F399114

General Info

Members Datasets Scaffolds Average Seq Length
307 186 614 89

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10958781|Ga0081455_109587812
Length 94
Sequence VIIRILGEGQYDVADHALDRLNELDTALEAAVDAGDEAAFPAALAELLDGVRSVGVAHPADSLDESDMILPPADATIDEVRAMLDESEEGLIPG

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
99 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
100 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
101 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
102 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
103 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
104 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
105 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
163 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 2643221561 Nocardioides sp. Root151 Isolate Unclassified
182 2643221696 Nocardioides sp. Root140 Isolate Unclassified
183 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
184 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
185 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
186 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 4.56
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.65
Bulb 0
Endosphere 12.7
Nodule 0
Rhizoplane 12.05
Rhizosphere 72.64
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10958781 3300005937 Bacteria 530
2 Ga0070683_100277317 3300005329 Bacteria 1595
3 Ga0068869_100859420 3300005334 Bacteria 783
4 Ga0070666_11026369 3300005335 Bacteria 612
5 Ga0070682_100530231 3300005337 Bacteria 918
6 Ga0070660_101393706 3300005339 Bacteria 595
7 Ga0070687_100093509 3300005343 Bacteria 1668
8 Ga0070692_10282568 3300005345 Bacteria 1006
9 Ga0070668_100247060 3300005347 Bacteria 1480
10 Ga0070675_101247403 3300005354 Bacteria 685
11 Ga0070688_101057140 3300005365 Bacteria 647
12 Ga0070659_100536975 3300005366 Bacteria 1000
13 Ga0070667_100036655 3300005367 Bacteria 4112
14 Ga0070701_11021788 3300005438 Unclassified 578
15 Ga0070700_100402498 3300005441 Bacteria 1029
16 Ga0070700_100865319 3300005441 Bacteria 733
17 Ga0070678_100111825 3300005456 Bacteria 2138
18 Ga0068867_100358029 3300005459 Bacteria 1220
19 Ga0068867_100440391 3300005459 Bacteria 1108
20 Ga0070685_11217769 3300005466 Bacteria 573
21 Ga0070707_100381095 3300005468 Bacteria 1370
22 Ga0070698_100030055 3300005471 Bacteria 5637
23 Ga0070665_101179365 3300005548 Bacteria 777
24 Ga0068855_102364914 3300005563 Bacteria 531
25 Ga0068856_101560348 3300005614 Bacteria 674
26 Ga0070702_100048817 3300005615 Bacteria 2411
27 Ga0068852_100964041 3300005616 Bacteria 871
28 Ga0068864_100125450 3300005618 Bacteria 2300
29 Ga0068864_100235939 3300005618 Bacteria 1693
30 Ga0068866_10674322 3300005718 Bacteria 706
31 Ga0068861_100033156 3300005719 Bacteria 3808
32 Ga0068858_102248465 3300005842 Bacteria 539
33 Ga0068860_100002948 3300005843 Bacteria 17594
34 Ga0075365_10031238 3300006038 Bacteria 3416
35 Ga0075365_10047529 3300006038 Bacteria 2821
36 Ga0075365_10144125 3300006038 Bacteria 1654
37 Ga0075365_10172398 3300006038 Bacteria 1510
38 Ga0075365_10304973 3300006038 Bacteria 1121
39 Ga0075365_10320655 3300006038 Bacteria 1091
40 Ga0075365_10342605 3300006038 Bacteria 1053
41 Ga0075365_10373044 3300006038 Bacteria 1006
42 Ga0075365_10720524 3300006038 Bacteria 704
43 Ga0075365_10996173 3300006038 Bacteria 590
44 Ga0075363_100713655 3300006048 Bacteria 606
45 Ga0075364_10756648 3300006051 Bacteria 663
46 Ga0075367_10017234 3300006178 Bacteria 3961
47 Ga0075367_10075163 3300006178 Bacteria 2038
48 Ga0075370_10099509 3300006353 Bacteria 1682
49 Ga0075370_10133639 3300006353 Bacteria 1448
50 Ga0075370_10389147 3300006353 Bacteria 836
51 Ga0068871_100706178 3300006358 Bacteria 924
52 Ga0111539_10266489 3300009094 Bacteria 1994
53 Ga0111539_10473853 3300009094 Bacteria 1458
54 Ga0111539_13184299 3300009094 Unclassified 529
55 Ga0105245_10273433 3300009098 Bacteria 1648
56 Ga0105243_10565901 3300009148 Bacteria 1088
57 Ga0105248_10766424 3300009177 Bacteria 1089
58 Ga0105238_10466058 3300009551 Bacteria 1261
59 Ga0105239_10571481 3300010375 Bacteria 1288
60 Ga0163162_12115627 3300013306 Bacteria 646
61 Ga0157372_11296926 3300013307 Bacteria 840
62 Ga0157375_10044758 3300013308 Bacteria 4304
63 Ga0163163_10162822 3300014325 Bacteria 2277
64 Ga0163163_10923480 3300014325 Bacteria 936
65 Ga0157380_10028366 3300014326 Bacteria 4267
66 Ga0157380_10580387 3300014326 Bacteria 1105
67 Ga0157377_10197642 3300014745 Bacteria 1275
68 Ga0157379_10601403 3300014968 Bacteria 1027
69 Ga0157376_12381097 3300014969 Bacteria 569
70 Ga0163161_10014516 3300017792 Bacteria 5485
71 Ga0197907_11400179 3300020069 Bacteria 1648
72 Ga0206349_1031490 3300020075 Bacteria 2590
73 Ga0206351_10677736 3300020077 Bacteria 2821
74 Ga0206352_10642381 3300020078 Bacteria 605
75 Ga0206350_11022604 3300020080 Bacteria 2563
76 Ga0206354_10046683 3300020081 Bacteria 1557
77 Ga0224712_10021228 3300022467 Bacteria 2219
78 Ga0207682_10041640 3300025893 Bacteria 1875
79 Ga0207642_10429929 3300025899 Bacteria 796
80 Ga0207642_10540969 3300025899 Bacteria 718
81 Ga0207710_10470856 3300025900 Bacteria 650
82 Ga0207688_11060064 3300025901 Bacteria 512
83 Ga0207643_10277053 3300025908 Bacteria 1039
84 Ga0207705_10001806 3300025909 Bacteria 16878
85 Ga0207662_10116941 3300025918 Bacteria 1668
86 Ga0207694_10461132 3300025924 Bacteria 1062
87 Ga0207650_11873283 3300025925 Bacteria 507
88 Ga0207690_10761745 3300025932 Bacteria 799
89 Ga0207709_10617582 3300025935 Bacteria 860
90 Ga0207669_10260895 3300025937 Bacteria 1296
91 Ga0207669_11691297 3300025937 Bacteria 540
92 Ga0207691_10046522 3300025940 Bacteria 3987
93 Ga0207667_10943359 3300025949 Bacteria 853
94 Ga0207712_12105812 3300025961 Unclassified 505
95 Ga0207658_10066404 3300025986 Bacteria 2713
96 Ga0207708_10011579 3300026075 Bacteria 6573
97 Ga0207708_10313226 3300026075 Bacteria 1279
98 Ga0207702_11120314 3300026078 Bacteria 781
99 Ga0207648_10060048 3300026089 Bacteria 3316
100 Ga0207676_10231639 3300026095 Bacteria 1652
101 Ga0207676_11811789 3300026095 Bacteria 609
102 Ga0207674_10009443 3300026116 Bacteria 11145
103 Ga0207675_100346649 3300026118 Bacteria 1455
104 Ga0207683_10208663 3300026121 Bacteria 1777
105 Ga0207698_10333501 3300026142 Bacteria 1426
106 Ga0268266_11982240 3300028379 Unclassified 556
107 Ga0268264_10009815 3300028381 Bacteria 7923
108 Ga0307408_100109456 3300031548 Bacteria 2120
109 Ga0307408_100578107 3300031548 Bacteria 995
110 Ga0307405_10184981 3300031731 Bacteria 1499
111 Ga0307405_10529397 3300031731 Bacteria 950
112 Ga0307413_10347453 3300031824 Bacteria 1143
113 Ga0307413_11634381 3300031824 Bacteria 573
114 Ga0307410_10110105 3300031852 Bacteria 1991
115 Ga0307410_10173703 3300031852 Bacteria 1626
116 Ga0307410_10573026 3300031852 Bacteria 938
117 Ga0307410_11367526 3300031852 Bacteria 621
118 Ga0307410_11430256 3300031852 Bacteria 608
119 Ga0307406_10790813 3300031901 Bacteria 800
120 Ga0307406_12062149 3300031901 Bacteria 511
121 Ga0307407_10112226 3300031903 Bacteria 1713
122 Ga0307407_10536865 3300031903 Bacteria 862
123 Ga0307407_10601956 3300031903 Bacteria 818
124 Ga0307407_11250486 3300031903 Bacteria 581
125 Ga0307412_10206626 3300031911 Bacteria 1495
126 Ga0307412_10835942 3300031911 Bacteria 802
127 Ga0307409_100064110 3300031995 Bacteria 2885
128 Ga0307409_100099624 3300031995 Bacteria 2407
129 Ga0307409_100155807 3300031995 Bacteria 1990
130 Ga0307409_100226725 3300031995 Bacteria 1691
131 Ga0307409_100544183 3300031995 Bacteria 1138
132 Ga0307409_101605921 3300031995 Bacteria 678
133 Ga0307409_102060297 3300031995 Bacteria 600
134 Ga0307409_102358358 3300031995 Bacteria 561
135 Ga0307416_100011557 3300032002 Bacteria 5897
136 Ga0307416_100013355 3300032002 Bacteria 5578
137 Ga0307416_100256097 3300032002 Bacteria 1707
138 Ga0307416_100337474 3300032002 Bacteria 1518
139 Ga0307416_100701862 3300032002 Bacteria 1101
140 Ga0307416_100722581 3300032002 Bacteria 1087
141 Ga0307416_100821296 3300032002 Bacteria 1026
142 Ga0307416_101133226 3300032002 Bacteria 887
143 Ga0307416_101496851 3300032002 Bacteria 781
144 Ga0307416_103130712 3300032002 Bacteria 553
145 Ga0307414_10636853 3300032004 Bacteria 960
146 Ga0307414_10709554 3300032004 Bacteria 911
147 Ga0307411_10061289 3300032005 Bacteria 2504
148 Ga0307411_10189788 3300032005 Bacteria 1568
149 Ga0307411_10677106 3300032005 Bacteria 896
150 Ga0307411_11203464 3300032005 Bacteria 687
151 Ga0307411_11277840 3300032005 Bacteria 668
152 Ga0307415_100024593 3300032126 Bacteria 3763
153 Ga0307415_100500284 3300032126 Bacteria 1062
154 Ga0395898_0891500 3300037466 Bacteria 828
155 Ga0395898_1297255 3300037466 Bacteria 657
156 Ga0439438_104455 3300041405 Bacteria 686
157 Ga0439447_033809 3300041407 Bacteria 1273
158 Ga0439461_0008842 3300041410 Bacteria 1815
159 Ga0439465_0043992 3300041413 Bacteria 1450
160 Ga0439465_0193598 3300041413 Bacteria 739
161 Ga0451787_166280 3300041441 Bacteria 569
162 Ga0451793_0986258 3300041452 Bacteria 633
163 Ga0451793_1158873 3300041452 Bacteria 582
164 Ga0451793_1629736 3300041452 Bacteria 506
165 Ga0451795_0138923 3300041456 Bacteria 545
166 Ga0451802_2142381 3300041460 Bacteria 634
167 Ga0451849_0310092 3300041505 Bacteria 1126
168 Ga0451855_1066914 3300041511 Bacteria 791
169 Ga0439462_0042721 3300042015 Bacteria 1211
170 Ga0450906_045904 3300042145 Bacteria 771
171 Ga0439446_0002141 3300042156 Bacteria 4691
172 Ga0439434_0019141 3300042435 Bacteria 2052
173 Ga0466968_0212458 3300044735 Bacteria 909
174 Ga0466960_0055486 3300044901 Bacteria 1927
175 Ga0466967_1680071 3300045976 Bacteria 632
176 Ga0495620_0309584 3300046515 Bacteria 600
177 Ga0495631_0296755 3300046518 Bacteria 688
178 Ga0496100_1103024 3300048903 Bacteria 625
179 Ga0496101_0082954 3300048904 Bacteria 2372
180 Ga0496101_0331974 3300048904 Bacteria 1194
181 Ga0496101_0715650 3300048904 Bacteria 790
182 Ga0496101_0834663 3300048904 Bacteria 726
183 Ga0496102_0063789 3300048905 Bacteria 3374
184 Ga0496102_0213882 3300048905 Bacteria 1817
185 Ga0496103_0152941 3300048906 Bacteria 1478
186 Ga0496103_0359692 3300048906 Bacteria 936
187 Ga0496104_0005838 3300048907 Bacteria 10783
188 Ga0496105_0007027 3300048908 Bacteria 8671
189 Ga0496106_0553063 3300048909 Bacteria 923
190 Ga0496106_1027896 3300048909 Bacteria 647
191 Ga0496107_0029700 3300048910 Bacteria 3891
192 Ga0496107_0152796 3300048910 Bacteria 1708
193 Ga0496108_0213077 3300048911 Bacteria 1677
194 Ga0496108_0231924 3300048911 Bacteria 1605
195 Ga0496108_0506302 3300048911 Bacteria 1054
196 Ga0496109_0143841 3300048912 Bacteria 2230
197 Ga0496109_0560456 3300048912 Bacteria 1078
198 Ga0496110_0247030 3300048913 Bacteria 1624
199 Ga0496110_0345067 3300048913 Bacteria 1356
200 Ga0496111_0095293 3300048914 Bacteria 2184
201 Ga0496111_0378234 3300048914 Bacteria 1047
202 Ga0496111_0763910 3300048914 Bacteria 701
203 Ga0496112_0169340 3300048915 Bacteria 2150
204 Ga0496113_0075423 3300048916 Bacteria 2574
205 Ga0496113_0505135 3300048916 Bacteria 971
206 Ga0496114_0010211 3300048917 Bacteria 7471
207 Ga0496114_0339282 3300048917 Bacteria 1329
208 Ga0496115_0039322 3300048918 Bacteria 3756
209 Ga0501311_026908 3300049527 Bacteria 813
210 Ga0501317_038903 3300049533 Bacteria 719
211 Ga0501317_098148 3300049533 Bacteria 526
212 Ga0501318_003883 3300049534 Bacteria 1401
213 Ga0501318_005522 3300049534 Bacteria 1257
214 Ga0501321_015950 3300049537 Bacteria 889
215 Ga0501325_044827 3300049541 Bacteria 548
216 Ga0501031_0098526 3300049568 Bacteria 1907
217 Ga0501031_0230255 3300049568 Bacteria 1206
218 Ga0501032_0055284 3300049569 Bacteria 2670
219 Ga0501033_0002108 3300049570 Bacteria 17222
220 Ga0501033_0232992 3300049570 Bacteria 1308
221 Ga0501033_1000187 3300049570 Bacteria 559
222 Ga0501034_0623512 3300049571 Bacteria 982
223 Ga0501034_1056903 3300049571 Bacteria 694
224 Ga0501036_0004245 3300049572 Bacteria 11555
225 Ga0501036_0012059 3300049572 Bacteria 7162
226 Ga0501037_0008882 3300049573 Bacteria 7359
227 Ga0501037_1094454 3300049573 Bacteria 516
228 Ga0501038_0031357 3300049574 Bacteria 4698
229 Ga0501038_0082799 3300049574 Bacteria 2702
230 Ga0501038_0813608 3300049574 Bacteria 694
231 Ga0501039_0466519 3300049575 Bacteria 991
232 Ga0501039_1042971 3300049575 Bacteria 634
233 Ga0501041_0111378 3300049577 Bacteria 1698
234 Ga0501042_0033950 3300049578 Bacteria 3618
235 Ga0501042_0542210 3300049578 Bacteria 845
236 Ga0501042_0979667 3300049578 Bacteria 616
237 Ga0501043_0059128 3300049579 Bacteria 3007
238 Ga0501046_0000841 3300049580 Bacteria 29918
239 Ga0501046_0075044 3300049580 Bacteria 2622
240 Ga0501047_0688010 3300049581 Bacteria 840
241 Ga0501048_0017189 3300049582 Bacteria 5329
242 Ga0501048_0155763 3300049582 Bacteria 1616
243 Ga0501067_0132385 3300049583 Bacteria 1388
244 Ga0501067_0527718 3300049583 Bacteria 661
245 Ga0501068_0476885 3300049584 Bacteria 808
246 Ga0501069_0034224 3300049585 Bacteria 2798
247 Ga0501070_0011977 3300049586 Bacteria 7322
248 Ga0501070_0023708 3300049586 Bacteria 5142
249 Ga0501070_0080657 3300049586 Bacteria 2692
250 Ga0501070_1208968 3300049586 Bacteria 580
251 Ga0501071_0157967 3300049587 Bacteria 1694
252 Ga0501071_0603388 3300049587 Bacteria 844
253 Ga0501072_0143898 3300049588 Bacteria 1901
254 Ga0501072_0750559 3300049588 Bacteria 766
255 Ga0501073_0040728 3300049589 Bacteria 3286
256 Ga0501074_0026566 3300049590 Bacteria 4198
257 Ga0501074_0046144 3300049590 Bacteria 3150
258 Ga0501075_0254580 3300049591 Bacteria 1338
259 Ga0501075_0264515 3300049591 Bacteria 1311
260 Ga0501076_0354902 3300049592 Bacteria 1204
261 Ga0501077_0051489 3300049593 Bacteria 2617
262 Ga0501217_226982 3300049661 Bacteria 593
263 Ga0501079_1103748 3300049741 Bacteria 625
264 Ga0501080_0061315 3300049742 Bacteria 3502
265 Ga0501080_0094913 3300049742 Bacteria 2770
266 Ga0501080_0879253 3300049742 Bacteria 782
267 Ga0501081_0140308 3300049743 Bacteria 1732
268 Ga0501083_0328338 3300049744 Bacteria 995
269 Ga0501083_0916626 3300049744 Bacteria 570
270 Ga0501035_0019794 3300049822 Bacteria 6183
271 Ga0501035_0274795 3300049822 Bacteria 1425
272 Ga0501044_0318731 3300049823 Bacteria 1479
273 Ga0501044_1351948 3300049823 Bacteria 578
274 Ga0501045_0363461 3300049824 Bacteria 1077
275 Ga0501045_1295708 3300049824 Bacteria 530
276 nmdc:mga03n38_841292_c1 3300050490 Bacteria 536
277 nmdc:mga00v17_100612_c1 3300050491 Bacteria 1824
278 nmdc:mga00v17_16414_c1 3300050491 Bacteria 4173
279 nmdc:mga00v17_46965_c1 3300050491 Bacteria 2614
280 nmdc:mga0yw44_1040676_c1 3300050492 Bacteria 554
281 nmdc:mga0yw44_121946_c1 3300050492 Bacteria 1680
282 nmdc:mga0yw44_1234034_c1 3300050492 Bacteria 504
283 nmdc:mga0yw44_13159_c1 3300050492 Bacteria 4345
284 nmdc:mga0yw44_211801_c1 3300050492 Bacteria 1282
285 nmdc:mga0yw44_278916_c1 3300050492 Bacteria 1117
286 nmdc:mga0yw44_337327_c1 3300050492 Bacteria 1014
287 nmdc:mga0yw44_463555_c1 3300050492 Bacteria 859
288 nmdc:mga0yw44_4649_c1 3300050492 Bacteria 6340
289 nmdc:mga0yw44_72619_c1 3300050492 Bacteria 2139
290 nmdc:mga0yw44_828379_c1 3300050492 Bacteria 628
291 nmdc:mga06z11_14758_c1 3300050494 Bacteria 3468
292 nmdc:mga06z11_816385_c1 3300050494 Bacteria 568
293 nmdc:mga07m45_108292_c1 3300050496 Bacteria 1599
294 nmdc:mga07m45_488221_c1 3300050496 Bacteria 713
295 nmdc:mga07m45_76616_c1 3300050496 Bacteria 1907
296 nmdc:mga08y16_1087793_c1 3300050511 Bacteria 775
297 nmdc:mga08y16_1801353_c1 3300050511 Bacteria 565
298 Ga0500644_0093032 3300053088 Bacteria 1132
299 Ga0500573_0412533 3300053140 Bacteria 636
300 Ga0501082_0393743 3300060353 Bacteria 1209
301 Ga0530510_0241843 3300061734 Bacteria 1344
302 2643825467 2643221561 Bacteria 4984412
303 2644531463 2643221696 Bacteria 5431823
304 2855387709 2855386786 Bacteria 4752232
305 2857712463 2857710386 Bacteria 3186771
306 2984576998 2984576629 Bacteria 4248407
307 2990258745 2990256926 Bacteria 4252839
308 Ga0081455_10958781
309 Ga0070683_100277317
310 Ga0068869_100859420
311 Ga0070666_11026369
312 Ga0070682_100530231
313 Ga0070660_101393706
314 Ga0070687_100093509
315 Ga0070692_10282568
316 Ga0070668_100247060
317 Ga0070675_101247403
318 Ga0070688_101057140
319 Ga0070659_100536975
320 Ga0070667_100036655
321 Ga0070701_11021788
322 Ga0070700_100402498
323 Ga0070700_100865319
324 Ga0070678_100111825
325 Ga0068867_100358029
326 Ga0068867_100440391
327 Ga0070685_11217769
328 Ga0070707_100381095
329 Ga0070698_100030055
330 Ga0070665_101179365
331 Ga0068855_102364914
332 Ga0068856_101560348
333 Ga0070702_100048817
334 Ga0068852_100964041
335 Ga0068864_100125450
336 Ga0068864_100235939
337 Ga0068866_10674322
338 Ga0068861_100033156
339 Ga0068858_102248465
340 Ga0068860_100002948
341 Ga0075365_10031238
342 Ga0075365_10047529
343 Ga0075365_10144125
344 Ga0075365_10172398
345 Ga0075365_10304973
346 Ga0075365_10320655
347 Ga0075365_10342605
348 Ga0075365_10373044
349 Ga0075365_10720524
350 Ga0075365_10996173
351 Ga0075363_100713655
352 Ga0075364_10756648
353 Ga0075367_10017234
354 Ga0075367_10075163
355 Ga0075370_10099509
356 Ga0075370_10133639
357 Ga0075370_10389147
358 Ga0068871_100706178
359 Ga0111539_10266489
360 Ga0111539_10473853
361 Ga0111539_13184299
362 Ga0105245_10273433
363 Ga0105243_10565901
364 Ga0105248_10766424
365 Ga0105238_10466058
366 Ga0105239_10571481
367 Ga0163162_12115627
368 Ga0157372_11296926
369 Ga0157375_10044758
370 Ga0163163_10162822
371 Ga0163163_10923480
372 Ga0157380_10028366
373 Ga0157380_10580387
374 Ga0157377_10197642
375 Ga0157379_10601403
376 Ga0157376_12381097
377 Ga0163161_10014516
378 Ga0197907_11400179
379 Ga0206349_1031490
380 Ga0206351_10677736
381 Ga0206352_10642381
382 Ga0206350_11022604
383 Ga0206354_10046683
384 Ga0224712_10021228
385 Ga0207682_10041640
386 Ga0207642_10429929
387 Ga0207642_10540969
388 Ga0207710_10470856
389 Ga0207688_11060064
390 Ga0207643_10277053
391 Ga0207705_10001806
392 Ga0207662_10116941
393 Ga0207694_10461132
394 Ga0207650_11873283
395 Ga0207690_10761745
396 Ga0207709_10617582
397 Ga0207669_10260895
398 Ga0207669_11691297
399 Ga0207691_10046522
400 Ga0207667_10943359
401 Ga0207712_12105812
402 Ga0207658_10066404
403 Ga0207708_10011579
404 Ga0207708_10313226
405 Ga0207702_11120314
406 Ga0207648_10060048
407 Ga0207676_10231639
408 Ga0207676_11811789
409 Ga0207674_10009443
410 Ga0207675_100346649
411 Ga0207683_10208663
412 Ga0207698_10333501
413 Ga0268266_11982240
414 Ga0268264_10009815
415 Ga0307408_100109456
416 Ga0307408_100578107
417 Ga0307405_10184981
418 Ga0307405_10529397
419 Ga0307413_10347453
420 Ga0307413_11634381
421 Ga0307410_10110105
422 Ga0307410_10173703
423 Ga0307410_10573026
424 Ga0307410_11367526
425 Ga0307410_11430256
426 Ga0307406_10790813
427 Ga0307406_12062149
428 Ga0307407_10112226
429 Ga0307407_10536865
430 Ga0307407_10601956
431 Ga0307407_11250486
432 Ga0307412_10206626
433 Ga0307412_10835942
434 Ga0307409_100064110
435 Ga0307409_100099624
436 Ga0307409_100155807
437 Ga0307409_100226725
438 Ga0307409_100544183
439 Ga0307409_101605921
440 Ga0307409_102060297
441 Ga0307409_102358358
442 Ga0307416_100011557
443 Ga0307416_100013355
444 Ga0307416_100256097
445 Ga0307416_100337474
446 Ga0307416_100701862
447 Ga0307416_100722581
448 Ga0307416_100821296
449 Ga0307416_101133226
450 Ga0307416_101496851
451 Ga0307416_103130712
452 Ga0307414_10636853
453 Ga0307414_10709554
454 Ga0307411_10061289
455 Ga0307411_10189788
456 Ga0307411_10677106
457 Ga0307411_11203464
458 Ga0307411_11277840
459 Ga0307415_100024593
460 Ga0307415_100500284
461 Ga0395898_0891500
462 Ga0395898_1297255
463 Ga0439438_104455
464 Ga0439447_033809
465 Ga0439461_0008842
466 Ga0439465_0043992
467 Ga0439465_0193598
468 Ga0451787_166280
469 Ga0451793_0986258
470 Ga0451793_1158873
471 Ga0451793_1629736
472 Ga0451795_0138923
473 Ga0451802_2142381
474 Ga0451849_0310092
475 Ga0451855_1066914
476 Ga0439462_0042721
477 Ga0450906_045904
478 Ga0439446_0002141
479 Ga0439434_0019141
480 Ga0466968_0212458
481 Ga0466960_0055486
482 Ga0466967_1680071
483 Ga0495620_0309584
484 Ga0495631_0296755
485 Ga0496100_1103024
486 Ga0496101_0082954
487 Ga0496101_0331974
488 Ga0496101_0715650
489 Ga0496101_0834663
490 Ga0496102_0063789
491 Ga0496102_0213882
492 Ga0496103_0152941
493 Ga0496103_0359692
494 Ga0496104_0005838
495 Ga0496105_0007027
496 Ga0496106_0553063
497 Ga0496106_1027896
498 Ga0496107_0029700
499 Ga0496107_0152796
500 Ga0496108_0213077
501 Ga0496108_0231924
502 Ga0496108_0506302
503 Ga0496109_0143841
504 Ga0496109_0560456
505 Ga0496110_0247030
506 Ga0496110_0345067
507 Ga0496111_0095293
508 Ga0496111_0378234
509 Ga0496111_0763910
510 Ga0496112_0169340
511 Ga0496113_0075423
512 Ga0496113_0505135
513 Ga0496114_0010211
514 Ga0496114_0339282
515 Ga0496115_0039322
516 Ga0501311_026908
517 Ga0501317_038903
518 Ga0501317_098148
519 Ga0501318_003883
520 Ga0501318_005522
521 Ga0501321_015950
522 Ga0501325_044827
523 Ga0501031_0098526
524 Ga0501031_0230255
525 Ga0501032_0055284
526 Ga0501033_0002108
527 Ga0501033_0232992
528 Ga0501033_1000187
529 Ga0501034_0623512
530 Ga0501034_1056903
531 Ga0501036_0004245
532 Ga0501036_0012059
533 Ga0501037_0008882
534 Ga0501037_1094454
535 Ga0501038_0031357
536 Ga0501038_0082799
537 Ga0501038_0813608
538 Ga0501039_0466519
539 Ga0501039_1042971
540 Ga0501041_0111378
541 Ga0501042_0033950
542 Ga0501042_0542210
543 Ga0501042_0979667
544 Ga0501043_0059128
545 Ga0501046_0000841
546 Ga0501046_0075044
547 Ga0501047_0688010
548 Ga0501048_0017189
549 Ga0501048_0155763
550 Ga0501067_0132385
551 Ga0501067_0527718
552 Ga0501068_0476885
553 Ga0501069_0034224
554 Ga0501070_0011977
555 Ga0501070_0023708
556 Ga0501070_0080657
557 Ga0501070_1208968
558 Ga0501071_0157967
559 Ga0501071_0603388
560 Ga0501072_0143898
561 Ga0501072_0750559
562 Ga0501073_0040728
563 Ga0501074_0026566
564 Ga0501074_0046144
565 Ga0501075_0254580
566 Ga0501075_0264515
567 Ga0501076_0354902
568 Ga0501077_0051489
569 Ga0501217_226982
570 Ga0501079_1103748
571 Ga0501080_0061315
572 Ga0501080_0094913
573 Ga0501080_0879253
574 Ga0501081_0140308
575 Ga0501083_0328338
576 Ga0501083_0916626
577 Ga0501035_0019794
578 Ga0501035_0274795
579 Ga0501044_0318731
580 Ga0501044_1351948
581 Ga0501045_0363461
582 Ga0501045_1295708
583 nmdc:mga03n38_841292_c1
584 nmdc:mga00v17_100612_c1
585 nmdc:mga00v17_16414_c1
586 nmdc:mga00v17_46965_c1
587 nmdc:mga0yw44_1040676_c1
588 nmdc:mga0yw44_121946_c1
589 nmdc:mga0yw44_1234034_c1
590 nmdc:mga0yw44_13159_c1
591 nmdc:mga0yw44_211801_c1
592 nmdc:mga0yw44_278916_c1
593 nmdc:mga0yw44_337327_c1
594 nmdc:mga0yw44_463555_c1
595 nmdc:mga0yw44_4649_c1
596 nmdc:mga0yw44_72619_c1
597 nmdc:mga0yw44_828379_c1
598 nmdc:mga06z11_14758_c1
599 nmdc:mga06z11_816385_c1
600 nmdc:mga07m45_108292_c1
601 nmdc:mga07m45_488221_c1
602 nmdc:mga07m45_76616_c1
603 nmdc:mga08y16_1087793_c1
604 nmdc:mga08y16_1801353_c1
605 Ga0500644_0093032
606 Ga0500573_0412533
607 Ga0501082_0393743
608 Ga0530510_0241843
609 2643825467
610 2644531463
611 2855387709
612 2857712463
613 2984576998
614 2990258745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22743

PspAA

PspA-Associated protein

1

94

0.98

Map