F399149

General Info

Members Datasets Scaffolds Average Seq Length
307 194 614 121

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100059745|Ga0075434_1000597454
Length 133
Sequence MTHGEATMDDAGATTGGVTVAYYYRVRWGAVAEFIELFERNHWPILRAQLEEGRFLAVHAATPRFHGDGRADWNFLVTITYRDWAAMEAHSEAEIAARLFPDHERYQAEERRRFELLEAHWDVPLEDHPLPGA

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
92 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
93 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
118 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
119 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
120 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
185 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 9.45
Rhizosphere 87.95
Stem 0
Stem Tuber 0
Unclassified 30.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100059745 3300006871 Bacteria 3791
2 rootH2_10141940 3300003320 Bacteria 1117
3 Ga0070690_101109777 3300005330 Unclassified 628
4 Ga0070670_100799080 3300005331 Unclassified 852
5 Ga0068869_100036266 3300005334 Bacteria 3501
6 Ga0068869_100480072 3300005334 Bacteria 1035
7 Ga0068868_100086432 3300005338 Bacteria 2521
8 Ga0068868_100670825 3300005338 Bacteria 925
9 Ga0070691_10186944 3300005341 Bacteria 1081
10 Ga0070692_10426117 3300005345 Unclassified 844
11 Ga0070668_100468342 3300005347 Unclassified 1086
12 Ga0070668_101973832 3300005347 Unclassified 538
13 Ga0070675_102052767 3300005354 Unclassified 527
14 Ga0070671_101357797 3300005355 Unclassified 627
15 Ga0070674_101408442 3300005356 Unclassified 624
16 Ga0070673_100076714 3300005364 Bacteria 2699
17 Ga0070659_101108442 3300005366 Bacteria 698
18 Ga0070667_100362553 3300005367 Unclassified 1314
19 Ga0070705_100268455 3300005440 Unclassified 1207
20 Ga0070700_100041703 3300005441 Bacteria 2815
21 Ga0070694_100180572 3300005444 Bacteria 1561
22 Ga0070694_101621756 3300005444 Unclassified 549
23 Ga0070708_100000370 3300005445 Bacteria 34049
24 Ga0070708_101837253 3300005445 Bacteria 562
25 Ga0070663_101187150 3300005455 Bacteria 670
26 Ga0070678_100130659 3300005456 Bacteria 1994
27 Ga0070678_100470597 3300005456 Unclassified 1104
28 Ga0070662_100261184 3300005457 Bacteria 1395
29 Ga0070662_100463607 3300005457 Bacteria 1053
30 Ga0070706_100208539 3300005467 Bacteria 1824
31 Ga0070706_100381880 3300005467 Unclassified 1312
32 Ga0070698_100410762 3300005471 Bacteria 1288
33 Ga0070698_101470431 3300005471 Bacteria 632
34 Ga0070698_101714434 3300005471 Unclassified 581
35 Ga0070699_100007517 3300005518 Bacteria 9477
36 Ga0070679_101623218 3300005530 Unclassified 594
37 Ga0070684_101287027 3300005535 Bacteria 688
38 Ga0070686_101485652 3300005544 Bacteria 571
39 Ga0070695_100002217 3300005545 Bacteria 11134
40 Ga0070695_100186392 3300005545 Bacteria 1474
41 Ga0070695_100458579 3300005545 Unclassified 978
42 Ga0070696_100053140 3300005546 Bacteria 2819
43 Ga0070696_100163171 3300005546 Bacteria 1643
44 Ga0070696_101153690 3300005546 Bacteria 653
45 Ga0070704_100009950 3300005549 Bacteria 5773
46 Ga0068854_100869616 3300005578 Unclassified 790
47 Ga0068856_100197684 3300005614 Bacteria 2025
48 Ga0070702_100438264 3300005615 Bacteria 945
49 Ga0070702_101254995 3300005615 Unclassified 600
50 Ga0068859_100446734 3300005617 Bacteria 1389
51 Ga0081455_10849489 3300005937 Bacteria 570
52 Ga0097621_100779487 3300006237 Unclassified 885
53 Ga0097621_102158419 3300006237 Bacteria 533
54 Ga0068871_101031371 3300006358 Bacteria 767
55 Ga0097620_100446762 3300006931 Bacteria 1389
56 Ga0075435_100027985 3300007076 Bacteria 4417
57 Ga0111539_10131212 3300009094 Bacteria 2934
58 Ga0111539_10190317 3300009094 Unclassified 2394
59 Ga0105245_10062415 3300009098 Bacteria 3362
60 Ga0105245_10095421 3300009098 Bacteria 2744
61 Ga0105245_11175623 3300009098 Unclassified 815
62 Ga0105245_12193496 3300009098 Unclassified 606
63 Ga0105247_10164003 3300009101 Bacteria 1473
64 Ga0114129_10512681 3300009147 Bacteria 1565
65 Ga0105243_10826882 3300009148 Unclassified 915
66 Ga0105243_11155563 3300009148 Unclassified 785
67 Ga0105243_12545585 3300009148 Bacteria 551
68 Ga0105241_10431230 3300009174 Bacteria 1162
69 Ga0105242_10346404 3300009176 Bacteria 1371
70 Ga0105242_12192801 3300009176 Bacteria 597
71 Ga0105242_13103108 3300009176 Unclassified 515
72 Ga0105248_11542196 3300009177 Unclassified 752
73 Ga0105248_12648385 3300009177 Unclassified 572
74 Ga0105238_10954751 3300009551 Bacteria 877
75 Ga0105249_10501000 3300009553 Unclassified 1260
76 Ga0105249_11280034 3300009553 Unclassified 805
77 Ga0105249_12132878 3300009553 Unclassified 633
78 Ga0105239_10227979 3300010375 Unclassified 2090
79 Ga0105239_10422240 3300010375 Bacteria 1511
80 Ga0105239_13416008 3300010375 Bacteria 516
81 Ga0105246_11746102 3300011119 Unclassified 593
82 Ga0105246_11798723 3300011119 Unclassified 585
83 Ga0105246_12004197 3300011119 Bacteria 559
84 Ga0157338_1018776 3300012515 Unclassified 786
85 Ga0157374_10457744 3300013296 Unclassified 1278
86 Ga0157374_11405169 3300013296 Bacteria 721
87 Ga0157378_10491622 3300013297 Bacteria 1224
88 Ga0157378_10801030 3300013297 Unclassified 968
89 Ga0157375_10138976 3300013308 Bacteria 2555
90 Ga0163163_10032222 3300014325 Bacteria 5062
91 Ga0163163_10042024 3300014325 Bacteria 4474
92 Ga0163163_10659066 3300014325 Unclassified 1110
93 Ga0157380_11278265 3300014326 Unclassified 780
94 Ga0157380_12912671 3300014326 Unclassified 545
95 Ga0157377_10737083 3300014745 Unclassified 720
96 Ga0157377_11200751 3300014745 Bacteria 587
97 Ga0157379_10187870 3300014968 Bacteria 1867
98 Ga0157379_11569219 3300014968 Unclassified 642
99 Ga0157376_10322735 3300014969 Bacteria 1468
100 Ga0157376_11719585 3300014969 Unclassified 663
101 Ga0163161_10242982 3300017792 Unclassified 1401
102 Ga0163161_11619246 3300017792 Bacteria 571
103 Ga0207645_10264921 3300025907 Unclassified 1139
104 Ga0207684_10099857 3300025910 Unclassified 2479
105 Ga0207654_11085122 3300025911 Unclassified 583
106 Ga0207646_10481098 3300025922 Bacteria 1119
107 Ga0207650_10506088 3300025925 Bacteria 1010
108 Ga0207687_10237594 3300025927 Bacteria 1442
109 Ga0207687_10828750 3300025927 Unclassified 790
110 Ga0207687_10850706 3300025927 Unclassified 779
111 Ga0207690_10436326 3300025932 Bacteria 1050
112 Ga0207706_10453057 3300025933 Bacteria 1110
113 Ga0207686_10376257 3300025934 Bacteria 1076
114 Ga0207669_10807793 3300025937 Bacteria 778
115 Ga0207669_11436412 3300025937 Bacteria 588
116 Ga0207711_10894612 3300025941 Unclassified 825
117 Ga0207689_10031415 3300025942 Bacteria 4421
118 Ga0207689_10417580 3300025942 Unclassified 1119
119 Ga0207661_10441321 3300025944 Bacteria 1185
120 Ga0207712_12146597 3300025961 Unclassified 500
121 Ga0207668_10871254 3300025972 Unclassified 800
122 Ga0207640_10272822 3300025981 Bacteria 1324
123 Ga0207658_10714670 3300025986 Bacteria 906
124 Ga0207677_10602892 3300026023 Bacteria 964
125 Ga0207703_11200970 3300026035 Unclassified 729
126 Ga0207678_10940254 3300026067 Bacteria 765
127 Ga0207678_11215605 3300026067 Unclassified 667
128 Ga0207708_10570566 3300026075 Unclassified 956
129 Ga0207702_10412521 3300026078 Unclassified 1304
130 Ga0207648_10396235 3300026089 Unclassified 1250
131 Ga0207648_11984201 3300026089 Unclassified 543
132 Ga0207676_10231219 3300026095 Bacteria 1653
133 Ga0207674_11212360 3300026116 Bacteria 724
134 Ga0207675_100174326 3300026118 Bacteria 2057
135 Ga0207683_10580554 3300026121 Unclassified 1037
136 Ga0207683_11773804 3300026121 Unclassified 566
137 Ga0268264_11647412 3300028381 Unclassified 652
138 Ga0268264_11745430 3300028381 Bacteria 633
139 Ga0265319_1002851 3300028563 Bacteria 9242
140 Ga0265334_10019588 3300028573 Bacteria 2781
141 Ga0265334_10028851 3300028573 Bacteria 2226
142 Ga0265318_10029054 3300028577 Bacteria 2157
143 Ga0265322_10060016 3300028654 Bacteria 1079
144 Ga0265338_10093443 3300028800 Bacteria 2478
145 Ga0265324_10012176 3300029957 Bacteria 3253
146 Ga0265324_10020682 3300029957 Bacteria 2363
147 Ga0265324_10120996 3300029957 Bacteria 889
148 Ga0265330_10155740 3300031235 Bacteria 970
149 Ga0265328_10027080 3300031239 Bacteria 2151
150 Ga0265320_10001605 3300031240 Bacteria 16214
151 Ga0265320_10037478 3300031240 Bacteria 2441
152 Ga0265325_10016992 3300031241 Bacteria 4055
153 Ga0265325_10422205 3300031241 Unclassified 583
154 Ga0265329_10004251 3300031242 Bacteria 6013
155 Ga0265329_10025855 3300031242 Bacteria 1938
156 Ga0265340_10006527 3300031247 Bacteria 6411
157 Ga0265339_10073089 3300031249 Bacteria 1824
158 Ga0265339_10170183 3300031249 Bacteria 1091
159 Ga0265331_10131261 3300031250 Bacteria 1143
160 Ga0265331_10172711 3300031250 Unclassified 978
161 Ga0265331_10181749 3300031250 Bacteria 950
162 Ga0265316_10060889 3300031344 Bacteria 2933
163 Ga0265316_10068493 3300031344 Bacteria 2741
164 Ga0265313_10035741 3300031595 Bacteria 2499
165 Ga0265313_10109475 3300031595 Bacteria 1216
166 Ga0265314_10049745 3300031711 Bacteria 2932
167 Ga0265342_10112840 3300031712 Bacteria 1537
168 Ga0265342_10157861 3300031712 Unclassified 1255
169 Ga0265342_10202753 3300031712 Bacteria 1077
170 Ga0307409_101298714 3300031995 Unclassified 753
171 Ga0307416_103126652 3300032002 Unclassified 554
172 Ga0373945_0291385 3300035116 Bacteria 697
173 Ga0316574_0465647 3300035398 Bacteria 791
174 Ga0373937_0314612 3300036401 Bacteria 1481
175 Ga0373937_1274860 3300036401 Unclassified 683
176 Ga0316582_0432436 3300036647 Bacteria 907
177 Ga0316582_1074664 3300036647 Bacteria 549
178 Ga0373925_0063613 3300037068 Bacteria 2776
179 Ga0395900_1862977 3300037418 Unclassified 512
180 Ga0451800_1091793 3300041459 Bacteria 762
181 Ga0451833_0553577 3300041491 Bacteria 586
182 Ga0451835_0580903 3300041492 Bacteria 879
183 Ga0451835_0709510 3300041492 Unclassified 548
184 Ga0451855_0378214 3300041511 Bacteria 504
185 Ga0451853_0047592 3300041512 Bacteria 1228
186 Ga0451853_1578111 3300041512 Unclassified 537
187 Ga0450910_066930 3300042147 Bacteria 613
188 Ga0453684_0940609 3300044712 Bacteria 923
189 Ga0495592_0029892 3300046454 Bacteria 4122
190 Ga0495603_0278746 3300046455 Bacteria 961
191 Ga0495653_0269585 3300046463 Bacteria 1122
192 Ga0495608_0262090 3300046511 Bacteria 1076
193 Ga0495618_0042901 3300046514 Bacteria 2853
194 Ga0495628_0038846 3300046516 Bacteria 3808
195 Ga0495628_0782000 3300046516 Unclassified 669
196 Ga0495630_1217859 3300046517 Bacteria 569
197 Ga0495640_0314191 3300046533 Bacteria 971
198 Ga0495640_0662196 3300046533 Bacteria 628
199 Ga0495640_0808226 3300046533 Unclassified 559
200 Ga0495586_0718914 3300046535 Bacteria 577
201 Ga0495667_0142523 3300046559 Bacteria 1544
202 Ga0495667_0931575 3300046559 Unclassified 532
203 Ga0495634_0015338 3300046642 Bacteria 5508
204 Ga0495599_0274654 3300046678 Unclassified 1022
205 Ga0495613_0489049 3300046689 Bacteria 830
206 Ga0495600_0192704 3300046809 Bacteria 1310
207 Ga0495674_0412205 3300047319 Bacteria 1089
208 Ga0495674_0422360 3300047319 Bacteria 1074
209 Ga0495674_0432748 3300047319 Bacteria 1059
210 Ga0495674_0993119 3300047319 Bacteria 644
211 Ga0495676_0165459 3300047321 Bacteria 1561
212 Ga0495684_0881888 3300047471 Unclassified 578
213 Ga0495614_0393617 3300048089 Bacteria 650
214 Ga0496101_0716934 3300048904 Bacteria 790
215 Ga0496101_1064422 3300048904 Unclassified 635
216 Ga0496102_0075748 3300048905 Bacteria 3093
217 Ga0496102_1465661 3300048905 Unclassified 601
218 Ga0496103_0070066 3300048906 Bacteria 2193
219 Ga0496104_0112602 3300048907 Bacteria 2609
220 Ga0496104_0164390 3300048907 Bacteria 2128
221 Ga0496105_0029057 3300048908 Bacteria 4524
222 Ga0496105_0337559 3300048908 Bacteria 1205
223 Ga0496106_0061168 3300048909 Bacteria 2856
224 Ga0496106_0373060 3300048909 Bacteria 1147
225 Ga0496106_0589276 3300048909 Bacteria 891
226 Ga0496107_0087392 3300048910 Bacteria 2276
227 Ga0496107_0412906 3300048910 Bacteria 1004
228 Ga0496108_0027915 3300048911 Bacteria 4666
229 Ga0496108_0137241 3300048911 Bacteria 2105
230 Ga0496109_0036714 3300048912 Unclassified 4424
231 Ga0496109_0045281 3300048912 Bacteria 3991
232 Ga0496109_0104461 3300048912 Bacteria 2630
233 Ga0496110_0006363 3300048913 Bacteria 9335
234 Ga0496111_0030787 3300048914 Bacteria 3817
235 Ga0496111_0084633 3300048914 Bacteria 2318
236 Ga0496112_0096943 3300048915 Bacteria 2919
237 Ga0496112_0135783 3300048915 Bacteria 2430
238 Ga0496112_0663714 3300048915 Bacteria 972
239 Ga0496113_0001622 3300048916 Bacteria 12664
240 Ga0496113_0020653 3300048916 Bacteria 4635
241 Ga0496114_1011382 3300048917 Bacteria 715
242 Ga0501031_0431653 3300049568 Bacteria 851
243 Ga0501031_0624085 3300049568 Unclassified 693
244 Ga0501032_0798155 3300049569 Bacteria 596
245 Ga0501036_0104233 3300049572 Bacteria 2399
246 Ga0501036_0173021 3300049572 Unclassified 1819
247 Ga0501037_0253948 3300049573 Bacteria 1230
248 Ga0501039_0031343 3300049575 Bacteria 4099
249 Ga0501039_0339180 3300049575 Bacteria 1181
250 Ga0501039_0594491 3300049575 Bacteria 867
251 Ga0501040_0113544 3300049576 Unclassified 1895
252 Ga0501040_0312352 3300049576 Bacteria 1124
253 Ga0501041_0062368 3300049577 Bacteria 2282
254 Ga0501041_0269049 3300049577 Bacteria 1072
255 Ga0501042_0295672 3300049578 Bacteria 1170
256 Ga0501046_0246664 3300049580 Bacteria 1316
257 Ga0501048_0134436 3300049582 Bacteria 1747
258 Ga0501068_0297478 3300049584 Unclassified 1033
259 Ga0501068_0588215 3300049584 Unclassified 725
260 Ga0501069_0511108 3300049585 Bacteria 717
261 Ga0501071_0056560 3300049587 Bacteria 2834
262 Ga0501071_0213585 3300049587 Bacteria 1451
263 Ga0501071_0838199 3300049587 Unclassified 709
264 Ga0501072_0041899 3300049588 Bacteria 3596
265 Ga0501073_0631574 3300049589 Bacteria 739
266 Ga0501074_0208670 3300049590 Bacteria 1392
267 Ga0501074_0793808 3300049590 Bacteria 667
268 Ga0501075_0015453 3300049591 Bacteria 5479
269 Ga0501075_0141393 3300049591 Bacteria 1834
270 Ga0501075_0914263 3300049591 Unclassified 667
271 Ga0501076_0075745 3300049592 Bacteria 2697
272 Ga0501076_0211073 3300049592 Bacteria 1586
273 Ga0501076_0347543 3300049592 Unclassified 1218
274 Ga0501076_0883877 3300049592 Unclassified 737
275 Ga0501077_0055212 3300049593 Bacteria 2522
276 Ga0501077_0412804 3300049593 Unclassified 863
277 Ga0501077_0993232 3300049593 Unclassified 540
278 Ga0501079_0269056 3300049741 Bacteria 1332
279 Ga0501080_1011295 3300049742 Unclassified 721
280 Ga0501080_1260469 3300049742 Bacteria 634
281 Ga0501081_0448765 3300049743 Bacteria 958
282 Ga0501083_0269736 3300049744 Bacteria 1107
283 Ga0501045_0009805 3300049824 Bacteria 6701
284 Ga0501045_0160702 3300049824 Bacteria 1672
285 nmdc:mga0yw44_372510_c1 3300050492 Bacteria 963
286 nmdc:mga05p37_261135_c1 3300050507 Bacteria 2072
287 nmdc:mga08y16_290844_c1 3300050511 Bacteria 1684
288 nmdc:mga08y16_294374_c1 3300050511 Bacteria 1673
289 nmdc:mga08y16_911343_c1 3300050511 Unclassified 864
290 nmdc:mga0n895_82482_c1 3300050512 Bacteria 3205
291 nmdc:mga0rr50_182472_c1 3300050513 Unclassified 1716
292 nmdc:mga0rr50_636954_c1 3300050513 Unclassified 909
293 nmdc:mga08x19_417278_c1 3300050514 Unclassified 942
294 Ga0495601_0011972 3300053077 Bacteria 5197
295 Ga0495601_0371089 3300053077 Bacteria 929
296 Ga0495601_0684404 3300053077 Bacteria 655
297 Ga0495595_0005285 3300053084 Bacteria 5221
298 Ga0495619_0061706 3300053085 Bacteria 2494
299 Ga0501084_0011161 3300054114 Bacteria 7442
300 Ga0501084_1691410 3300054114 Bacteria 529
301 Ga0590071_015391 3300059421 Bacteria 1793
302 Ga0590074_003636 3300059423 Bacteria 2551
303 Ga0590075_039485 3300059424 Bacteria 1204
304 Ga0501082_0284655 3300060353 Bacteria 1439
305 Ga0530510_0277819 3300061734 Bacteria 1251
306 Ga0530510_0429674 3300061734 Bacteria 997
307 Ga0530510_1025171 3300061734 Unclassified 632
308 Ga0075434_100059745
309 rootH2_10141940
310 Ga0070690_101109777
311 Ga0070670_100799080
312 Ga0068869_100036266
313 Ga0068869_100480072
314 Ga0068868_100086432
315 Ga0068868_100670825
316 Ga0070691_10186944
317 Ga0070692_10426117
318 Ga0070668_100468342
319 Ga0070668_101973832
320 Ga0070675_102052767
321 Ga0070671_101357797
322 Ga0070674_101408442
323 Ga0070673_100076714
324 Ga0070659_101108442
325 Ga0070667_100362553
326 Ga0070705_100268455
327 Ga0070700_100041703
328 Ga0070694_100180572
329 Ga0070694_101621756
330 Ga0070708_100000370
331 Ga0070708_101837253
332 Ga0070663_101187150
333 Ga0070678_100130659
334 Ga0070678_100470597
335 Ga0070662_100261184
336 Ga0070662_100463607
337 Ga0070706_100208539
338 Ga0070706_100381880
339 Ga0070698_100410762
340 Ga0070698_101470431
341 Ga0070698_101714434
342 Ga0070699_100007517
343 Ga0070679_101623218
344 Ga0070684_101287027
345 Ga0070686_101485652
346 Ga0070695_100002217
347 Ga0070695_100186392
348 Ga0070695_100458579
349 Ga0070696_100053140
350 Ga0070696_100163171
351 Ga0070696_101153690
352 Ga0070704_100009950
353 Ga0068854_100869616
354 Ga0068856_100197684
355 Ga0070702_100438264
356 Ga0070702_101254995
357 Ga0068859_100446734
358 Ga0081455_10849489
359 Ga0097621_100779487
360 Ga0097621_102158419
361 Ga0068871_101031371
362 Ga0097620_100446762
363 Ga0075435_100027985
364 Ga0111539_10131212
365 Ga0111539_10190317
366 Ga0105245_10062415
367 Ga0105245_10095421
368 Ga0105245_11175623
369 Ga0105245_12193496
370 Ga0105247_10164003
371 Ga0114129_10512681
372 Ga0105243_10826882
373 Ga0105243_11155563
374 Ga0105243_12545585
375 Ga0105241_10431230
376 Ga0105242_10346404
377 Ga0105242_12192801
378 Ga0105242_13103108
379 Ga0105248_11542196
380 Ga0105248_12648385
381 Ga0105238_10954751
382 Ga0105249_10501000
383 Ga0105249_11280034
384 Ga0105249_12132878
385 Ga0105239_10227979
386 Ga0105239_10422240
387 Ga0105239_13416008
388 Ga0105246_11746102
389 Ga0105246_11798723
390 Ga0105246_12004197
391 Ga0157338_1018776
392 Ga0157374_10457744
393 Ga0157374_11405169
394 Ga0157378_10491622
395 Ga0157378_10801030
396 Ga0157375_10138976
397 Ga0163163_10032222
398 Ga0163163_10042024
399 Ga0163163_10659066
400 Ga0157380_11278265
401 Ga0157380_12912671
402 Ga0157377_10737083
403 Ga0157377_11200751
404 Ga0157379_10187870
405 Ga0157379_11569219
406 Ga0157376_10322735
407 Ga0157376_11719585
408 Ga0163161_10242982
409 Ga0163161_11619246
410 Ga0207645_10264921
411 Ga0207684_10099857
412 Ga0207654_11085122
413 Ga0207646_10481098
414 Ga0207650_10506088
415 Ga0207687_10237594
416 Ga0207687_10828750
417 Ga0207687_10850706
418 Ga0207690_10436326
419 Ga0207706_10453057
420 Ga0207686_10376257
421 Ga0207669_10807793
422 Ga0207669_11436412
423 Ga0207711_10894612
424 Ga0207689_10031415
425 Ga0207689_10417580
426 Ga0207661_10441321
427 Ga0207712_12146597
428 Ga0207668_10871254
429 Ga0207640_10272822
430 Ga0207658_10714670
431 Ga0207677_10602892
432 Ga0207703_11200970
433 Ga0207678_10940254
434 Ga0207678_11215605
435 Ga0207708_10570566
436 Ga0207702_10412521
437 Ga0207648_10396235
438 Ga0207648_11984201
439 Ga0207676_10231219
440 Ga0207674_11212360
441 Ga0207675_100174326
442 Ga0207683_10580554
443 Ga0207683_11773804
444 Ga0268264_11647412
445 Ga0268264_11745430
446 Ga0265319_1002851
447 Ga0265334_10019588
448 Ga0265334_10028851
449 Ga0265318_10029054
450 Ga0265322_10060016
451 Ga0265338_10093443
452 Ga0265324_10012176
453 Ga0265324_10020682
454 Ga0265324_10120996
455 Ga0265330_10155740
456 Ga0265328_10027080
457 Ga0265320_10001605
458 Ga0265320_10037478
459 Ga0265325_10016992
460 Ga0265325_10422205
461 Ga0265329_10004251
462 Ga0265329_10025855
463 Ga0265340_10006527
464 Ga0265339_10073089
465 Ga0265339_10170183
466 Ga0265331_10131261
467 Ga0265331_10172711
468 Ga0265331_10181749
469 Ga0265316_10060889
470 Ga0265316_10068493
471 Ga0265313_10035741
472 Ga0265313_10109475
473 Ga0265314_10049745
474 Ga0265342_10112840
475 Ga0265342_10157861
476 Ga0265342_10202753
477 Ga0307409_101298714
478 Ga0307416_103126652
479 Ga0373945_0291385
480 Ga0316574_0465647
481 Ga0373937_0314612
482 Ga0373937_1274860
483 Ga0316582_0432436
484 Ga0316582_1074664
485 Ga0373925_0063613
486 Ga0395900_1862977
487 Ga0451800_1091793
488 Ga0451833_0553577
489 Ga0451835_0580903
490 Ga0451835_0709510
491 Ga0451855_0378214
492 Ga0451853_0047592
493 Ga0451853_1578111
494 Ga0450910_066930
495 Ga0453684_0940609
496 Ga0495592_0029892
497 Ga0495603_0278746
498 Ga0495653_0269585
499 Ga0495608_0262090
500 Ga0495618_0042901
501 Ga0495628_0038846
502 Ga0495628_0782000
503 Ga0495630_1217859
504 Ga0495640_0314191
505 Ga0495640_0662196
506 Ga0495640_0808226
507 Ga0495586_0718914
508 Ga0495667_0142523
509 Ga0495667_0931575
510 Ga0495634_0015338
511 Ga0495599_0274654
512 Ga0495613_0489049
513 Ga0495600_0192704
514 Ga0495674_0412205
515 Ga0495674_0422360
516 Ga0495674_0432748
517 Ga0495674_0993119
518 Ga0495676_0165459
519 Ga0495684_0881888
520 Ga0495614_0393617
521 Ga0496101_0716934
522 Ga0496101_1064422
523 Ga0496102_0075748
524 Ga0496102_1465661
525 Ga0496103_0070066
526 Ga0496104_0112602
527 Ga0496104_0164390
528 Ga0496105_0029057
529 Ga0496105_0337559
530 Ga0496106_0061168
531 Ga0496106_0373060
532 Ga0496106_0589276
533 Ga0496107_0087392
534 Ga0496107_0412906
535 Ga0496108_0027915
536 Ga0496108_0137241
537 Ga0496109_0036714
538 Ga0496109_0045281
539 Ga0496109_0104461
540 Ga0496110_0006363
541 Ga0496111_0030787
542 Ga0496111_0084633
543 Ga0496112_0096943
544 Ga0496112_0135783
545 Ga0496112_0663714
546 Ga0496113_0001622
547 Ga0496113_0020653
548 Ga0496114_1011382
549 Ga0501031_0431653
550 Ga0501031_0624085
551 Ga0501032_0798155
552 Ga0501036_0104233
553 Ga0501036_0173021
554 Ga0501037_0253948
555 Ga0501039_0031343
556 Ga0501039_0339180
557 Ga0501039_0594491
558 Ga0501040_0113544
559 Ga0501040_0312352
560 Ga0501041_0062368
561 Ga0501041_0269049
562 Ga0501042_0295672
563 Ga0501046_0246664
564 Ga0501048_0134436
565 Ga0501068_0297478
566 Ga0501068_0588215
567 Ga0501069_0511108
568 Ga0501071_0056560
569 Ga0501071_0213585
570 Ga0501071_0838199
571 Ga0501072_0041899
572 Ga0501073_0631574
573 Ga0501074_0208670
574 Ga0501074_0793808
575 Ga0501075_0015453
576 Ga0501075_0141393
577 Ga0501075_0914263
578 Ga0501076_0075745
579 Ga0501076_0211073
580 Ga0501076_0347543
581 Ga0501076_0883877
582 Ga0501077_0055212
583 Ga0501077_0412804
584 Ga0501077_0993232
585 Ga0501079_0269056
586 Ga0501080_1011295
587 Ga0501080_1260469
588 Ga0501081_0448765
589 Ga0501083_0269736
590 Ga0501045_0009805
591 Ga0501045_0160702
592 nmdc:mga0yw44_372510_c1
593 nmdc:mga05p37_261135_c1
594 nmdc:mga08y16_290844_c1
595 nmdc:mga08y16_294374_c1
596 nmdc:mga08y16_911343_c1
597 nmdc:mga0n895_82482_c1
598 nmdc:mga0rr50_182472_c1
599 nmdc:mga0rr50_636954_c1
600 nmdc:mga08x19_417278_c1
601 Ga0495601_0011972
602 Ga0495601_0371089
603 Ga0495601_0684404
604 Ga0495595_0005285
605 Ga0495619_0061706
606 Ga0501084_0011161
607 Ga0501084_1691410
608 Ga0590071_015391
609 Ga0590074_003636
610 Ga0590075_039485
611 Ga0501082_0284655
612 Ga0530510_0277819
613 Ga0530510_0429674
614 Ga0530510_1025171

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.7499 2 116
1x7v-assembly3.cif.gz_C crystal structure of pa3566 from pseudomonas aeruginosa 0.7484 1 116
4zos-assembly2.cif.gz_B 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] 0.7432 2 116
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.7404 1 111
2bbe-assembly1.cif.gz_A crystal structure of protein so0527 from shewanella oneidensis 0.7397 1 112
ID Description Score Start End Superfamily
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7499 2 116 3.30.70.100
4zosB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7432 2 116 3.30.70.100
1x7vB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7422 1 116 3.30.70.100
2bbeA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7397 1 112 3.30.70.100
1x7vB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7355 1 116 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V8DET8-F1-model_v4 EthD domain-containing protein 0.9537 2 116
AF-A0A1F2TD55-F1-model_v4 EthD domain-containing protein 0.9507 2 117
AF-A0A2V7VQM4-F1-model_v4 NIPSNAP domain-containing protein 0.9479 3 119
AF-A0A535IVW3-F1-model_v4 EthD family reductase 0.9469 2 120
AF-A0A522P6S2-F1-model_v4 Uncharacterized protein 0.9404 1 119

Map