F399115

General Info

Members Datasets Scaffolds Average Seq Length
307 143 614 195

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10000625|Ga0081538_1000062512
Length 221
Sequence MTTPTIGVLALQGDVREHLRMLTGAGATAVPIRRPDELAAVDGLVLPGGESTTMHKLAVAFDLFEPLRERIRDGMPAFGTCAGMILLADRIEGGIEGQETLGGLDITVRRNAFGRQVDSFEADLDFAAFDSPFHAVLIRAPWVEKVGAGVEVLARIGSGPDAGRIVAVRQGPVLATSFHPEISGDDRLHRHFVSLARAEQLSAEQDDAGGYSAEQPSAEQS

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
66 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
89 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
90 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2643221576 Nocardioides sp. Root614 Isolate Unclassified
137 2643221590 Nocardioides sp. Root682 Isolate Unclassified
138 2643221615 Nocardioides sp. Root224 Isolate Unclassified
139 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
140 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
141 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
142 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
143 2895427314 Nonomuraea sp. PA05 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0.33
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 2.93
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10000625 3300005981 Bacteria 39268
2 LJQas_1002076 3300000549 Bacteria 2855
3 JGI24739J22299_10015334 3300001989 Bacteria 2782
4 JGI24737J22298_10006431 3300001990 Bacteria 4013
5 JGI24735J21928_10017305 3300002067 Bacteria 2230
6 Ga0070658_10658177 3300005327 Bacteria 909
7 Ga0070683_100003420 3300005329 Bacteria 12879
8 Ga0070683_100281863 3300005329 Bacteria 1581
9 Ga0070660_100024020 3300005339 Bacteria 4521
10 Ga0070668_100060527 3300005347 Bacteria 2932
11 Ga0070714_100033447 3300005435 Bacteria 4297
12 Ga0070663_100853491 3300005455 Bacteria 784
13 Ga0070678_100692279 3300005456 Bacteria 918
14 Ga0070681_10550369 3300005458 Bacteria 1068
15 Ga0070698_100476472 3300005471 Bacteria 1185
16 Ga0070679_100007194 3300005530 Bacteria 10395
17 Ga0070684_100336321 3300005535 Bacteria 1388
18 Ga0070684_100552510 3300005535 Bacteria 1069
19 Ga0070672_100430213 3300005543 Bacteria 1135
20 Ga0070686_100264247 3300005544 Bacteria 1263
21 Ga0070665_100000863 3300005548 Bacteria 39318
22 Ga0068857_100262791 3300005577 Bacteria 1584
23 Ga0068857_100344733 3300005577 Bacteria 1379
24 Ga0068852_100297352 3300005616 Bacteria 1561
25 Ga0068860_100000783 3300005843 Bacteria 35732
26 Ga0081455_10000909 3300005937 Bacteria 37956
27 Ga0081455_10002872 3300005937 Bacteria 20284
28 Ga0081455_10004987 3300005937 Bacteria 14686
29 Ga0081538_10123340 3300005981 Bacteria 1239
30 Ga0075365_10063757 3300006038 Bacteria 2467
31 Ga0075365_10265407 3300006038 Bacteria 1207
32 Ga0075365_10320646 3300006038 Bacteria 1091
33 Ga0075363_100215988 3300006048 Bacteria 1098
34 Ga0075364_10006724 3300006051 Bacteria 6778
35 Ga0075364_10369177 3300006051 Bacteria 978
36 Ga0075370_10100733 3300006353 Bacteria 1671
37 Ga0075428_100013613 3300006844 Bacteria 9058
38 Ga0075431_100012961 3300006847 Bacteria 8416
39 Ga0075431_100068576 3300006847 Bacteria 3660
40 Ga0075429_100003297 3300006880 Bacteria 13741
41 Ga0068865_100357502 3300006881 Bacteria 1185
42 Ga0111539_10005975 3300009094 Bacteria 15725
43 Ga0105245_10353409 3300009098 Bacteria 1457
44 Ga0105245_11071897 3300009098 Bacteria 852
45 Ga0114129_10023562 3300009147 Bacteria 8725
46 Ga0105248_11079970 3300009177 Bacteria 907
47 Ga0105238_11181869 3300009551 Bacteria 789
48 Ga0105239_10004560 3300010375 Bacteria 16514
49 Ga0105239_10298356 3300010375 Bacteria 1814
50 Ga0157369_11044837 3300013105 Bacteria 836
51 Ga0163163_10497811 3300014325 Bacteria 1280
52 Ga0207647_10021581 3300025904 Bacteria 4297
53 Ga0207671_10065114 3300025914 Bacteria 2710
54 Ga0207687_10265742 3300025927 Bacteria 1369
55 Ga0207687_10291628 3300025927 Bacteria 1311
56 Ga0207664_10125154 3300025929 Bacteria 2157
57 Ga0207686_10280509 3300025934 Bacteria 1230
58 Ga0207704_10278657 3300025938 Bacteria 1270
59 Ga0207661_10022171 3300025944 Bacteria 4777
60 Ga0207651_10448974 3300025960 Bacteria 1106
61 Ga0207668_10101794 3300025972 Bacteria 2136
62 Ga0207658_10236089 3300025986 Bacteria 1546
63 Ga0207703_10677578 3300026035 Bacteria 980
64 Ga0207674_10252496 3300026116 Bacteria 1711
65 Ga0207675_100316746 3300026118 Bacteria 1522
66 Ga0207683_10153767 3300026121 Bacteria 2077
67 Ga0207698_10685254 3300026142 Bacteria 1018
68 Ga0207428_10026441 3300027907 Bacteria 4844
69 Ga0268266_10003878 3300028379 Bacteria 14576
70 Ga0268264_10000576 3300028381 Bacteria 44482
71 Ga0265760_10099331 3300031090 Bacteria 919
72 Ga0307409_100849700 3300031995 Bacteria 923
73 Ga0307416_100742740 3300032002 Bacteria 1073
74 Ga0307411_10402541 3300032005 Bacteria 1132
75 Ga0307415_100158626 3300032126 Bacteria 1751
76 Ga0307415_100375372 3300032126 Bacteria 1205
77 Ga0395900_0636716 3300037418 Bacteria 1004
78 Ga0395898_0643986 3300037466 Bacteria 1002
79 Ga0451833_1146284 3300041491 Bacteria 1172
80 Ga0451839_1114179 3300041496 Bacteria 2128
81 Ga0451853_0102815 3300041512 Bacteria 2573
82 Ga0466972_0245483 3300044658 Bacteria 837
83 Ga0466965_0269625 3300044683 Bacteria 917
84 Ga0466966_0213274 3300044684 Bacteria 1166
85 Ga0466961_0083243 3300044693 Bacteria 2023
86 Ga0466963_0151677 3300044694 Bacteria 1609
87 Ga0466963_0163734 3300044694 Bacteria 1549
88 Ga0466964_0030438 3300044706 Bacteria 2136
89 Ga0466971_0081989 3300044719 Bacteria 1472
90 Ga0466970_0120551 3300044765 Bacteria 1436
91 Ga0466957_0328286 3300044842 Bacteria 1033
92 Ga0466960_0033397 3300044901 Bacteria 2391
93 Ga0466960_0173425 3300044901 Bacteria 1165
94 Ga0466960_0298043 3300044901 Bacteria 908
95 Ga0466959_0281331 3300045049 Bacteria 1142
96 Ga0466958_0088974 3300045836 Bacteria 1908
97 Ga0466967_0032685 3300045976 Bacteria 4396
98 Ga0466967_0409142 3300045976 Bacteria 1321
99 Ga0466967_0560825 3300045976 Bacteria 1125
100 Ga0495585_0052316 3300046492 Bacteria 2261
101 Ga0496100_0079514 3300048903 Bacteria 2210
102 Ga0496102_0338540 3300048905 Bacteria 1417
103 Ga0496103_0482646 3300048906 Bacteria 794
104 Ga0496104_0605159 3300048907 Bacteria 1006
105 Ga0496109_1171351 3300048912 Bacteria 705
106 Ga0496110_0437891 3300048913 Bacteria 1191
107 Ga0496113_0386889 3300048916 Bacteria 1123
108 Ga0496114_0271903 3300048917 Bacteria 1493
109 Ga0496115_0081698 3300048918 Bacteria 2632
110 Ga0501031_0004607 3300049568 Bacteria 8942
111 Ga0501031_0015987 3300049568 Bacteria 4872
112 Ga0501031_0050777 3300049568 Bacteria 2701
113 Ga0501031_0129845 3300049568 Bacteria 1646
114 Ga0501031_0392161 3300049568 Bacteria 898
115 Ga0501031_0495683 3300049568 Bacteria 788
116 Ga0501032_0024826 3300049569 Bacteria 4135
117 Ga0501032_0065832 3300049569 Bacteria 2423
118 Ga0501032_0072795 3300049569 Bacteria 2290
119 Ga0501032_0230327 3300049569 Bacteria 1205
120 Ga0501032_0327135 3300049569 Bacteria 989
121 Ga0501033_0297065 3300049570 Bacteria 1138
122 Ga0501034_0410481 3300049571 Bacteria 1276
123 Ga0501036_0002755 3300049572 Bacteria 13901
124 Ga0501036_0013831 3300049572 Bacteria 6712
125 Ga0501036_0025326 3300049572 Bacteria 5005
126 Ga0501036_0078976 3300049572 Bacteria 2784
127 Ga0501036_0768629 3300049572 Bacteria 794
128 Ga0501037_0347935 3300049573 Bacteria 1023
129 Ga0501037_0370849 3300049573 Bacteria 985
130 Ga0501038_0025903 3300049574 Bacteria 5224
131 Ga0501038_0055008 3300049574 Bacteria 3421
132 Ga0501038_0343448 3300049574 Bacteria 1164
133 Ga0501039_0005445 3300049575 Bacteria 9625
134 Ga0501039_0007697 3300049575 Bacteria 8226
135 Ga0501039_0019109 3300049575 Bacteria 5257
136 Ga0501039_0145357 3300049575 Bacteria 1863
137 Ga0501039_0184101 3300049575 Bacteria 1642
138 Ga0501039_0842585 3300049575 Bacteria 715
139 Ga0501040_0005604 3300049576 Bacteria 8113
140 Ga0501040_0017845 3300049576 Bacteria 4711
141 Ga0501040_0037725 3300049576 Bacteria 3284
142 Ga0501040_0064560 3300049576 Bacteria 2520
143 Ga0501040_0085147 3300049576 Bacteria 2194
144 Ga0501040_0087337 3300049576 Bacteria 2165
145 Ga0501040_0236184 3300049576 Bacteria 1302
146 Ga0501041_0001615 3300049577 Bacteria 12579
147 Ga0501041_0012583 3300049577 Bacteria 5011
148 Ga0501041_0013615 3300049577 Bacteria 4823
149 Ga0501041_0033910 3300049577 Bacteria 3089
150 Ga0501041_0190270 3300049577 Bacteria 1285
151 Ga0501041_0205272 3300049577 Bacteria 1236
152 Ga0501041_0264345 3300049577 Bacteria 1082
153 Ga0501041_0312050 3300049577 Bacteria 991
154 Ga0501041_0313733 3300049577 Bacteria 989
155 Ga0501041_0325094 3300049577 Bacteria 970
156 Ga0501042_0000476 3300049578 Bacteria 20765
157 Ga0501042_0012615 3300049578 Bacteria 5731
158 Ga0501042_0017807 3300049578 Bacteria 4906
159 Ga0501042_0048916 3300049578 Bacteria 3015
160 Ga0501042_0070858 3300049578 Bacteria 2494
161 Ga0501042_0111876 3300049578 Bacteria 1966
162 Ga0501043_0037457 3300049579 Bacteria 3815
163 Ga0501043_0134465 3300049579 Bacteria 1937
164 Ga0501043_0191567 3300049579 Bacteria 1590
165 Ga0501046_0009981 3300049580 Bacteria 8176
166 Ga0501046_0012255 3300049580 Bacteria 7307
167 Ga0501046_0014892 3300049580 Bacteria 6543
168 Ga0501046_0042746 3300049580 Bacteria 3612
169 Ga0501046_0130099 3300049580 Bacteria 1910
170 Ga0501046_0193370 3300049580 Bacteria 1517
171 Ga0501046_0328552 3300049580 Bacteria 1113
172 Ga0501048_0001240 3300049582 Bacteria 19341
173 Ga0501048_0048724 3300049582 Bacteria 3021
174 Ga0501048_0086924 3300049582 Bacteria 2205
175 Ga0501048_0149259 3300049582 Bacteria 1653
176 Ga0501048_0161601 3300049582 Bacteria 1585
177 Ga0501068_0029581 3300049584 Bacteria 3244
178 Ga0501068_0030845 3300049584 Bacteria 3182
179 Ga0501068_0176081 3300049584 Bacteria 1352
180 Ga0501069_0023713 3300049585 Bacteria 3345
181 Ga0501069_0091253 3300049585 Bacteria 1723
182 Ga0501069_0369725 3300049585 Bacteria 846
183 Ga0501069_0409189 3300049585 Bacteria 803
184 Ga0501070_0030280 3300049586 Bacteria 4535
185 Ga0501070_0032903 3300049586 Bacteria 4337
186 Ga0501070_0134336 3300049586 Bacteria 2043
187 Ga0501071_0007243 3300049587 Bacteria 7262
188 Ga0501071_0086954 3300049587 Bacteria 2293
189 Ga0501071_0089225 3300049587 Bacteria 2262
190 Ga0501071_0123472 3300049587 Bacteria 1920
191 Ga0501071_0134543 3300049587 Bacteria 1838
192 Ga0501071_0160876 3300049587 Bacteria 1678
193 Ga0501071_0382645 3300049587 Bacteria 1073
194 Ga0501072_0002074 3300049588 Bacteria 14906
195 Ga0501072_0008879 3300049588 Bacteria 7637
196 Ga0501072_0014957 3300049588 Bacteria 5948
197 Ga0501072_0059790 3300049588 Bacteria 3004
198 Ga0501072_0221308 3300049588 Bacteria 1508
199 Ga0501072_0256158 3300049588 Bacteria 1393
200 Ga0501073_0066149 3300049589 Bacteria 2520
201 Ga0501073_0102278 3300049589 Bacteria 1990
202 Ga0501073_0302368 3300049589 Bacteria 1104
203 Ga0501074_0007736 3300049590 Bacteria 7784
204 Ga0501074_0009132 3300049590 Bacteria 7198
205 Ga0501074_0143394 3300049590 Bacteria 1708
206 Ga0501075_0002938 3300049591 Bacteria 11422
207 Ga0501075_0017060 3300049591 Bacteria 5239
208 Ga0501075_0022174 3300049591 Bacteria 4637
209 Ga0501075_0025239 3300049591 Bacteria 4366
210 Ga0501075_0033993 3300049591 Bacteria 3794
211 Ga0501075_0043954 3300049591 Bacteria 3351
212 Ga0501075_0239812 3300049591 Bacteria 1382
213 Ga0501075_0265857 3300049591 Bacteria 1307
214 Ga0501075_0635745 3300049591 Bacteria 814
215 Ga0501075_0973182 3300049591 Bacteria 645
216 Ga0501076_0004452 3300049592 Bacteria 9969
217 Ga0501076_0006302 3300049592 Bacteria 8597
218 Ga0501076_0027295 3300049592 Bacteria 4427
219 Ga0501076_0050343 3300049592 Bacteria 3295
220 Ga0501076_0076352 3300049592 Bacteria 2687
221 Ga0501076_0155291 3300049592 Bacteria 1862
222 Ga0501076_0366969 3300049592 Bacteria 1183
223 Ga0501076_0596664 3300049592 Bacteria 911
224 Ga0501077_0031008 3300049593 Bacteria 3401
225 Ga0501077_0043930 3300049593 Bacteria 2839
226 Ga0501077_0101371 3300049593 Bacteria 1824
227 Ga0501077_0115765 3300049593 Bacteria 1699
228 Ga0501077_0149271 3300049593 Bacteria 1483
229 Ga0501079_0014398 3300049741 Bacteria 6029
230 Ga0501079_0026364 3300049741 Bacteria 4456
231 Ga0501079_0030173 3300049741 Bacteria 4166
232 Ga0501079_0094121 3300049741 Bacteria 2321
233 Ga0501079_0176263 3300049741 Bacteria 1667
234 Ga0501079_0269244 3300049741 Bacteria 1332
235 Ga0501079_0298034 3300049741 Bacteria 1261
236 Ga0501079_0340259 3300049741 Bacteria 1175
237 Ga0501079_0621315 3300049741 Bacteria 850
238 Ga0501079_0662526 3300049741 Bacteria 822
239 Ga0501080_0032466 3300049742 Bacteria 4870
240 Ga0501080_0105806 3300049742 Bacteria 2608
241 Ga0501080_0144622 3300049742 Bacteria 2198
242 Ga0501080_0371268 3300049742 Bacteria 1290
243 Ga0501080_0814177 3300049742 Bacteria 818
244 Ga0501081_0006507 3300049743 Bacteria 7587
245 Ga0501081_0011435 3300049743 Bacteria 5806
246 Ga0501081_0018895 3300049743 Bacteria 4580
247 Ga0501081_0026088 3300049743 Bacteria 3936
248 Ga0501081_0047846 3300049743 Bacteria 2942
249 Ga0501081_0111022 3300049743 Bacteria 1946
250 Ga0501081_0111334 3300049743 Bacteria 1943
251 Ga0501083_0077838 3300049744 Bacteria 2200
252 Ga0501083_0096661 3300049744 Bacteria 1949
253 Ga0501083_0197357 3300049744 Bacteria 1313
254 Ga0501035_0019972 3300049822 Bacteria 6155
255 Ga0501035_0026592 3300049822 Bacteria 5293
256 Ga0501035_0199001 3300049822 Bacteria 1719
257 Ga0501035_0202817 3300049822 Bacteria 1700
258 Ga0501035_0647854 3300049822 Bacteria 857
259 Ga0501044_0224161 3300049823 Bacteria 1830
260 Ga0501044_0731159 3300049823 Bacteria 873
261 Ga0501045_0001280 3300049824 Bacteria 16706
262 Ga0501045_0069244 3300049824 Bacteria 2593
263 Ga0501045_0087597 3300049824 Bacteria 2299
264 Ga0501045_0088335 3300049824 Bacteria 2290
265 Ga0501045_0160369 3300049824 Bacteria 1674
266 nmdc:mga00v17_305883_c1 3300050491 Bacteria 1033
267 nmdc:mga00v17_49231_c1 3300050491 Bacteria 2556
268 nmdc:mga0yw44_292930_c1 3300050492 Bacteria 1089
269 nmdc:mga0yw44_364574_c1 3300050492 Bacteria 974
270 nmdc:mga07m45_40950_c1 3300050496 Bacteria 2594
271 nmdc:mga05p37_997_c1 3300050507 Bacteria 32250
272 nmdc:mga09592_1183_c1 3300050508 Bacteria 20832
273 nmdc:mga06r32_6990_c1 3300050510 Bacteria 10157
274 nmdc:mga06r32_751_c1 3300050510 Bacteria 28489
275 nmdc:mga08y16_10418_c1 3300050511 Bacteria 9751
276 Ga0500644_0013781 3300053088 Bacteria 2266
277 Ga0500641_0040964 3300053096 Bacteria 1873
278 Ga0500554_076798 3300053102 Bacteria 1095
279 Ga0501084_0005587 3300054114 Bacteria 10323
280 Ga0501084_0007024 3300054114 Bacteria 9279
281 Ga0501084_0010721 3300054114 Bacteria 7585
282 Ga0501084_0021846 3300054114 Bacteria 5338
283 Ga0501084_0051911 3300054114 Bacteria 3431
284 Ga0501082_0037533 3300060353 Bacteria 4176
285 Ga0501082_0064246 3300060353 Bacteria 3161
286 Ga0501082_0090385 3300060353 Bacteria 2644
287 Ga0501082_0117787 3300060353 Bacteria 2301
288 Ga0501082_0121534 3300060353 Bacteria 2263
289 Ga0501082_0179717 3300060353 Bacteria 1840
290 Ga0501082_0190464 3300060353 Bacteria 1784
291 Ga0501082_0461978 3300060353 Bacteria 1109
292 Ga0501082_1058114 3300060353 Bacteria 709
293 Ga0466962_0015626 3300061719 Bacteria 3660
294 Ga0530510_0008161 3300061734 Bacteria 7304
295 Ga0530510_0086406 3300061734 Bacteria 2285
296 Ga0530510_0130515 3300061734 Bacteria 1848
297 Ga0530510_0156013 3300061734 Bacteria 1687
298 Ga0530510_0225515 3300061734 Bacteria 1393
299 Ga0530510_0335752 3300061734 Bacteria 1134
300 2643891624 2643221576 Bacteria 5214352
301 2643960672 2643221590 Bacteria 5214697
302 2644093887 2643221615 Bacteria 5487866
303 2644323731 2643221657 Bacteria 5490246
304 2816426696 2816332119 Bacteria 8120218
305 2891403658 2891395885 Bacteria 9251614
306 2891556094 2891554331 Bacteria 8812224
307 2895429141 2895427314 Bacteria 13147766
308 Ga0081538_10000625
309 LJQas_1002076
310 JGI24739J22299_10015334
311 JGI24737J22298_10006431
312 JGI24735J21928_10017305
313 Ga0070658_10658177
314 Ga0070683_100003420
315 Ga0070683_100281863
316 Ga0070660_100024020
317 Ga0070668_100060527
318 Ga0070714_100033447
319 Ga0070663_100853491
320 Ga0070678_100692279
321 Ga0070681_10550369
322 Ga0070698_100476472
323 Ga0070679_100007194
324 Ga0070684_100336321
325 Ga0070684_100552510
326 Ga0070672_100430213
327 Ga0070686_100264247
328 Ga0070665_100000863
329 Ga0068857_100262791
330 Ga0068857_100344733
331 Ga0068852_100297352
332 Ga0068860_100000783
333 Ga0081455_10000909
334 Ga0081455_10002872
335 Ga0081455_10004987
336 Ga0081538_10123340
337 Ga0075365_10063757
338 Ga0075365_10265407
339 Ga0075365_10320646
340 Ga0075363_100215988
341 Ga0075364_10006724
342 Ga0075364_10369177
343 Ga0075370_10100733
344 Ga0075428_100013613
345 Ga0075431_100012961
346 Ga0075431_100068576
347 Ga0075429_100003297
348 Ga0068865_100357502
349 Ga0111539_10005975
350 Ga0105245_10353409
351 Ga0105245_11071897
352 Ga0114129_10023562
353 Ga0105248_11079970
354 Ga0105238_11181869
355 Ga0105239_10004560
356 Ga0105239_10298356
357 Ga0157369_11044837
358 Ga0163163_10497811
359 Ga0207647_10021581
360 Ga0207671_10065114
361 Ga0207687_10265742
362 Ga0207687_10291628
363 Ga0207664_10125154
364 Ga0207686_10280509
365 Ga0207704_10278657
366 Ga0207661_10022171
367 Ga0207651_10448974
368 Ga0207668_10101794
369 Ga0207658_10236089
370 Ga0207703_10677578
371 Ga0207674_10252496
372 Ga0207675_100316746
373 Ga0207683_10153767
374 Ga0207698_10685254
375 Ga0207428_10026441
376 Ga0268266_10003878
377 Ga0268264_10000576
378 Ga0265760_10099331
379 Ga0307409_100849700
380 Ga0307416_100742740
381 Ga0307411_10402541
382 Ga0307415_100158626
383 Ga0307415_100375372
384 Ga0395900_0636716
385 Ga0395898_0643986
386 Ga0451833_1146284
387 Ga0451839_1114179
388 Ga0451853_0102815
389 Ga0466972_0245483
390 Ga0466965_0269625
391 Ga0466966_0213274
392 Ga0466961_0083243
393 Ga0466963_0151677
394 Ga0466963_0163734
395 Ga0466964_0030438
396 Ga0466971_0081989
397 Ga0466970_0120551
398 Ga0466957_0328286
399 Ga0466960_0033397
400 Ga0466960_0173425
401 Ga0466960_0298043
402 Ga0466959_0281331
403 Ga0466958_0088974
404 Ga0466967_0032685
405 Ga0466967_0409142
406 Ga0466967_0560825
407 Ga0495585_0052316
408 Ga0496100_0079514
409 Ga0496102_0338540
410 Ga0496103_0482646
411 Ga0496104_0605159
412 Ga0496109_1171351
413 Ga0496110_0437891
414 Ga0496113_0386889
415 Ga0496114_0271903
416 Ga0496115_0081698
417 Ga0501031_0004607
418 Ga0501031_0015987
419 Ga0501031_0050777
420 Ga0501031_0129845
421 Ga0501031_0392161
422 Ga0501031_0495683
423 Ga0501032_0024826
424 Ga0501032_0065832
425 Ga0501032_0072795
426 Ga0501032_0230327
427 Ga0501032_0327135
428 Ga0501033_0297065
429 Ga0501034_0410481
430 Ga0501036_0002755
431 Ga0501036_0013831
432 Ga0501036_0025326
433 Ga0501036_0078976
434 Ga0501036_0768629
435 Ga0501037_0347935
436 Ga0501037_0370849
437 Ga0501038_0025903
438 Ga0501038_0055008
439 Ga0501038_0343448
440 Ga0501039_0005445
441 Ga0501039_0007697
442 Ga0501039_0019109
443 Ga0501039_0145357
444 Ga0501039_0184101
445 Ga0501039_0842585
446 Ga0501040_0005604
447 Ga0501040_0017845
448 Ga0501040_0037725
449 Ga0501040_0064560
450 Ga0501040_0085147
451 Ga0501040_0087337
452 Ga0501040_0236184
453 Ga0501041_0001615
454 Ga0501041_0012583
455 Ga0501041_0013615
456 Ga0501041_0033910
457 Ga0501041_0190270
458 Ga0501041_0205272
459 Ga0501041_0264345
460 Ga0501041_0312050
461 Ga0501041_0313733
462 Ga0501041_0325094
463 Ga0501042_0000476
464 Ga0501042_0012615
465 Ga0501042_0017807
466 Ga0501042_0048916
467 Ga0501042_0070858
468 Ga0501042_0111876
469 Ga0501043_0037457
470 Ga0501043_0134465
471 Ga0501043_0191567
472 Ga0501046_0009981
473 Ga0501046_0012255
474 Ga0501046_0014892
475 Ga0501046_0042746
476 Ga0501046_0130099
477 Ga0501046_0193370
478 Ga0501046_0328552
479 Ga0501048_0001240
480 Ga0501048_0048724
481 Ga0501048_0086924
482 Ga0501048_0149259
483 Ga0501048_0161601
484 Ga0501068_0029581
485 Ga0501068_0030845
486 Ga0501068_0176081
487 Ga0501069_0023713
488 Ga0501069_0091253
489 Ga0501069_0369725
490 Ga0501069_0409189
491 Ga0501070_0030280
492 Ga0501070_0032903
493 Ga0501070_0134336
494 Ga0501071_0007243
495 Ga0501071_0086954
496 Ga0501071_0089225
497 Ga0501071_0123472
498 Ga0501071_0134543
499 Ga0501071_0160876
500 Ga0501071_0382645
501 Ga0501072_0002074
502 Ga0501072_0008879
503 Ga0501072_0014957
504 Ga0501072_0059790
505 Ga0501072_0221308
506 Ga0501072_0256158
507 Ga0501073_0066149
508 Ga0501073_0102278
509 Ga0501073_0302368
510 Ga0501074_0007736
511 Ga0501074_0009132
512 Ga0501074_0143394
513 Ga0501075_0002938
514 Ga0501075_0017060
515 Ga0501075_0022174
516 Ga0501075_0025239
517 Ga0501075_0033993
518 Ga0501075_0043954
519 Ga0501075_0239812
520 Ga0501075_0265857
521 Ga0501075_0635745
522 Ga0501075_0973182
523 Ga0501076_0004452
524 Ga0501076_0006302
525 Ga0501076_0027295
526 Ga0501076_0050343
527 Ga0501076_0076352
528 Ga0501076_0155291
529 Ga0501076_0366969
530 Ga0501076_0596664
531 Ga0501077_0031008
532 Ga0501077_0043930
533 Ga0501077_0101371
534 Ga0501077_0115765
535 Ga0501077_0149271
536 Ga0501079_0014398
537 Ga0501079_0026364
538 Ga0501079_0030173
539 Ga0501079_0094121
540 Ga0501079_0176263
541 Ga0501079_0269244
542 Ga0501079_0298034
543 Ga0501079_0340259
544 Ga0501079_0621315
545 Ga0501079_0662526
546 Ga0501080_0032466
547 Ga0501080_0105806
548 Ga0501080_0144622
549 Ga0501080_0371268
550 Ga0501080_0814177
551 Ga0501081_0006507
552 Ga0501081_0011435
553 Ga0501081_0018895
554 Ga0501081_0026088
555 Ga0501081_0047846
556 Ga0501081_0111022
557 Ga0501081_0111334
558 Ga0501083_0077838
559 Ga0501083_0096661
560 Ga0501083_0197357
561 Ga0501035_0019972
562 Ga0501035_0026592
563 Ga0501035_0199001
564 Ga0501035_0202817
565 Ga0501035_0647854
566 Ga0501044_0224161
567 Ga0501044_0731159
568 Ga0501045_0001280
569 Ga0501045_0069244
570 Ga0501045_0087597
571 Ga0501045_0088335
572 Ga0501045_0160369
573 nmdc:mga00v17_305883_c1
574 nmdc:mga00v17_49231_c1
575 nmdc:mga0yw44_292930_c1
576 nmdc:mga0yw44_364574_c1
577 nmdc:mga07m45_40950_c1
578 nmdc:mga05p37_997_c1
579 nmdc:mga09592_1183_c1
580 nmdc:mga06r32_6990_c1
581 nmdc:mga06r32_751_c1
582 nmdc:mga08y16_10418_c1
583 Ga0500644_0013781
584 Ga0500641_0040964
585 Ga0500554_076798
586 Ga0501084_0005587
587 Ga0501084_0007024
588 Ga0501084_0010721
589 Ga0501084_0021846
590 Ga0501084_0051911
591 Ga0501082_0037533
592 Ga0501082_0064246
593 Ga0501082_0090385
594 Ga0501082_0117787
595 Ga0501082_0121534
596 Ga0501082_0179717
597 Ga0501082_0190464
598 Ga0501082_0461978
599 Ga0501082_1058114
600 Ga0466962_0015626
601 Ga0530510_0008161
602 Ga0530510_0086406
603 Ga0530510_0130515
604 Ga0530510_0156013
605 Ga0530510_0225515
606 Ga0530510_0335752
607 2643891624
608 2643960672
609 2644093887
610 2644323731
611 2816426696
612 2891403658
613 2891556094
614 2895429141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01174

SNO

SNO glutamine amidotransferase family

8

197

0.93

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

15

134

0.75

PF00117

GATase

Glutamine amidotransferase class-I

16

194

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wxy-assembly1.cif.gz_L plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9465 5 198
4wxy-assembly1.cif.gz_F plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p. 0.9454 5 198
2nv2-assembly1.cif.gz_J structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis 0.9453 4 198
2iss-assembly1.cif.gz_D structure of the plp synthase holoenzyme from thermotoga maritima 0.945 4 195
1q7r-assembly1.cif.gz_A x-ray crystallographic analysis of a predicted amidotransferase from b. stearothermophilus at 1.9 a resolution 0.9332 1 198
ID Description Score Start End Superfamily
af_P9WII7_2_198_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9487 2 198 3.40.50.880
af_P9WII7_2_198_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9346 2 198 3.40.50.880
2ywdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9246 6 197 3.40.50.880
af_A0A143ZYM6_1_127_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9235 1 107 3.40.50.880
2ywjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9132 5 196 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7Y5RLS2-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9868 1 112 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A383BYH2-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9842 5 104 GO:0004359
GO:0005829
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A259S3B1-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9835 1 112 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A6G3XLL1-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9811 3 83 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A7X5WP70-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9786 5 84 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600

Map