F399032

General Info

Members Datasets Scaffolds Average Seq Length
307 150 614 119

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100857459|Ga0070659_1008574592
Length 142
Sequence MDGRVAKGVSRPASRTIAMPKHRIFTTSFASVYPHYVRKAEAKGRERGEVDQVICWLTGYTSQALAEQIERKTDFETFFAEAPALHPNVGKITGVVCGVRVEEVEDPLMRKIRYLDKLVDELAKGGRWRKCCEPDVNAGRLR

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
141 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 97.72
Stem 0
Stem Tuber 0
Unclassified 10.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100857459 3300005366 Bacteria 792
2 SwRhRL2b_contig_488007 2162886007 Bacteria 962
3 JGI24737J22298_10042284 3300001990 Bacteria 1397
4 Ga0065704_10207795 3300005289 Bacteria 1120
5 Ga0065715_10970484 3300005293 Bacteria 553
6 Ga0065707_10107886 3300005295 Bacteria 2534
7 Ga0065707_10124146 3300005295 Bacteria 2050
8 Ga0070658_10231553 3300005327 Bacteria 1564
9 Ga0070658_10254549 3300005327 Bacteria 1490
10 Ga0070658_11871320 3300005327 Bacteria 518
11 Ga0070676_10111933 3300005328 Bacteria 1701
12 Ga0070683_100110118 3300005329 Bacteria 2597
13 Ga0070683_100201948 3300005329 Bacteria 1888
14 Ga0070690_100908527 3300005330 Bacteria 689
15 Ga0070670_100134280 3300005331 Bacteria 2138
16 Ga0070670_100662985 3300005331 Bacteria 936
17 Ga0068869_100063607 3300005334 Bacteria 2711
18 Ga0068869_101506690 3300005334 Unclassified 597
19 Ga0070682_101071976 3300005337 Bacteria 673
20 Ga0068868_100017545 3300005338 Bacteria 5337
21 Ga0068868_100624478 3300005338 Bacteria 957
22 Ga0070660_100054725 3300005339 Bacteria 3082
23 Ga0070660_100947891 3300005339 Bacteria 726
24 Ga0070660_101042183 3300005339 Bacteria 692
25 Ga0070687_100336829 3300005343 Unclassified 969
26 Ga0070661_100058429 3300005344 Bacteria 2826
27 Ga0070661_100076076 3300005344 Bacteria 2474
28 Ga0070661_100392380 3300005344 Bacteria 1096
29 Ga0070661_100841855 3300005344 Bacteria 754
30 Ga0070661_101084033 3300005344 Bacteria 667
31 Ga0070668_100312446 3300005347 Bacteria 1321
32 Ga0070668_101078902 3300005347 Bacteria 724
33 Ga0070669_100276702 3300005353 Bacteria 1344
34 Ga0070669_101285546 3300005353 Bacteria 633
35 Ga0070675_100261153 3300005354 Bacteria 1518
36 Ga0070675_100816278 3300005354 Bacteria 853
37 Ga0070671_100184723 3300005355 Bacteria 1766
38 Ga0070671_100345272 3300005355 Bacteria 1270
39 Ga0070671_100900415 3300005355 Bacteria 773
40 Ga0070671_101147891 3300005355 Bacteria 683
41 Ga0070674_100913096 3300005356 Bacteria 766
42 Ga0070688_100022321 3300005365 Bacteria 3706
43 Ga0070688_100878181 3300005365 Bacteria 706
44 Ga0070659_100209534 3300005366 Bacteria 1606
45 Ga0070659_100222114 3300005366 Bacteria 1559
46 Ga0070667_101241880 3300005367 Bacteria 698
47 Ga0070667_101553004 3300005367 Bacteria 622
48 Ga0070701_10929337 3300005438 Unclassified 602
49 Ga0070701_11060178 3300005438 Unclassified 568
50 Ga0070708_100634099 3300005445 Bacteria 1007
51 Ga0070708_101636832 3300005445 Bacteria 599
52 Ga0070663_100448319 3300005455 Bacteria 1063
53 Ga0070662_100000167 3300005457 Bacteria 38204
54 Ga0070662_100039895 3300005457 Bacteria 3342
55 Ga0070662_100222368 3300005457 Bacteria 1507
56 Ga0070662_100703294 3300005457 Bacteria 855
57 Ga0070681_10002689 3300005458 Bacteria 16345
58 Ga0070681_10674667 3300005458 Bacteria 949
59 Ga0068867_100356185 3300005459 Bacteria 1223
60 Ga0068867_101176434 3300005459 Bacteria 703
61 Ga0070685_11316755 3300005466 Bacteria 552
62 Ga0070707_100106749 3300005468 Bacteria 2716
63 Ga0070707_100793557 3300005468 Bacteria 911
64 Ga0070698_100003096 3300005471 Bacteria 18338
65 Ga0070679_100122321 3300005530 Bacteria 2587
66 Ga0070679_100128661 3300005530 Bacteria 2514
67 Ga0070684_100553477 3300005535 Bacteria 1068
68 Ga0070684_101342300 3300005535 Bacteria 673
69 Ga0070697_101608496 3300005536 Bacteria 581
70 Ga0068853_100176590 3300005539 Bacteria 1935
71 Ga0068853_100802020 3300005539 Bacteria 902
72 Ga0068853_100899497 3300005539 Bacteria 850
73 Ga0070672_100502833 3300005543 Bacteria 1049
74 Ga0070695_101632044 3300005545 Bacteria 539
75 Ga0070696_100146988 3300005546 Bacteria 1727
76 Ga0070704_100028704 3300005549 Bacteria 3705
77 Ga0068855_100035795 3300005563 Bacteria 5912
78 Ga0068855_100399816 3300005563 Bacteria 1506
79 Ga0070664_100103937 3300005564 Bacteria 2473
80 Ga0070664_100476897 3300005564 Bacteria 1148
81 Ga0070664_100929343 3300005564 Bacteria 816
82 Ga0070664_101701545 3300005564 Bacteria 598
83 Ga0070664_101911902 3300005564 Unclassified 563
84 Ga0068854_100213094 3300005578 Bacteria 1525
85 Ga0068854_100281472 3300005578 Bacteria 1339
86 Ga0068856_100861247 3300005614 Bacteria 925
87 Ga0068856_101053403 3300005614 Bacteria 831
88 Ga0070702_101005910 3300005615 Bacteria 660
89 Ga0068852_100328157 3300005616 Bacteria 1488
90 Ga0068852_101179860 3300005616 Bacteria 787
91 Ga0068859_100059793 3300005617 Bacteria 3839
92 Ga0068864_100076853 3300005618 Unclassified 2918
93 Ga0068864_101266824 3300005618 Bacteria 737
94 Ga0068864_101328444 3300005618 Bacteria 720
95 Ga0068864_102585614 3300005618 Bacteria 514
96 Ga0068861_100983511 3300005719 Unclassified 804
97 Ga0068851_10146427 3300005834 Bacteria 1288
98 Ga0068870_11362156 3300005840 Unclassified 519
99 Ga0068863_100063311 3300005841 Unclassified 3498
100 Ga0068863_100441273 3300005841 Bacteria 1277
101 Ga0068863_100456244 3300005841 Bacteria 1255
102 Ga0068858_100389803 3300005842 Bacteria 1337
103 Ga0068862_100211063 3300005844 Bacteria 1754
104 Ga0068862_100305080 3300005844 Unclassified 1466
105 Ga0068862_101797860 3300005844 Bacteria 622
106 Ga0097621_100468430 3300006237 Bacteria 1137
107 Ga0075431_100873009 3300006847 Bacteria 870
108 Ga0068865_101584017 3300006881 Bacteria 588
109 Ga0097620_100059790 3300006931 Bacteria 3839
110 Ga0111539_10388923 3300009094 Bacteria 1624
111 Ga0105247_10046290 3300009101 Bacteria 2670
112 Ga0105247_11088570 3300009101 Unclassified 630
113 Ga0105247_11728068 3300009101 Unclassified 518
114 Ga0105241_10524093 3300009174 Bacteria 1060
115 Ga0105241_10638949 3300009174 Bacteria 965
116 Ga0105248_10099186 3300009177 Bacteria 3282
117 Ga0105248_10330191 3300009177 Bacteria 1718
118 Ga0105248_10394209 3300009177 Bacteria 1559
119 Ga0105248_10408411 3300009177 Bacteria 1529
120 Ga0105248_12288452 3300009177 Bacteria 615
121 Ga0105238_10834097 3300009551 Bacteria 938
122 Ga0105249_10240598 3300009553 Unclassified 1789
123 Ga0105249_10287733 3300009553 Unclassified 1644
124 Ga0105249_10400346 3300009553 Bacteria 1403
125 Ga0105246_11213162 3300011119 Bacteria 695
126 Ga0157373_10265152 3300013100 Bacteria 1216
127 Ga0157373_10457567 3300013100 Bacteria 919
128 Ga0157373_11225213 3300013100 Bacteria 566
129 Ga0157374_10131459 3300013296 Bacteria 2423
130 Ga0157374_10240918 3300013296 Bacteria 1779
131 Ga0157374_10386347 3300013296 Bacteria 1395
132 Ga0157374_10611890 3300013296 Bacteria 1100
133 Ga0157378_10802868 3300013297 Unclassified 967
134 Ga0163162_10025661 3300013306 Bacteria 5826
135 Ga0163162_10502743 3300013306 Bacteria 1342
136 Ga0163162_10674591 3300013306 Bacteria 1156
137 Ga0163162_10904571 3300013306 Unclassified 996
138 Ga0157372_10071794 3300013307 Bacteria 3900
139 Ga0157372_11963523 3300013307 Bacteria 672
140 Ga0157375_10353654 3300013308 Bacteria 1635
141 Ga0157375_10551499 3300013308 Bacteria 1314
142 Ga0157375_11268226 3300013308 Bacteria 866
143 Ga0157375_11628408 3300013308 Bacteria 763
144 Ga0157375_11776214 3300013308 Bacteria 731
145 Ga0157375_12380744 3300013308 Bacteria 632
146 Ga0163163_10240173 3300014325 Bacteria 1861
147 Ga0163163_10452637 3300014325 Bacteria 1344
148 Ga0163163_10499968 3300014325 Unclassified 1278
149 Ga0157380_10074801 3300014326 Unclassified 2751
150 Ga0157380_10823709 3300014326 Bacteria 947
151 Ga0157377_10235623 3300014745 Bacteria 1179
152 Ga0157379_10471741 3300014968 Bacteria 1161
153 Ga0157376_11145206 3300014969 Bacteria 805
154 Ga0157376_11881061 3300014969 Unclassified 635
155 Ga0182005_1137055 3300015265 Bacteria 705
156 Ga0163161_10140970 3300017792 Bacteria 1825
157 Ga0163161_11489261 3300017792 Unclassified 594
158 Ga0213876_10077276 3300021384 Bacteria 1758
159 Ga0207656_10497120 3300025321 Bacteria 619
160 Ga0207682_10398969 3300025893 Bacteria 650
161 Ga0207710_10024123 3300025900 Bacteria 2617
162 Ga0207647_10001745 3300025904 Bacteria 16667
163 Ga0207645_10078357 3300025907 Bacteria 2117
164 Ga0207645_10195908 3300025907 Bacteria 1328
165 Ga0207705_10480734 3300025909 Bacteria 964
166 Ga0207705_10735582 3300025909 Bacteria 766
167 Ga0207705_11434821 3300025909 Bacteria 524
168 Ga0207654_10006365 3300025911 Bacteria 5938
169 Ga0207695_10025122 3300025913 Bacteria 6681
170 Ga0207662_10226864 3300025918 Unclassified 1218
171 Ga0207657_10020889 3300025919 Bacteria 6180
172 Ga0207657_10042596 3300025919 Bacteria 4004
173 Ga0207649_10500425 3300025920 Bacteria 924
174 Ga0207652_10139906 3300025921 Bacteria 2164
175 Ga0207646_10039911 3300025922 Bacteria 4224
176 Ga0207646_10141023 3300025922 Bacteria 2171
177 Ga0207681_10089086 3300025923 Bacteria 2199
178 Ga0207650_10098111 3300025925 Bacteria 2250
179 Ga0207650_10596784 3300025925 Bacteria 928
180 Ga0207650_10734205 3300025925 Bacteria 835
181 Ga0207644_10523692 3300025931 Unclassified 979
182 Ga0207644_10561223 3300025931 Bacteria 946
183 Ga0207644_10678817 3300025931 Bacteria 858
184 Ga0207644_10879479 3300025931 Unclassified 751
185 Ga0207644_11564184 3300025931 Bacteria 553
186 Ga0207690_10061115 3300025932 Bacteria 2560
187 Ga0207690_10107888 3300025932 Bacteria 2000
188 Ga0207706_10000257 3300025933 Bacteria 57965
189 Ga0207706_10244278 3300025933 Bacteria 1569
190 Ga0207670_10764563 3300025936 Unclassified 803
191 Ga0207669_10131224 3300025937 Bacteria 1722
192 Ga0207669_10523621 3300025937 Bacteria 952
193 Ga0207704_11035155 3300025938 Bacteria 696
194 Ga0207691_10029643 3300025940 Bacteria 5119
195 Ga0207691_10492176 3300025940 Bacteria 1042
196 Ga0207691_10738613 3300025940 Bacteria 829
197 Ga0207691_11515276 3300025940 Bacteria 548
198 Ga0207711_10242414 3300025941 Bacteria 1653
199 Ga0207711_10282931 3300025941 Bacteria 1527
200 Ga0207711_10586323 3300025941 Bacteria 1040
201 Ga0207689_10056453 3300025942 Bacteria 3232
202 Ga0207689_10244226 3300025942 Bacteria 1484
203 Ga0207689_10802495 3300025942 Bacteria 794
204 Ga0207661_10093032 3300025944 Bacteria 2515
205 Ga0207661_10159028 3300025944 Bacteria 1959
206 Ga0207661_10365482 3300025944 Bacteria 1304
207 Ga0207679_10238442 3300025945 Bacteria 1540
208 Ga0207679_11980214 3300025945 Bacteria 530
209 Ga0207667_10143731 3300025949 Bacteria 2456
210 Ga0207651_10712274 3300025960 Bacteria 885
211 Ga0207651_10738432 3300025960 Bacteria 869
212 Ga0207651_11434521 3300025960 Bacteria 621
213 Ga0207712_10486333 3300025961 Bacteria 1053
214 Ga0207668_10442021 3300025972 Bacteria 1108
215 Ga0207640_11328242 3300025981 Bacteria 643
216 Ga0207658_11938353 3300025986 Bacteria 536
217 Ga0207677_10098161 3300026023 Bacteria 2148
218 Ga0207703_10146992 3300026035 Bacteria 2051
219 Ga0207678_10405574 3300026067 Bacteria 1181
220 Ga0207641_10239234 3300026088 Unclassified 1691
221 Ga0207641_11172551 3300026088 Bacteria 767
222 Ga0207648_10415430 3300026089 Bacteria 1221
223 Ga0207676_10502832 3300026095 Bacteria 1151
224 Ga0207676_10956117 3300026095 Unclassified 842
225 Ga0207676_11587101 3300026095 Bacteria 652
226 Ga0207676_12072672 3300026095 Bacteria 567
227 Ga0207674_10072578 3300026116 Bacteria 3458
228 Ga0207675_100751335 3300026118 Unclassified 987
229 Ga0207683_10929454 3300026121 Bacteria 808
230 Ga0207698_10803038 3300026142 Bacteria 943
231 Ga0207428_10307209 3300027907 Bacteria 1173
232 Ga0268265_10050615 3300028380 Bacteria 3131
233 Ga0268265_10099896 3300028380 Bacteria 2340
234 Ga0268265_10134144 3300028380 Unclassified 2063
235 Ga0268264_10006019 3300028381 Bacteria 10265
236 Ga0307408_100112703 3300031548 Bacteria 2092
237 Ga0307408_100369752 3300031548 Bacteria 1222
238 Ga0307408_101813926 3300031548 Bacteria 583
239 Ga0307405_10051748 3300031731 Bacteria 2550
240 Ga0307405_10129888 3300031731 Bacteria 1739
241 Ga0307405_10294373 3300031731 Bacteria 1228
242 Ga0307405_10321590 3300031731 Bacteria 1182
243 Ga0307405_11020003 3300031731 Bacteria 707
244 Ga0307413_10001957 3300031824 Bacteria 8177
245 Ga0307413_10004681 3300031824 Bacteria 5996
246 Ga0307413_10067582 3300031824 Bacteria 2235
247 Ga0307413_10192759 3300031824 Bacteria 1465
248 Ga0307413_10327187 3300031824 Bacteria 1173
249 Ga0307413_10556221 3300031824 Bacteria 931
250 Ga0307413_11272438 3300031824 Bacteria 642
251 Ga0307410_10005928 3300031852 Bacteria 6534
252 Ga0307410_10010135 3300031852 Bacteria 5326
253 Ga0307410_10094113 3300031852 Bacteria 2133
254 Ga0307410_10202374 3300031852 Bacteria 1517
255 Ga0307410_10585375 3300031852 Bacteria 929
256 Ga0307410_11003532 3300031852 Bacteria 720
257 Ga0307410_11510345 3300031852 Unclassified 592
258 Ga0307406_10383374 3300031901 Bacteria 1109
259 Ga0307406_10424376 3300031901 Bacteria 1060
260 Ga0307406_11971531 3300031901 Bacteria 521
261 Ga0307407_10029624 3300031903 Bacteria 2943
262 Ga0307407_10800104 3300031903 Bacteria 717
263 Ga0307412_10025914 3300031911 Bacteria 3638
264 Ga0307412_10332360 3300031911 Bacteria 1213
265 Ga0307412_10443969 3300031911 Bacteria 1067
266 Ga0307412_11043934 3300031911 Bacteria 724
267 Ga0307409_100008994 3300031995 Bacteria 6107
268 Ga0307409_100015564 3300031995 Bacteria 4997
269 Ga0307409_100046936 3300031995 Bacteria 3273
270 Ga0307409_100048105 3300031995 Bacteria 3242
271 Ga0307409_100166939 3300031995 Bacteria 1933
272 Ga0307409_100316129 3300031995 Bacteria 1459
273 Ga0307409_100360482 3300031995 Unclassified 1375
274 Ga0307409_100472303 3300031995 Bacteria 1215
275 Ga0307409_100814653 3300031995 Bacteria 942
276 Ga0307409_101369733 3300031995 Bacteria 733
277 Ga0307416_100263853 3300032002 Bacteria 1685
278 Ga0307416_101250149 3300032002 Bacteria 848
279 Ga0307416_101276499 3300032002 Bacteria 840
280 Ga0307414_10014852 3300032004 Bacteria 4684
281 Ga0307414_10055788 3300032004 Bacteria 2768
282 Ga0307414_10061430 3300032004 Bacteria 2662
283 Ga0307414_11098664 3300032004 Bacteria 734
284 Ga0307414_11206948 3300032004 Bacteria 700
285 Ga0307414_11239250 3300032004 Bacteria 691
286 Ga0307414_11422181 3300032004 Bacteria 645
287 Ga0307411_10010954 3300032005 Bacteria 4864
288 Ga0307411_10101345 3300032005 Bacteria 2037
289 Ga0307411_10142787 3300032005 Bacteria 1767
290 Ga0307411_10252841 3300032005 Unclassified 1387
291 Ga0307411_10277899 3300032005 Bacteria 1331
292 Ga0307411_11505720 3300032005 Bacteria 618
293 Ga0307415_100013628 3300032126 Bacteria 4752
294 Ga0307415_101613053 3300032126 Bacteria 624
295 Ga0395905_1020030 3300037471 Bacteria 731
296 Ga0436365_0563357 3300039437 Bacteria 3593
297 Ga0451798_0965973 3300041458 Bacteria 533
298 Ga0451804_0509903 3300041463 Bacteria 541
299 Ga0451807_1216529 3300041486 Bacteria 763
300 Ga0453684_0251174 3300044712 Bacteria 2031
301 Ga0495666_0030072 3300046526 Bacteria 2668
302 Ga0495647_0016253 3300046681 Bacteria 2617
303 Ga0496123_0007381 3300048926 Bacteria 10389
304 Ga0496126_0000019 3300048929 Bacteria 564723
305 Ga0501249_201408 3300049679 Bacteria 523
306 nmdc:mga08y16_223117_c1 3300050511 Bacteria 1950
307 2896431422 2896429255 Bacteria 2557483
308 Ga0070659_100857459
309 SwRhRL2b_contig_488007
310 JGI24737J22298_10042284
311 Ga0065704_10207795
312 Ga0065715_10970484
313 Ga0065707_10107886
314 Ga0065707_10124146
315 Ga0070658_10231553
316 Ga0070658_10254549
317 Ga0070658_11871320
318 Ga0070676_10111933
319 Ga0070683_100110118
320 Ga0070683_100201948
321 Ga0070690_100908527
322 Ga0070670_100134280
323 Ga0070670_100662985
324 Ga0068869_100063607
325 Ga0068869_101506690
326 Ga0070682_101071976
327 Ga0068868_100017545
328 Ga0068868_100624478
329 Ga0070660_100054725
330 Ga0070660_100947891
331 Ga0070660_101042183
332 Ga0070687_100336829
333 Ga0070661_100058429
334 Ga0070661_100076076
335 Ga0070661_100392380
336 Ga0070661_100841855
337 Ga0070661_101084033
338 Ga0070668_100312446
339 Ga0070668_101078902
340 Ga0070669_100276702
341 Ga0070669_101285546
342 Ga0070675_100261153
343 Ga0070675_100816278
344 Ga0070671_100184723
345 Ga0070671_100345272
346 Ga0070671_100900415
347 Ga0070671_101147891
348 Ga0070674_100913096
349 Ga0070688_100022321
350 Ga0070688_100878181
351 Ga0070659_100209534
352 Ga0070659_100222114
353 Ga0070667_101241880
354 Ga0070667_101553004
355 Ga0070701_10929337
356 Ga0070701_11060178
357 Ga0070708_100634099
358 Ga0070708_101636832
359 Ga0070663_100448319
360 Ga0070662_100000167
361 Ga0070662_100039895
362 Ga0070662_100222368
363 Ga0070662_100703294
364 Ga0070681_10002689
365 Ga0070681_10674667
366 Ga0068867_100356185
367 Ga0068867_101176434
368 Ga0070685_11316755
369 Ga0070707_100106749
370 Ga0070707_100793557
371 Ga0070698_100003096
372 Ga0070679_100122321
373 Ga0070679_100128661
374 Ga0070684_100553477
375 Ga0070684_101342300
376 Ga0070697_101608496
377 Ga0068853_100176590
378 Ga0068853_100802020
379 Ga0068853_100899497
380 Ga0070672_100502833
381 Ga0070695_101632044
382 Ga0070696_100146988
383 Ga0070704_100028704
384 Ga0068855_100035795
385 Ga0068855_100399816
386 Ga0070664_100103937
387 Ga0070664_100476897
388 Ga0070664_100929343
389 Ga0070664_101701545
390 Ga0070664_101911902
391 Ga0068854_100213094
392 Ga0068854_100281472
393 Ga0068856_100861247
394 Ga0068856_101053403
395 Ga0070702_101005910
396 Ga0068852_100328157
397 Ga0068852_101179860
398 Ga0068859_100059793
399 Ga0068864_100076853
400 Ga0068864_101266824
401 Ga0068864_101328444
402 Ga0068864_102585614
403 Ga0068861_100983511
404 Ga0068851_10146427
405 Ga0068870_11362156
406 Ga0068863_100063311
407 Ga0068863_100441273
408 Ga0068863_100456244
409 Ga0068858_100389803
410 Ga0068862_100211063
411 Ga0068862_100305080
412 Ga0068862_101797860
413 Ga0097621_100468430
414 Ga0075431_100873009
415 Ga0068865_101584017
416 Ga0097620_100059790
417 Ga0111539_10388923
418 Ga0105247_10046290
419 Ga0105247_11088570
420 Ga0105247_11728068
421 Ga0105241_10524093
422 Ga0105241_10638949
423 Ga0105248_10099186
424 Ga0105248_10330191
425 Ga0105248_10394209
426 Ga0105248_10408411
427 Ga0105248_12288452
428 Ga0105238_10834097
429 Ga0105249_10240598
430 Ga0105249_10287733
431 Ga0105249_10400346
432 Ga0105246_11213162
433 Ga0157373_10265152
434 Ga0157373_10457567
435 Ga0157373_11225213
436 Ga0157374_10131459
437 Ga0157374_10240918
438 Ga0157374_10386347
439 Ga0157374_10611890
440 Ga0157378_10802868
441 Ga0163162_10025661
442 Ga0163162_10502743
443 Ga0163162_10674591
444 Ga0163162_10904571
445 Ga0157372_10071794
446 Ga0157372_11963523
447 Ga0157375_10353654
448 Ga0157375_10551499
449 Ga0157375_11268226
450 Ga0157375_11628408
451 Ga0157375_11776214
452 Ga0157375_12380744
453 Ga0163163_10240173
454 Ga0163163_10452637
455 Ga0163163_10499968
456 Ga0157380_10074801
457 Ga0157380_10823709
458 Ga0157377_10235623
459 Ga0157379_10471741
460 Ga0157376_11145206
461 Ga0157376_11881061
462 Ga0182005_1137055
463 Ga0163161_10140970
464 Ga0163161_11489261
465 Ga0213876_10077276
466 Ga0207656_10497120
467 Ga0207682_10398969
468 Ga0207710_10024123
469 Ga0207647_10001745
470 Ga0207645_10078357
471 Ga0207645_10195908
472 Ga0207705_10480734
473 Ga0207705_10735582
474 Ga0207705_11434821
475 Ga0207654_10006365
476 Ga0207695_10025122
477 Ga0207662_10226864
478 Ga0207657_10020889
479 Ga0207657_10042596
480 Ga0207649_10500425
481 Ga0207652_10139906
482 Ga0207646_10039911
483 Ga0207646_10141023
484 Ga0207681_10089086
485 Ga0207650_10098111
486 Ga0207650_10596784
487 Ga0207650_10734205
488 Ga0207644_10523692
489 Ga0207644_10561223
490 Ga0207644_10678817
491 Ga0207644_10879479
492 Ga0207644_11564184
493 Ga0207690_10061115
494 Ga0207690_10107888
495 Ga0207706_10000257
496 Ga0207706_10244278
497 Ga0207670_10764563
498 Ga0207669_10131224
499 Ga0207669_10523621
500 Ga0207704_11035155
501 Ga0207691_10029643
502 Ga0207691_10492176
503 Ga0207691_10738613
504 Ga0207691_11515276
505 Ga0207711_10242414
506 Ga0207711_10282931
507 Ga0207711_10586323
508 Ga0207689_10056453
509 Ga0207689_10244226
510 Ga0207689_10802495
511 Ga0207661_10093032
512 Ga0207661_10159028
513 Ga0207661_10365482
514 Ga0207679_10238442
515 Ga0207679_11980214
516 Ga0207667_10143731
517 Ga0207651_10712274
518 Ga0207651_10738432
519 Ga0207651_11434521
520 Ga0207712_10486333
521 Ga0207668_10442021
522 Ga0207640_11328242
523 Ga0207658_11938353
524 Ga0207677_10098161
525 Ga0207703_10146992
526 Ga0207678_10405574
527 Ga0207641_10239234
528 Ga0207641_11172551
529 Ga0207648_10415430
530 Ga0207676_10502832
531 Ga0207676_10956117
532 Ga0207676_11587101
533 Ga0207676_12072672
534 Ga0207674_10072578
535 Ga0207675_100751335
536 Ga0207683_10929454
537 Ga0207698_10803038
538 Ga0207428_10307209
539 Ga0268265_10050615
540 Ga0268265_10099896
541 Ga0268265_10134144
542 Ga0268264_10006019
543 Ga0307408_100112703
544 Ga0307408_100369752
545 Ga0307408_101813926
546 Ga0307405_10051748
547 Ga0307405_10129888
548 Ga0307405_10294373
549 Ga0307405_10321590
550 Ga0307405_11020003
551 Ga0307413_10001957
552 Ga0307413_10004681
553 Ga0307413_10067582
554 Ga0307413_10192759
555 Ga0307413_10327187
556 Ga0307413_10556221
557 Ga0307413_11272438
558 Ga0307410_10005928
559 Ga0307410_10010135
560 Ga0307410_10094113
561 Ga0307410_10202374
562 Ga0307410_10585375
563 Ga0307410_11003532
564 Ga0307410_11510345
565 Ga0307406_10383374
566 Ga0307406_10424376
567 Ga0307406_11971531
568 Ga0307407_10029624
569 Ga0307407_10800104
570 Ga0307412_10025914
571 Ga0307412_10332360
572 Ga0307412_10443969
573 Ga0307412_11043934
574 Ga0307409_100008994
575 Ga0307409_100015564
576 Ga0307409_100046936
577 Ga0307409_100048105
578 Ga0307409_100166939
579 Ga0307409_100316129
580 Ga0307409_100360482
581 Ga0307409_100472303
582 Ga0307409_100814653
583 Ga0307409_101369733
584 Ga0307416_100263853
585 Ga0307416_101250149
586 Ga0307416_101276499
587 Ga0307414_10014852
588 Ga0307414_10055788
589 Ga0307414_10061430
590 Ga0307414_11098664
591 Ga0307414_11206948
592 Ga0307414_11239250
593 Ga0307414_11422181
594 Ga0307411_10010954
595 Ga0307411_10101345
596 Ga0307411_10142787
597 Ga0307411_10252841
598 Ga0307411_10277899
599 Ga0307411_11505720
600 Ga0307415_100013628
601 Ga0307415_101613053
602 Ga0395905_1020030
603 Ga0436365_0563357
604 Ga0451798_0965973
605 Ga0451804_0509903
606 Ga0451807_1216529
607 Ga0453684_0251174
608 Ga0495666_0030072
609 Ga0495647_0016253
610 Ga0496123_0007381
611 Ga0496126_0000019
612 Ga0501249_201408
613 nmdc:mga08y16_223117_c1
614 2896431422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

23

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9404 3 114
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.8876 3 114
4fx4-assembly1.cif.gz_A crystal structure of m. tuberculosis transcriptional regulator mosr (rv1049) in compex with dna 0.2426 13 107
4e91-assembly1.cif.gz_A crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bd3 0.2399 13 115
7xdk-assembly1.cif.gz_A cryo-em structure of sars-cov-2 delta spike protein in complex with ba7054 and ba7125 fab 0.2294 15 114
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9231 1 114 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8716 1 114 1.10.8.290
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.754 9 114 1.10.8.10
af_P0ACC1_1_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.707 9 117 1.10.8.10
1nv8B01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.6907 11 114 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A1W6VMU7-F1-model_v4 deleted 0.9987 33 116
AF-A0A1E4ACD0-F1-model_v4 deleted 0.9956 4 116
AF-W5Y1I0-F1-model_v4 DUF2200 domain-containing protein 0.9942 4 115
AF-A0A239SPK5-F1-model_v4 Lin0147 0.9936 4 115
AF-A0A1H3YTD1-F1-model_v4 DUF2200 domain-containing protein 0.9926 9 116

Map