622_0000537 3300053156 Bacteria 35129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10000660 Ga0075366_100006609 108
2 3300028794 Ga0307515_10000318 Ga0307515_1000031898 108
3 3300028794 Ga0307515_10017059 Ga0307515_100170597 108
4 3300031911 Ga0307412_10025342 Ga0307412_100253423 108
5 3300032004 Ga0307414_10000710 Ga0307414_100007104 108
6 3300033179 Ga0307507_10000159 Ga0307507_10000159101 108
7 3300041498 Ga0451841_1079460 Ga0451841_1079460_31_357 108
8 3300046459 Ga0495629_0221173 Ga0495629_0221173_96_422 108
9 3300046492 Ga0495585_0000477 Ga0495585_0000477_26516_26842 108
10 3300046501 Ga0495607_0109685 Ga0495607_0109685_211_537 108
11 3300046511 Ga0495608_0608068 Ga0495608_0608068_264_590 108
12 3300046524 Ga0495648_0007084 Ga0495648_0007084_1311_1637 108
13 3300046524 Ga0495648_0062608 Ga0495648_0062608_110_436 108
14 3300046530 Ga0495654_0166734 Ga0495654_0166734_155_481 108
15 3300046538 Ga0495609_0006151 Ga0495609_0006151_2124_2450 108
16 3300046558 Ga0495633_0000295 Ga0495633_0000295_7886_8212 108
17 3300046616 Ga0495668_0000121 Ga0495668_0000121_46912_47238 108
18 3300046660 Ga0495625_0001033 Ga0495625_0001033_5358_5684 108
19 3300046660 Ga0495625_0003507 Ga0495625_0003507_11449_11775 108
20 3300046665 Ga0495661_0219272 Ga0495661_0219272_590_916 108
21 3300046665 Ga0495661_0268244 Ga0495661_0268244_216_542 108
22 3300046691 Ga0495670_0306670 Ga0495670_0306670_127_453 108
23 3300048089 Ga0495614_0079542 Ga0495614_0079542_461_787 108
24 3300049766 Ga0501269_009096 Ga0501269_009096_270_596 108
25 3300050493 nmdc:mga0k408_710_c1 nmdc:mga0k408_710_c1_9444_9770 108
26 3300050496 nmdc:mga07m45_293865_c2 nmdc:mga07m45_293865_c2_10_336 108
27 3300053123 Ga0500614_037853 Ga0500614_037853_546_872 108
28 3300001990 JGI24737J22298_10001399 JGI24737J22298_100013999 109
29 3300001990 JGI24737J22298_10019217 JGI24737J22298_100192172 109
30 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004190 109
31 3300002737 JGI25162J39368_1000650 JGI25162J39368_100065019 109
32 3300002737 JGI25162J39368_1003960 JGI25162J39368_10039601 109
33 3300002772 JGI25164J39214_1000862 JGI25164J39214_100086212 109
34 3300003214 JGI25165J46597_1001427 JGI25165J46597_10014276 109
35 3300003316 rootH1_10061908 rootH1_100619089 109
36 3300003320 rootH2_10010808 rootH2_1001080829 109
37 3300003320 rootH2_10071179 rootH2_100711791 109
38 3300003320 rootH2_10287756 rootH2_102877561 109
39 3300003322 rootL2_10064606 rootL2_100646062 109
40 3300003322 rootL2_10175893 rootL2_101758937 109
41 3300003322 rootL2_10265490 rootL2_102654903 109
42 3300003323 rootH1_10005288 rootH1_1000528824 109
43 3300003323 rootH1_10193406 rootH1_101934061 109
44 3300003323 rootH1_10290119 rootH1_102901193 109
45 3300005288 Ga0065714_10136798 Ga0065714_101367982 109
46 3300005289 Ga0065704_10284346 Ga0065704_102843463 109
47 3300005327 Ga0070658_11677159 Ga0070658_116771591 109
48 3300005336 Ga0070680_100027733 Ga0070680_1000277332 109
49 3300005336 Ga0070680_100510035 Ga0070680_1005100352 109
50 3300005338 Ga0068868_100118087 Ga0068868_1001180872 109
51 3300005339 Ga0070660_101373726 Ga0070660_1013737261 109
52 3300005354 Ga0070675_100822520 Ga0070675_1008225201 109
53 3300005437 Ga0070710_11401612 Ga0070710_114016121 109
54 3300005455 Ga0070663_100020487 Ga0070663_1000204874 109
55 3300005457 Ga0070662_100000031 Ga0070662_10000003123 109
56 3300005458 Ga0070681_10007952 Ga0070681_100079527 109
57 3300005530 Ga0070679_100018424 Ga0070679_1000184243 109
58 3300005530 Ga0070679_102028686 Ga0070679_1020286861 109
59 3300005535 Ga0070684_100087904 Ga0070684_1000879043 109
60 3300005535 Ga0070684_101243797 Ga0070684_1012437972 109
61 3300005539 Ga0068853_101618219 Ga0068853_1016182191 109
62 3300005548 Ga0070665_100001665 Ga0070665_1000016657 109
63 3300005548 Ga0070665_101381959 Ga0070665_1013819592 109
64 3300005563 Ga0068855_100000226 Ga0068855_10000022649 109
65 3300005563 Ga0068855_100036771 Ga0068855_1000367714 109
66 3300005563 Ga0068855_100074393 Ga0068855_1000743934 109
67 3300005563 Ga0068855_100076670 Ga0068855_1000766702 109
68 3300005577 Ga0068857_102342262 Ga0068857_1023422621 109
69 3300005578 Ga0068854_100436795 Ga0068854_1004367952 109
70 3300005578 Ga0068854_100691014 Ga0068854_1006910142 109
71 3300005614 Ga0068856_100194156 Ga0068856_1001941563 109
72 3300005614 Ga0068856_100442487 Ga0068856_1004424872 109
73 3300005616 Ga0068852_101091819 Ga0068852_1010918192 109
74 3300005616 Ga0068852_102467309 Ga0068852_1024673091 109
75 3300005718 Ga0068866_10357937 Ga0068866_103579372 109
76 3300005842 Ga0068858_100089313 Ga0068858_1000893132 109
77 3300006195 Ga0075366_10000727 Ga0075366_100007276 109
78 3300006195 Ga0075366_10003622 Ga0075366_100036223 109
79 3300009093 Ga0105240_10002198 Ga0105240_1000219824 109
80 3300009093 Ga0105240_10044728 Ga0105240_100447283 109
81 3300009093 Ga0105240_10054898 Ga0105240_100548987 109
82 3300009093 Ga0105240_10079666 Ga0105240_100796663 109
83 3300009093 Ga0105240_10218018 Ga0105240_102180183 109
84 3300009093 Ga0105240_10225706 Ga0105240_102257061 109
85 3300009093 Ga0105240_10312009 Ga0105240_103120092 109
86 3300009093 Ga0105240_10583789 Ga0105240_105837892 109
87 3300009093 Ga0105240_10950344 Ga0105240_109503441 109
88 3300009093 Ga0105240_11465747 Ga0105240_114657472 109
89 3300009093 Ga0105240_12254273 Ga0105240_122542731 109
90 3300009174 Ga0105241_10001360 Ga0105241_1000136018 109
91 3300009174 Ga0105241_10002608 Ga0105241_100026087 109
92 3300009174 Ga0105241_10047598 Ga0105241_100475983 109
93 3300009176 Ga0105242_10900046 Ga0105242_109000462 109
94 3300009545 Ga0105237_10000143 Ga0105237_1000014354 109
95 3300009545 Ga0105237_10003402 Ga0105237_1000340211 109
96 3300009545 Ga0105237_10019933 Ga0105237_100199336 109
97 3300009545 Ga0105237_10111475 Ga0105237_101114753 109
98 3300009545 Ga0105237_10159423 Ga0105237_101594231 109
99 3300009545 Ga0105237_10372846 Ga0105237_103728463 109
100 3300009545 Ga0105237_10804965 Ga0105237_108049652 109
101 3300009545 Ga0105237_10973695 Ga0105237_109736952 109
102 3300009545 Ga0105237_11708120 Ga0105237_117081202 109
103 3300009545 Ga0105237_11840310 Ga0105237_118403101 109
104 3300009551 Ga0105238_10036985 Ga0105238_100369856 109
105 3300009551 Ga0105238_10091415 Ga0105238_100914153 109
106 3300009551 Ga0105238_10862622 Ga0105238_108626222 109
107 3300009551 Ga0105238_10873521 Ga0105238_108735212 109
108 3300009553 Ga0105249_10277460 Ga0105249_102774603 109
109 3300010375 Ga0105239_10000036 Ga0105239_100000366 109
110 3300010375 Ga0105239_10000195 Ga0105239_1000019526 109
111 3300010375 Ga0105239_10003569 Ga0105239_100035699 109
112 3300010375 Ga0105239_10005136 Ga0105239_1000513611 109
113 3300010375 Ga0105239_10035617 Ga0105239_100356171 109
114 3300010375 Ga0105239_10058799 Ga0105239_100587994 109
115 3300010375 Ga0105239_10064942 Ga0105239_100649425 109
116 3300010375 Ga0105239_10093530 Ga0105239_100935305 109
117 3300010375 Ga0105239_10137557 Ga0105239_101375572 109
118 3300010375 Ga0105239_10410523 Ga0105239_104105231 109
119 3300010375 Ga0105239_11491907 Ga0105239_114919072 109
120 3300011119 Ga0105246_10245450 Ga0105246_102454502 109
121 3300013100 Ga0157373_10000134 Ga0157373_1000013460 109
122 3300013100 Ga0157373_10000360 Ga0157373_1000036019 109
123 3300013100 Ga0157373_10006702 Ga0157373_100067026 109
124 3300013100 Ga0157373_10214320 Ga0157373_102143201 109
125 3300013100 Ga0157373_10914186 Ga0157373_109141861 109
126 3300013102 Ga0157371_10004775 Ga0157371_100047754 109
127 3300013102 Ga0157371_10013694 Ga0157371_100136948 109
128 3300013102 Ga0157371_10077589 Ga0157371_100775893 109
129 3300013102 Ga0157371_10445105 Ga0157371_104451053 109
130 3300013102 Ga0157371_10688523 Ga0157371_106885231 109
131 3300013104 Ga0157370_10007964 Ga0157370_100079644 109
132 3300013104 Ga0157370_10047268 Ga0157370_100472685 109
133 3300013104 Ga0157370_10088078 Ga0157370_100880784 109
134 3300013104 Ga0157370_10245118 Ga0157370_102451181 109
135 3300013104 Ga0157370_10401515 Ga0157370_104015151 109
136 3300013104 Ga0157370_10573296 Ga0157370_105732962 109
137 3300013105 Ga0157369_10001726 Ga0157369_1000172619 109
138 3300013105 Ga0157369_10088799 Ga0157369_100887992 109
139 3300013105 Ga0157369_10157382 Ga0157369_101573821 109
140 3300013296 Ga0157374_10000051 Ga0157374_1000005124 109
141 3300013296 Ga0157374_11135297 Ga0157374_111352971 109
142 3300013296 Ga0157374_11722114 Ga0157374_117221142 109
143 3300013297 Ga0157378_10006153 Ga0157378_100061537 109
144 3300013306 Ga0163162_10000459 Ga0163162_1000045938 109
145 3300013306 Ga0163162_10016960 Ga0163162_100169606 109
146 3300013306 Ga0163162_10195355 Ga0163162_101953553 109
147 3300013306 Ga0163162_11499365 Ga0163162_114993651 109
148 3300013307 Ga0157372_10000286 Ga0157372_1000028639 109
149 3300013307 Ga0157372_10000725 Ga0157372_1000072511 109
150 3300013307 Ga0157372_10008804 Ga0157372_100088046 109
151 3300013307 Ga0157372_10022408 Ga0157372_100224086 109
152 3300013307 Ga0157372_10036110 Ga0157372_100361105 109
153 3300013308 Ga0157375_10019874 Ga0157375_100198747 109
154 3300014497 Ga0182008_10001648 Ga0182008_100016489 109
155 3300014745 Ga0157377_10048866 Ga0157377_100488664 109
156 3300015261 Ga0182006_1000904 Ga0182006_100090412 109
157 3300015261 Ga0182006_1058829 Ga0182006_10588292 109
158 3300015261 Ga0182006_1150567 Ga0182006_11505671 109
159 3300015262 Ga0182007_10015221 Ga0182007_100152212 109
160 3300017792 Ga0163161_10004368 Ga0163161_1000436812 109
161 3300017792 Ga0163161_10005047 Ga0163161_100050474 109
162 3300025230 Ga0209563_111698 Ga0209563_1116982 109
163 3300025231 Ga0207427_100152 Ga0207427_10015240 109
164 3300025233 Ga0209437_100030 Ga0209437_1000305 109
165 3300025233 Ga0209437_100164 Ga0209437_10016498 109
166 3300025250 Ga0209026_1001646 Ga0209026_10016464 109
167 3300025250 Ga0209026_1005925 Ga0209026_10059252 109
168 3300025250 Ga0209026_1035961 Ga0209026_10359611 109
169 3300025254 Ga0209148_1022874 Ga0209148_10228742 109
170 3300025261 Ga0209233_1000038 Ga0209233_1000038504 109
171 3300025272 Ga0209455_1035984 Ga0209455_10359842 109
172 3300025904 Ga0207647_10000081 Ga0207647_1000008133 109
173 3300025904 Ga0207647_10004768 Ga0207647_100047689 109
174 3300025909 Ga0207705_10000028 Ga0207705_1000002876 109
175 3300025911 Ga0207654_10001489 Ga0207654_1000148910 109
176 3300025911 Ga0207654_10003258 Ga0207654_100032587 109
177 3300025911 Ga0207654_10040975 Ga0207654_100409753 109
178 3300025912 Ga0207707_10019673 Ga0207707_100196738 109
179 3300025913 Ga0207695_10000183 Ga0207695_1000018371 109
180 3300025913 Ga0207695_10005810 Ga0207695_1000581019 109
181 3300025913 Ga0207695_10007301 Ga0207695_100073015 109
182 3300025913 Ga0207695_10033140 Ga0207695_100331403 109
183 3300025913 Ga0207695_10176531 Ga0207695_101765312 109
184 3300025913 Ga0207695_10206600 Ga0207695_102066001 109
185 3300025913 Ga0207695_10270311 Ga0207695_102703112 109
186 3300025913 Ga0207695_10287867 Ga0207695_102878672 109
187 3300025913 Ga0207695_10669741 Ga0207695_106697412 109
188 3300025913 Ga0207695_11446302 Ga0207695_114463021 109
189 3300025913 Ga0207695_11474625 Ga0207695_114746252 109
190 3300025914 Ga0207671_10000968 Ga0207671_1000096812 109
191 3300025914 Ga0207671_10003362 Ga0207671_1000336211 109
192 3300025914 Ga0207671_10006318 Ga0207671_100063187 109
193 3300025914 Ga0207671_10009918 Ga0207671_100099183 109
194 3300025914 Ga0207671_10012780 Ga0207671_100127805 109
195 3300025914 Ga0207671_10285121 Ga0207671_102851212 109
196 3300025914 Ga0207671_10472272 Ga0207671_104722721 109
197 3300025914 Ga0207671_10598316 Ga0207671_105983162 109
198 3300025914 Ga0207671_10932903 Ga0207671_109329031 109
199 3300025917 Ga0207660_10018829 Ga0207660_100188292 109
200 3300025917 Ga0207660_10952602 Ga0207660_109526022 109
201 3300025919 Ga0207657_11264611 Ga0207657_112646111 109
202 3300025921 Ga0207652_10083321 Ga0207652_100833212 109
203 3300025921 Ga0207652_10108913 Ga0207652_101089134 109
204 3300025921 Ga0207652_10757033 Ga0207652_107570332 109
205 3300025924 Ga0207694_10056725 Ga0207694_100567253 109
206 3300025924 Ga0207694_11293948 Ga0207694_112939481 109
207 3300025933 Ga0207706_10000124 Ga0207706_1000012473 109
208 3300025934 Ga0207686_10457689 Ga0207686_104576892 109
209 3300025949 Ga0207667_10000039 Ga0207667_10000039111 109
210 3300025949 Ga0207667_10020040 Ga0207667_100200402 109
211 3300025949 Ga0207667_10060640 Ga0207667_100606404 109
212 3300025949 Ga0207667_10185355 Ga0207667_101853552 109
213 3300025961 Ga0207712_10764658 Ga0207712_107646582 109
214 3300025981 Ga0207640_10548332 Ga0207640_105483322 109
215 3300026023 Ga0207677_10195082 Ga0207677_101950822 109
216 3300026067 Ga0207678_10040879 Ga0207678_100408793 109
217 3300026078 Ga0207702_10154585 Ga0207702_101545853 109
218 3300026116 Ga0207674_10650136 Ga0207674_106501362 109
219 3300026142 Ga0207698_11563991 Ga0207698_115639912 109
220 3300028379 Ga0268266_10151799 Ga0268266_101517992 109
221 3300028786 Ga0307517_10013164 Ga0307517_100131649 109
222 3300030731 Ga0316177_1201147 Ga0316177_12011473 109
223 3300030742 Ga0316183_1007655 Ga0316183_10076558 109
224 3300030744 Ga0316181_1013171 Ga0316181_101317111 109
225 3300030744 Ga0316181_1152293 Ga0316181_11522931 109
226 3300030745 Ga0316182_1078015 Ga0316182_10780152 109
227 3300031251 Ga0265327_10239445 Ga0265327_102394452 109
228 3300031507 Ga0307509_10592645 Ga0307509_105926451 109
229 3300031548 Ga0307408_100001128 Ga0307408_10000112818 109
230 3300031548 Ga0307408_100001444 Ga0307408_10000144412 109
231 3300031731 Ga0307405_10548721 Ga0307405_105487212 109
232 3300031824 Ga0307413_10036639 Ga0307413_100366392 109
233 3300031911 Ga0307412_10001170 Ga0307412_100011709 109
234 3300031911 Ga0307412_11494550 Ga0307412_114945501 109
235 3300031995 Ga0307409_100507066 Ga0307409_1005070662 109
236 3300032002 Ga0307416_100039708 Ga0307416_1000397083 109
237 3300032004 Ga0307414_10017087 Ga0307414_100170872 109
238 3300032004 Ga0307414_10028488 Ga0307414_100284884 109
239 3300033180 Ga0307510_10005630 Ga0307510_1000563012 109
240 3300037312 Ga0395899_0000434 Ga0395899_0000434_12123_12452 109
241 3300037312 Ga0395899_0000751 Ga0395899_0000751_10366_10695 109
242 3300037418 Ga0395900_0000153 Ga0395900_0000153_28064_28393 109
243 3300037418 Ga0395900_1008500 Ga0395900_1008500_397_726 109
244 3300037466 Ga0395898_0078437 Ga0395898_0078437_447_776 109
245 3300037471 Ga0395905_0003545 Ga0395905_0003545_11001_11330 109
246 3300038443 Ga0395901_0000330 Ga0395901_0000330_31531_31860 109
247 3300041404 Ga0439436_0081900 Ga0439436_0081900_321_650 109
248 3300041443 Ga0451789_0716494 Ga0451789_0716494_180_509 109
249 3300042012 Ga0439455_0077145 Ga0439455_0077145_440_769 109
250 3300042014 Ga0439457_013754 Ga0439457_013754_558_887 109
251 3300042145 Ga0450906_087677 Ga0450906_087677_29_358 109
252 3300044656 Ga0466969_0014294 Ga0466969_0014294_3016_3345 109
253 3300044684 Ga0466966_0003138 Ga0466966_0003138_7746_8075 109
254 3300044693 Ga0466961_0054087 Ga0466961_0054087_2046_2375 109
255 3300044693 Ga0466961_0315933 Ga0466961_0315933_504_833 109
256 3300046471 Ga0495650_0000050 Ga0495650_0000050_250841_251170 109
257 3300046492 Ga0495585_0000167 Ga0495585_0000167_51934_52263 109
258 3300046500 Ga0495596_0263693 Ga0495596_0263693_209_538 109
259 3300046506 Ga0495583_0169627 Ga0495583_0169627_225_554 109
260 3300046507 Ga0495606_0000036 Ga0495606_0000036_790_1119 109
261 3300046512 Ga0495610_0001572 Ga0495610_0001572_18868_19197 109
262 3300046513 Ga0495616_0000271 Ga0495616_0000271_29290_29619 109
263 3300046518 Ga0495631_0004810 Ga0495631_0004810_343_672 109
264 3300046518 Ga0495631_0386014 Ga0495631_0386014_112_441 109
265 3300046519 Ga0495632_0041937 Ga0495632_0041937_1055_1384 109
266 3300046520 Ga0495637_0047058 Ga0495637_0047058_485_814 109
267 3300046529 Ga0495652_0831991 Ga0495652_0831991_254_583 109
268 3300046538 Ga0495609_0005232 Ga0495609_0005232_4172_4501 109
269 3300046538 Ga0495609_0008801 Ga0495609_0008801_2472_2801 109
270 3300046557 Ga0495622_0138466 Ga0495622_0138466_728_1057 109
271 3300046558 Ga0495633_0002805 Ga0495633_0002805_6065_6394 109
272 3300046558 Ga0495633_0108880 Ga0495633_0108880_781_1110 109
273 3300046616 Ga0495668_0094882 Ga0495668_0094882_1172_1501 109
274 3300046660 Ga0495625_0000105 Ga0495625_0000105_15085_15414 109
275 3300046660 Ga0495625_0055219 Ga0495625_0055219_850_1179 109
276 3300046660 Ga0495625_0125478 Ga0495625_0125478_723_1052 109
277 3300046665 Ga0495661_0065499 Ga0495661_0065499_988_1317 109
278 3300046684 Ga0495669_0593725 Ga0495669_0593725_106_435 109
279 3300046692 Ga0495671_0179310 Ga0495671_0179310_670_999 109
280 3300046694 Ga0495649_0000011 Ga0495649_0000011_109527_109856 109
281 3300047323 Ga0495683_0182702 Ga0495683_0182702_585_914 109
282 3300047323 Ga0495683_0211886 Ga0495683_0211886_395_724 109
283 3300047443 Ga0495687_033512 Ga0495687_033512_652_981 109
284 3300047443 Ga0495687_047678 Ga0495687_047678_654_983 109
285 3300047445 Ga0495677_0059332 Ga0495677_0059332_628_957 109
286 3300047446 Ga0495679_069844 Ga0495679_069844_71_400 109
287 3300047447 Ga0495685_281161 Ga0495685_281161_154_483 109
288 3300047469 Ga0495673_0046491 Ga0495673_0046491_66_395 109
289 3300047472 Ga0495686_0008205 Ga0495686_0008205_537_866 109
290 3300047472 Ga0495686_0062033 Ga0495686_0062033_561_890 109
291 3300047472 Ga0495686_0133146 Ga0495686_0133146_867_1196 109
292 3300048925 Ga0496122_0000391 Ga0496122_0000391_75214_75543 109
293 3300048926 Ga0496123_0012360 Ga0496123_0012360_5201_5530 109
294 3300048928 Ga0496125_0123875 Ga0496125_0123875_1442_1771 109
295 3300048929 Ga0496126_0921052 Ga0496126_0921052_64_393 109
296 3300049649 Ga0501198_004789 Ga0501198_004789_136_465 109
297 3300050493 nmdc:mga0k408_2016_c1 nmdc:mga0k408_2016_c1_7336_7665 109
298 3300050493 nmdc:mga0k408_88196_c1 nmdc:mga0k408_88196_c1_385_714 109
299 3300053080 Ga0500635_0003096 Ga0500635_0003096_1415_1744 109
300 3300053080 Ga0500635_0028495 Ga0500635_0028495_1155_1484 109
301 3300053122 Ga0500608_049037 Ga0500608_049037_1137_1466 109
302 3300053122 Ga0500608_052638 Ga0500608_052638_573_902 109
303 3300053125 Ga0500618_000012 Ga0500618_000012_150881_151210 109
304 3300053125 Ga0500618_017964 Ga0500618_017964_823_1152 109
305 3300053130 Ga0500642_0011646 Ga0500642_0011646_2580_2909 109
306 3300053138 Ga0500564_092359 Ga0500564_092359_680_1009 109
307 3300053156 Ga0500622_0000537 Ga0500622_0000537_16611_16940 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

49

99

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

51

97

0.94

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

52

97

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.905 14 95
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.8774 46 84
3irq-assembly1.cif.gz_A crystal structure of a z-z junction 0.8505 25 83
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8497 10 92
7wu0-assembly1.cif.gz_Z cryo-em structure of a human pre-40s ribosomal subunit - state rrp12-b3 0.8398 46 84
ID Description Score Start End Superfamily
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9011 12 96 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8774 46 84 1.10.10.10
af_O53773_1_99_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8708 20 100 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8442 27 84 1.10.10.10
af_O06195_1_80_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8431 25 83 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6I7QJ35-F1-model_v4 ArsR family transcriptional regulator 0.9402 6 99 GO:0003700
GO:0005737
AF-A0A855K488-F1-model_v4 Transcriptional regulator 0.9395 17 99 GO:0003700
AF-B3JHT3-F1-model_v4 Transcriptional regulator, ArsR family 0.9392 6 109 GO:0003700
GO:0005737
AF-A0A7X7A3B6-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9381 8 103 GO:0003700
GO:0005737
AF-A0A0H5BG74-F1-model_v4 Arsenical resistance operon repressor 0.9345 8 100 GO:0003700

Feature Viewer

pLDDT pTM Quality
90.07 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map