F399029

General Info

Members Datasets Scaffolds Average Seq Length
307 188 301 152

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100051872|Ga0070688_1000518721
Length 164
Sequence MKTEIAVNIRKGTKEDLPAILQLVHELAEFEKAPDAITNTLSMMEEEGFGKRPVFEFYVAEKDGEVIGMALFFVKYSTWKGAGLYLDDLIVREKYRGAGIGTKLFNTYLLEAKRMNAKQAHWQVLDWNTPAIDMYKKAGASVEAEWLDCKMNEEEIQAYLDKLN

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
6 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 1.63
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1164358 2162886011 Bacteria 1557
2 JGI25162J39368_1001073 3300002737 Bacteria 16670
3 JGI25164J39214_1001966 3300002772 Bacteria 3726
4 JGI25165J46597_1000620 3300003214 Bacteria 29837
5 rootH2_10176895 3300003320 Bacteria 2929
6 rootH2_10200857 3300003320 Bacteria 1581
7 rootL2_10319166 3300003322 Bacteria 1676
8 rootH1_10002605 3300003323 Bacteria 51064
9 Ga0065714_10002345 3300005288 Bacteria 23040
10 Ga0065712_10101260 3300005290 Bacteria 2032
11 Ga0065715_10569353 3300005293 Bacteria 719
12 Ga0065707_10131820 3300005295 Bacteria 1907
13 Ga0070658_10025762 3300005327 Bacteria 4714
14 Ga0070658_10059174 3300005327 Unclassified 3120
15 Ga0070658_10062211 3300005327 Bacteria 3042
16 Ga0070676_10043221 3300005328 Bacteria 2618
17 Ga0070676_10070805 3300005328 Bacteria 2093
18 Ga0070670_100037549 3300005331 Bacteria 4167
19 Ga0070670_100314614 3300005331 Bacteria 1371
20 Ga0068869_100028124 3300005334 Bacteria 3925
21 Ga0068869_100053585 3300005334 Bacteria 2934
22 Ga0070666_10081627 3300005335 Unclassified 2210
23 Ga0070680_100472892 3300005336 Bacteria 1071
24 Ga0068868_100007788 3300005338 Bacteria 7646
25 Ga0068868_100094965 3300005338 Bacteria 2406
26 Ga0068868_100313440 3300005338 Bacteria 1335
27 Ga0070660_100038196 3300005339 Bacteria 3643
28 Ga0070689_100031523 3300005340 Bacteria 4029
29 Ga0070692_10156446 3300005345 Bacteria 1302
30 Ga0070668_100063560 3300005347 Unclassified 2861
31 Ga0070668_100120628 3300005347 Bacteria 2095
32 Ga0070669_100039369 3300005353 Bacteria 3435
33 Ga0070675_100089363 3300005354 Bacteria 2579
34 Ga0070675_100118612 3300005354 Bacteria 2246
35 Ga0070671_100060106 3300005355 Bacteria 3164
36 Ga0070673_100059003 3300005364 Bacteria 3036
37 Ga0070673_100456098 3300005364 Bacteria 1151
38 Ga0070673_100928588 3300005364 Bacteria 808
39 Ga0070688_100051872 3300005365 Bacteria 2560
40 Ga0070688_100079030 3300005365 Bacteria 2124
41 Ga0070688_100668010 3300005365 Bacteria 802
42 Ga0070659_100000578 3300005366 Bacteria 26773
43 Ga0070659_100038444 3300005366 Bacteria 3732
44 Ga0070667_100919438 3300005367 Bacteria 815
45 Ga0070709_10621249 3300005434 Bacteria 834
46 Ga0070701_10095775 3300005438 Bacteria 1635
47 Ga0070700_100513102 3300005441 Bacteria 924
48 Ga0070678_100956277 3300005456 Unclassified 785
49 Ga0070662_100031860 3300005457 Bacteria 3703
50 Ga0070662_100804085 3300005457 Bacteria 799
51 Ga0068867_100039025 3300005459 Bacteria 3460
52 Ga0068867_101257285 3300005459 Unclassified 682
53 Ga0068867_101707823 3300005459 Bacteria 590
54 Ga0070685_10077243 3300005466 Bacteria 1988
55 Ga0070685_10150268 3300005466 Bacteria 1475
56 Ga0070685_11116470 3300005466 Bacteria 596
57 Ga0070679_100000065 3300005530 Bacteria 78829
58 Ga0070679_100154721 3300005530 Bacteria 2268
59 Ga0068853_100603809 3300005539 Unclassified 1042
60 Ga0070672_100034270 3300005543 Bacteria 3853
61 Ga0070672_100034431 3300005543 Bacteria 3844
62 Ga0070695_101100677 3300005545 Unclassified 650
63 Ga0070665_100194624 3300005548 Unclassified 2028
64 Ga0068855_100005888 3300005563 Bacteria 14948
65 Ga0068857_100082058 3300005577 Bacteria 2880
66 Ga0068852_100208515 3300005616 Unclassified 1852
67 Ga0068859_100187153 3300005617 Bacteria 2154
68 Ga0068859_101755908 3300005617 Unclassified 685
69 Ga0068864_100731399 3300005618 Bacteria 969
70 Ga0068866_10022089 3300005718 Bacteria 2941
71 Ga0068866_10051007 3300005718 Unclassified 2104
72 Ga0068861_100014105 3300005719 Bacteria 5603
73 Ga0068861_100083422 3300005719 Bacteria 2507
74 Ga0068861_100773300 3300005719 Unclassified 899
75 Ga0068851_10011219 3300005834 Bacteria 4197
76 Ga0068870_10054065 3300005840 Unclassified 2134
77 Ga0068863_100053489 3300005841 Bacteria 3827
78 Ga0068863_100071430 3300005841 Bacteria 3284
79 Ga0068860_100059491 3300005843 Bacteria 3632
80 Ga0068860_100131825 3300005843 Bacteria 2399
81 Ga0068860_100219502 3300005843 Bacteria 1846
82 Ga0068860_100297155 3300005843 Unclassified 1581
83 Ga0068860_100580590 3300005843 Unclassified 1125
84 Ga0068860_101089255 3300005843 Unclassified 818
85 Ga0068860_101408465 3300005843 Unclassified 718
86 Ga0068862_100090465 3300005844 Bacteria 2664
87 Ga0068862_100170156 3300005844 Unclassified 1950
88 Ga0075366_10161905 3300006195 Bacteria 1356
89 Ga0097621_100162138 3300006237 Unclassified 1922
90 Ga0097621_100196821 3300006237 Unclassified 1748
91 Ga0097621_100414680 3300006237 Bacteria 1208
92 Ga0068871_100062196 3300006358 Unclassified 3050
93 Ga0068871_100081511 3300006358 Bacteria 2681
94 Ga0068871_100571451 3300006358 Unclassified 1026
95 Ga0068865_100067193 3300006881 Bacteria 2531
96 Ga0068865_100279142 3300006881 Unclassified 1329
97 Ga0097620_100187143 3300006931 Bacteria 2154
98 Ga0097620_101755919 3300006931 Unclassified 685
99 Ga0105240_10952365 3300009093 Bacteria 921
100 Ga0111539_10053504 3300009094 Bacteria 4805
101 Ga0105243_11054419 3300009148 Bacteria 819
102 Ga0105241_10352225 3300009174 Unclassified 1279
103 Ga0105242_10079244 3300009176 Bacteria 2743
104 Ga0105242_10497081 3300009176 Bacteria 1159
105 Ga0105248_10977048 3300009177 Bacteria 956
106 Ga0105237_10009171 3300009545 Bacteria 10626
107 Ga0105237_10565432 3300009545 Bacteria 1144
108 Ga0105238_10228288 3300009551 Bacteria 1838
109 Ga0105249_10056335 3300009553 Bacteria 3598
110 Ga0105249_10066174 3300009553 Bacteria 3327
111 Ga0105249_10172402 3300009553 Bacteria 2099
112 Ga0105239_11493438 3300010375 Unclassified 781
113 Ga0105246_10396652 3300011119 Bacteria 1145
114 Ga0157373_10000269 3300013100 Bacteria 41858
115 Ga0157373_10038377 3300013100 Bacteria 3433
116 Ga0157373_10053930 3300013100 Bacteria 2858
117 Ga0157371_10002200 3300013102 Bacteria 18914
118 Ga0157371_10004323 3300013102 Bacteria 12455
119 Ga0157371_10009843 3300013102 Bacteria 7491
120 Ga0157371_10026643 3300013102 Bacteria 4199
121 Ga0157371_10134146 3300013102 Bacteria 1763
122 Ga0157370_10098784 3300013104 Bacteria 2737
123 Ga0157370_11141246 3300013104 Bacteria 704
124 Ga0157374_10101442 3300013296 Bacteria 2759
125 Ga0157378_10013242 3300013297 Bacteria 7212
126 Ga0157378_10244544 3300013297 Bacteria 1715
127 Ga0157378_10349755 3300013297 Bacteria 1443
128 Ga0157372_10004146 3300013307 Bacteria 15520
129 Ga0157372_10009422 3300013307 Bacteria 10390
130 Ga0157372_10135920 3300013307 Bacteria 2831
131 Ga0157372_10464283 3300013307 Bacteria 1475
132 Ga0157372_11411219 3300013307 Bacteria 803
133 Ga0157372_11599738 3300013307 Bacteria 750
134 Ga0157375_10026401 3300013308 Bacteria 5412
135 Ga0157375_10238063 3300013308 Bacteria 1980
136 Ga0157380_10056150 3300014326 Bacteria 3130
137 Ga0182008_10000009 3300014497 Bacteria 331416
138 Ga0157377_10008684 3300014745 Bacteria 4962
139 Ga0157376_10050227 3300014969 Bacteria 3459
140 Ga0182005_1000209 3300015265 Bacteria 38801
141 Ga0209436_103192 3300025208 Bacteria 4473
142 Ga0207427_100106 3300025231 Bacteria 117041
143 Ga0209437_100226 3300025233 Bacteria 100303
144 Ga0209233_1000089 3300025261 Bacteria 316381
145 Ga0207426_1044687 3300025302 Bacteria 1353
146 Ga0207697_10163187 3300025315 Bacteria 973
147 Ga0207642_10307947 3300025899 Bacteria 921
148 Ga0207688_10009523 3300025901 Bacteria 5288
149 Ga0207680_10218522 3300025903 Unclassified 1305
150 Ga0207647_10271450 3300025904 Bacteria 970
151 Ga0207645_10004421 3300025907 Bacteria 10404
152 Ga0207645_10019079 3300025907 Bacteria 4503
153 Ga0207643_10005242 3300025908 Bacteria 6932
154 Ga0207643_10014704 3300025908 Bacteria 4256
155 Ga0207705_10296248 3300025909 Bacteria 1240
156 Ga0207705_10329142 3300025909 Bacteria 1175
157 Ga0207671_10000827 3300025914 Bacteria 39300
158 Ga0207671_10399916 3300025914 Bacteria 1092
159 Ga0207657_10032094 3300025919 Bacteria 4749
160 Ga0207652_10000013 3300025921 Bacteria 222247
161 Ga0207681_10047102 3300025923 Bacteria 2902
162 Ga0207681_10130743 3300025923 Unclassified 1856
163 Ga0207694_11453086 3300025924 Bacteria 579
164 Ga0207650_10008302 3300025925 Bacteria 7090
165 Ga0207650_10262682 3300025925 Bacteria 1401
166 Ga0207659_10120026 3300025926 Bacteria 2013
167 Ga0207659_10134094 3300025926 Bacteria 1915
168 Ga0207659_10690943 3300025926 Bacteria 873
169 Ga0207644_10049826 3300025931 Bacteria 3000
170 Ga0207690_10001498 3300025932 Bacteria 14585
171 Ga0207706_10012385 3300025933 Bacteria 7768
172 Ga0207686_10749772 3300025934 Bacteria 779
173 Ga0207670_10101491 3300025936 Bacteria 2056
174 Ga0207704_10297524 3300025938 Bacteria 1235
175 Ga0207704_10297723 3300025938 Unclassified 1234
176 Ga0207691_10019220 3300025940 Bacteria 6468
177 Ga0207691_10051663 3300025940 Bacteria 3757
178 Ga0207689_10013336 3300025942 Bacteria 7012
179 Ga0207689_10025742 3300025942 Unclassified 4929
180 Ga0207689_10095766 3300025942 Unclassified 2438
181 Ga0207689_10662067 3300025942 Bacteria 880
182 Ga0207667_11264573 3300025949 Bacteria 715
183 Ga0207651_10491400 3300025960 Bacteria 1059
184 Ga0207651_10552954 3300025960 Bacteria 1001
185 Ga0207712_10198773 3300025961 Bacteria 1588
186 Ga0207712_11272326 3300025961 Bacteria 657
187 Ga0207668_10135786 3300025972 Unclassified 1884
188 Ga0207640_10153145 3300025981 Bacteria 1696
189 Ga0207658_10261401 3300025986 Bacteria 1475
190 Ga0207658_10326279 3300025986 Unclassified 1330
191 Ga0207658_10783591 3300025986 Bacteria 865
192 Ga0207677_10034978 3300026023 Bacteria 3258
193 Ga0207677_10212950 3300026023 Bacteria 1544
194 Ga0207639_10086513 3300026041 Bacteria 2496
195 Ga0207639_10115509 3300026041 Bacteria 2195
196 Ga0207708_10574305 3300026075 Bacteria 953
197 Ga0207641_10021980 3300026088 Bacteria 5246
198 Ga0207641_10176174 3300026088 Bacteria 1955
199 Ga0207648_10159083 3300026089 Bacteria 1995
200 Ga0207648_10480893 3300026089 Bacteria 1134
201 Ga0207648_11750414 3300026089 Bacteria 583
202 Ga0207648_11840612 3300026089 Unclassified 567
203 Ga0207674_10059366 3300026116 Bacteria 3871
204 Ga0207674_10322350 3300026116 Bacteria 1494
205 Ga0207675_100000124 3300026118 Bacteria 63805
206 Ga0207675_100234220 3300026118 Bacteria 1772
207 Ga0207675_100527933 3300026118 Bacteria 1177
208 Ga0207683_10010510 3300026121 Bacteria 7897
209 Ga0207698_10203123 3300026142 Bacteria 1776
210 Ga0207698_10209173 3300026142 Bacteria 1754
211 Ga0209995_1084061 3300027471 Bacteria 547
212 Ga0207428_10115480 3300027907 Bacteria 2062
213 Ga0268266_10097525 3300028379 Unclassified 2585
214 Ga0268264_10193932 3300028381 Bacteria 1853
215 Ga0268264_10269666 3300028381 Unclassified 1590
216 Ga0268264_10393620 3300028381 Bacteria 1330
217 Ga0268264_10425184 3300028381 Bacteria 1282
218 Ga0307512_10186638 3300030522 Bacteria 1153
219 Ga0307516_10000786 3300031730 Bacteria 43327
220 Ga0307405_11039669 3300031731 Bacteria 701
221 Ga0307410_10047477 3300031852 Bacteria 2870
222 Ga0307414_10363547 3300032004 Bacteria 1246
223 Ga0307414_11808584 3300032004 Unclassified 570
224 Ga0395899_0027671 3300037312 Bacteria 4272
225 Ga0395899_0084609 3300037312 Bacteria 2305
226 Ga0395899_0503327 3300037312 Bacteria 785
227 Ga0395900_0001378 3300037418 Bacteria 29221
228 Ga0395900_0170532 3300037418 Bacteria 2216
229 Ga0395900_0266320 3300037418 Bacteria 1709
230 Ga0395900_0758079 3300037418 Bacteria 900
231 Ga0395898_0001155 3300037466 Bacteria 40306
232 Ga0395898_0258567 3300037466 Bacteria 1660
233 Ga0395905_0450222 3300037471 Bacteria 1185
234 Ga0395901_0009161 3300038443 Bacteria 10027
235 Ga0395901_0554261 3300038443 Bacteria 1164
236 Ga0439439_0136824 3300041406 Bacteria 690
237 Ga0451789_0947215 3300041443 Bacteria 606
238 Ga0451793_1576346 3300041452 Bacteria 560
239 Ga0451807_0030291 3300041486 Bacteria 673
240 Ga0439431_0000125 3300041997 Bacteria 13494
241 Ga0439445_0022661 3300042004 Bacteria 1585
242 Ga0439449_0003148 3300042007 Bacteria 6421
243 Ga0439457_019459 3300042014 Unclassified 1508
244 Ga0439446_0256872 3300042156 Bacteria 604
245 Ga0466966_0000162 3300044684 Bacteria 43660
246 Ga0466961_0526279 3300044693 Bacteria 713
247 Ga0466968_0056258 3300044735 Bacteria 1689
248 Ga0466970_0336493 3300044765 Bacteria 855
249 Ga0466957_0000105 3300044842 Bacteria 34390
250 Ga0466960_0182909 3300044901 Bacteria 1137
251 Ga0466959_0000077 3300045049 Bacteria 62293
252 Ga0495585_0000031 3300046492 Bacteria 143899
253 Ga0495644_0011577 3300046523 Bacteria 3395
254 Ga0495661_0005768 3300046665 Bacteria 8758
255 Ga0495589_0034180 3300046794 Bacteria 2553
256 Ga0495687_003643 3300047443 Bacteria 10986
257 Ga0496104_0673702 3300048907 Unclassified 943
258 Ga0501031_0025910 3300049568 Bacteria 3825
259 Ga0501032_0233720 3300049569 Bacteria 1195
260 Ga0501034_0002458 3300049571 Bacteria 22331
261 Ga0501034_0012297 3300049571 Bacteria 8841
262 Ga0501034_0054369 3300049571 Bacteria 4031
263 Ga0501034_0501245 3300049571 Bacteria 1128
264 Ga0501037_0008662 3300049573 Bacteria 7460
265 Ga0501037_0048064 3300049573 Bacteria 3127
266 Ga0501037_0072321 3300049573 Bacteria 2508
267 Ga0501037_0186079 3300049573 Bacteria 1472
268 Ga0501037_0318273 3300049573 Bacteria 1078
269 Ga0501038_0030126 3300049574 Bacteria 4805
270 Ga0501038_0032641 3300049574 Bacteria 4592
271 Ga0501039_0025681 3300049575 Bacteria 4527
272 Ga0501039_0098135 3300049575 Unclassified 2285
273 Ga0501039_0242108 3300049575 Bacteria 1418
274 Ga0501043_0005990 3300049579 Bacteria 9773
275 Ga0501043_0008603 3300049579 Bacteria 8044
276 Ga0501043_0017398 3300049579 Bacteria 5635
277 Ga0501043_0063013 3300049579 Bacteria 2912
278 Ga0501046_0052201 3300049580 Bacteria 3222
279 Ga0501047_0078084 3300049581 Bacteria 3184
280 Ga0501047_0191791 3300049581 Bacteria 1906
281 Ga0501047_0815125 3300049581 Bacteria 748
282 Ga0501070_0093112 3300049586 Bacteria 2493
283 Ga0501073_0010670 3300049589 Bacteria 6726
284 Ga0501074_0000952 3300049590 Bacteria 18706
285 Ga0501080_0048501 3300049742 Bacteria 3952
286 Ga0501083_0005031 3300049744 Bacteria 9362
287 Ga0501035_0010700 3300049822 Bacteria 8492
288 Ga0501035_0040817 3300049822 Bacteria 4192
289 Ga0501035_0201198 3300049822 Bacteria 1708
290 Ga0501035_0288559 3300049822 Unclassified 1385
291 Ga0501044_0003711 3300049823 Bacteria 17152
292 Ga0501044_0008589 3300049823 Bacteria 11188
293 Ga0501044_0048320 3300049823 Unclassified 4395
294 Ga0501044_0267297 3300049823 Bacteria 1647
295 Ga0501044_0524547 3300049823 Bacteria 1084
296 Ga0501045_0576171 3300049824 Bacteria 834
297 nmdc:mga0k408_156744_c1 3300050493 Bacteria 1356
298 nmdc:mga08y16_8765_c1 3300050511 Bacteria 10613
299 Ga0500583_0017376 3300053092 Bacteria 2897
300 Ga0500568_0007295 3300053139 Bacteria 5437
301 Ga0500622_0106683 3300053156 Bacteria 1373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2890737413 2890740491 145
2 3300005466 Ga0070685_11116470 Ga0070685_111164701 147
3 3300031730 Ga0307516_10000786 Ga0307516_100007862 147
4 3300053139 Ga0500568_0007295 Ga0500568_0007295_4683_5141 147
5 iso_pu_bacteria 2599185184 2599476850 147
6 iso_pu_bacteria 2852623160 2852623695 147
7 iso_pu_bacteria 2884933994 2884937399 147
8 iso_pu_bacteria 2896085136 2896087392 147
9 iso_pu_bacteria 2932082852 2932085423 147
10 3300003322 rootL2_10319166 rootL2_103191663 148
11 3300005616 Ga0068852_100208515 Ga0068852_1002085153 148
12 3300006237 Ga0097621_100196821 Ga0097621_1001968211 148
13 3300009093 Ga0105240_10952365 Ga0105240_109523651 148
14 3300009545 Ga0105237_10009171 Ga0105237_100091712 148
15 3300025904 Ga0207647_10271450 Ga0207647_102714502 148
16 3300025914 Ga0207671_10000827 Ga0207671_1000082727 148
17 3300026142 Ga0207698_10203123 Ga0207698_102031232 148
18 3300041997 Ga0439431_0000125 Ga0439431_0000125_6765_7211 148
19 3300042004 Ga0439445_0022661 Ga0439445_0022661_737_1183 148
20 3300049571 Ga0501034_0501245 Ga0501034_0501245_217_663 148
21 3300053092 Ga0500583_0017376 Ga0500583_0017376_2358_2825 148
22 2162886011 MRS1b_contig_1164358 MRS1b_0861.00002780 149
23 3300002737 JGI25162J39368_1001073 JGI25162J39368_100107311 149
24 3300002772 JGI25164J39214_1001966 JGI25164J39214_10019662 149
25 3300003214 JGI25165J46597_1000620 JGI25165J46597_100062025 149
26 3300003320 rootH2_10176895 rootH2_101768952 149
27 3300003320 rootH2_10200857 rootH2_102008572 149
28 3300003323 rootH1_10002605 rootH1_1000260511 149
29 3300005288 Ga0065714_10002345 Ga0065714_1000234513 149
30 3300005290 Ga0065712_10101260 Ga0065712_101012602 149
31 3300005293 Ga0065715_10569353 Ga0065715_105693532 149
32 3300005295 Ga0065707_10131820 Ga0065707_101318202 149
33 3300005327 Ga0070658_10025762 Ga0070658_100257624 149
34 3300005327 Ga0070658_10059174 Ga0070658_100591744 149
35 3300005327 Ga0070658_10062211 Ga0070658_100622112 149
36 3300005328 Ga0070676_10043221 Ga0070676_100432212 149
37 3300005328 Ga0070676_10070805 Ga0070676_100708052 149
38 3300005331 Ga0070670_100037549 Ga0070670_1000375492 149
39 3300005331 Ga0070670_100314614 Ga0070670_1003146142 149
40 3300005334 Ga0068869_100028124 Ga0068869_1000281244 149
41 3300005334 Ga0068869_100053585 Ga0068869_1000535852 149
42 3300005335 Ga0070666_10081627 Ga0070666_100816271 149
43 3300005336 Ga0070680_100472892 Ga0070680_1004728921 149
44 3300005338 Ga0068868_100007788 Ga0068868_1000077887 149
45 3300005338 Ga0068868_100094965 Ga0068868_1000949652 149
46 3300005338 Ga0068868_100313440 Ga0068868_1003134401 149
47 3300005339 Ga0070660_100038196 Ga0070660_1000381964 149
48 3300005340 Ga0070689_100031523 Ga0070689_1000315232 149
49 3300005345 Ga0070692_10156446 Ga0070692_101564461 149
50 3300005347 Ga0070668_100063560 Ga0070668_1000635602 149
51 3300005347 Ga0070668_100120628 Ga0070668_1001206282 149
52 3300005353 Ga0070669_100039369 Ga0070669_1000393693 149
53 3300005354 Ga0070675_100089363 Ga0070675_1000893632 149
54 3300005354 Ga0070675_100118612 Ga0070675_1001186122 149
55 3300005355 Ga0070671_100060106 Ga0070671_1000601063 149
56 3300005364 Ga0070673_100059003 Ga0070673_1000590034 149
57 3300005364 Ga0070673_100456098 Ga0070673_1004560982 149
58 3300005364 Ga0070673_100928588 Ga0070673_1009285882 149
59 3300005365 Ga0070688_100051872 Ga0070688_1000518721 149
60 3300005365 Ga0070688_100079030 Ga0070688_1000790302 149
61 3300005365 Ga0070688_100668010 Ga0070688_1006680101 149
62 3300005366 Ga0070659_100000578 Ga0070659_10000057825 149
63 3300005366 Ga0070659_100038444 Ga0070659_1000384443 149
64 3300005367 Ga0070667_100919438 Ga0070667_1009194382 149
65 3300005434 Ga0070709_10621249 Ga0070709_106212491 149
66 3300005438 Ga0070701_10095775 Ga0070701_100957752 149
67 3300005441 Ga0070700_100513102 Ga0070700_1005131022 149
68 3300005456 Ga0070678_100956277 Ga0070678_1009562772 149
69 3300005457 Ga0070662_100031860 Ga0070662_1000318605 149
70 3300005457 Ga0070662_100804085 Ga0070662_1008040852 149
71 3300005459 Ga0068867_100039025 Ga0068867_1000390252 149
72 3300005459 Ga0068867_101257285 Ga0068867_1012572851 149
73 3300005459 Ga0068867_101707823 Ga0068867_1017078231 149
74 3300005466 Ga0070685_10077243 Ga0070685_100772432 149
75 3300005466 Ga0070685_10150268 Ga0070685_101502682 149
76 3300005530 Ga0070679_100000065 Ga0070679_1000000656 149
77 3300005530 Ga0070679_100154721 Ga0070679_1001547213 149
78 3300005539 Ga0068853_100603809 Ga0068853_1006038092 149
79 3300005543 Ga0070672_100034270 Ga0070672_1000342704 149
80 3300005543 Ga0070672_100034431 Ga0070672_1000344311 149
81 3300005545 Ga0070695_101100677 Ga0070695_1011006771 149
82 3300005548 Ga0070665_100194624 Ga0070665_1001946242 149
83 3300005563 Ga0068855_100005888 Ga0068855_1000058889 149
84 3300005577 Ga0068857_100082058 Ga0068857_1000820582 149
85 3300005617 Ga0068859_100187153 Ga0068859_1001871533 149
86 3300005617 Ga0068859_101755908 Ga0068859_1017559082 149
87 3300005618 Ga0068864_100731399 Ga0068864_1007313991 149
88 3300005718 Ga0068866_10022089 Ga0068866_100220893 149
89 3300005718 Ga0068866_10051007 Ga0068866_100510072 149
90 3300005719 Ga0068861_100014105 Ga0068861_1000141056 149
91 3300005719 Ga0068861_100083422 Ga0068861_1000834222 149
92 3300005719 Ga0068861_100773300 Ga0068861_1007733002 149
93 3300005834 Ga0068851_10011219 Ga0068851_100112195 149
94 3300005840 Ga0068870_10054065 Ga0068870_100540652 149
95 3300005841 Ga0068863_100053489 Ga0068863_1000534893 149
96 3300005841 Ga0068863_100071430 Ga0068863_1000714302 149
97 3300005843 Ga0068860_100059491 Ga0068860_1000594912 149
98 3300005843 Ga0068860_100131825 Ga0068860_1001318254 149
99 3300005843 Ga0068860_100219502 Ga0068860_1002195022 149
100 3300005843 Ga0068860_100297155 Ga0068860_1002971552 149
101 3300005843 Ga0068860_100580590 Ga0068860_1005805902 149
102 3300005843 Ga0068860_101089255 Ga0068860_1010892552 149
103 3300005843 Ga0068860_101408465 Ga0068860_1014084651 149
104 3300005844 Ga0068862_100090465 Ga0068862_1000904652 149
105 3300005844 Ga0068862_100170156 Ga0068862_1001701562 149
106 3300006195 Ga0075366_10161905 Ga0075366_101619052 149
107 3300006237 Ga0097621_100162138 Ga0097621_1001621381 149
108 3300006237 Ga0097621_100414680 Ga0097621_1004146802 149
109 3300006358 Ga0068871_100062196 Ga0068871_1000621962 149
110 3300006358 Ga0068871_100081511 Ga0068871_1000815113 149
111 3300006358 Ga0068871_100571451 Ga0068871_1005714512 149
112 3300006881 Ga0068865_100067193 Ga0068865_1000671933 149
113 3300006881 Ga0068865_100279142 Ga0068865_1002791422 149
114 3300006931 Ga0097620_100187143 Ga0097620_1001871433 149
115 3300006931 Ga0097620_101755919 Ga0097620_1017559192 149
116 3300009094 Ga0111539_10053504 Ga0111539_100535046 149
117 3300009148 Ga0105243_11054419 Ga0105243_110544192 149
118 3300009174 Ga0105241_10352225 Ga0105241_103522252 149
119 3300009176 Ga0105242_10079244 Ga0105242_100792444 149
120 3300009176 Ga0105242_10497081 Ga0105242_104970812 149
121 3300009177 Ga0105248_10977048 Ga0105248_109770482 149
122 3300009545 Ga0105237_10565432 Ga0105237_105654322 149
123 3300009551 Ga0105238_10228288 Ga0105238_102282882 149
124 3300009553 Ga0105249_10056335 Ga0105249_100563351 149
125 3300009553 Ga0105249_10066174 Ga0105249_100661744 149
126 3300009553 Ga0105249_10172402 Ga0105249_101724022 149
127 3300010375 Ga0105239_11493438 Ga0105239_114934382 149
128 3300011119 Ga0105246_10396652 Ga0105246_103966522 149
129 3300013100 Ga0157373_10000269 Ga0157373_100002694 149
130 3300013100 Ga0157373_10038377 Ga0157373_100383773 149
131 3300013100 Ga0157373_10053930 Ga0157373_100539303 149
132 3300013102 Ga0157371_10002200 Ga0157371_100022004 149
133 3300013102 Ga0157371_10004323 Ga0157371_1000432310 149
134 3300013102 Ga0157371_10009843 Ga0157371_100098437 149
135 3300013102 Ga0157371_10026643 Ga0157371_100266433 149
136 3300013102 Ga0157371_10134146 Ga0157371_101341462 149
137 3300013104 Ga0157370_10098784 Ga0157370_100987843 149
138 3300013104 Ga0157370_11141246 Ga0157370_111412461 149
139 3300013296 Ga0157374_10101442 Ga0157374_101014423 149
140 3300013297 Ga0157378_10013242 Ga0157378_100132422 149
141 3300013297 Ga0157378_10244544 Ga0157378_102445442 149
142 3300013297 Ga0157378_10349755 Ga0157378_103497552 149
143 3300013307 Ga0157372_10004146 Ga0157372_1000414616 149
144 3300013307 Ga0157372_10009422 Ga0157372_100094225 149
145 3300013307 Ga0157372_10135920 Ga0157372_101359202 149
146 3300013307 Ga0157372_10464283 Ga0157372_104642832 149
147 3300013307 Ga0157372_11411219 Ga0157372_114112192 149
148 3300013307 Ga0157372_11599738 Ga0157372_115997381 149
149 3300013308 Ga0157375_10026401 Ga0157375_100264013 149
150 3300013308 Ga0157375_10238063 Ga0157375_102380632 149
151 3300014326 Ga0157380_10056150 Ga0157380_100561505 149
152 3300014497 Ga0182008_10000009 Ga0182008_10000009166 149
153 3300014745 Ga0157377_10008684 Ga0157377_100086844 149
154 3300014969 Ga0157376_10050227 Ga0157376_100502272 149
155 3300015265 Ga0182005_1000209 Ga0182005_100020929 149
156 3300025208 Ga0209436_103192 Ga0209436_1031925 149
157 3300025231 Ga0207427_100106 Ga0207427_10010641 149
158 3300025233 Ga0209437_100226 Ga0209437_10022640 149
159 3300025261 Ga0209233_1000089 Ga0209233_100008940 149
160 3300025302 Ga0207426_1044687 Ga0207426_10446873 149
161 3300025315 Ga0207697_10163187 Ga0207697_101631872 149
162 3300025899 Ga0207642_10307947 Ga0207642_103079472 149
163 3300025901 Ga0207688_10009523 Ga0207688_100095233 149
164 3300025903 Ga0207680_10218522 Ga0207680_102185222 149
165 3300025907 Ga0207645_10004421 Ga0207645_100044213 149
166 3300025907 Ga0207645_10019079 Ga0207645_100190792 149
167 3300025908 Ga0207643_10005242 Ga0207643_100052423 149
168 3300025908 Ga0207643_10014704 Ga0207643_100147043 149
169 3300025909 Ga0207705_10296248 Ga0207705_102962482 149
170 3300025909 Ga0207705_10329142 Ga0207705_103291422 149
171 3300025914 Ga0207671_10399916 Ga0207671_103999162 149
172 3300025919 Ga0207657_10032094 Ga0207657_100320941 149
173 3300025921 Ga0207652_10000013 Ga0207652_1000001373 149
174 3300025923 Ga0207681_10047102 Ga0207681_100471023 149
175 3300025923 Ga0207681_10130743 Ga0207681_101307431 149
176 3300025924 Ga0207694_11453086 Ga0207694_114530861 149
177 3300025925 Ga0207650_10008302 Ga0207650_100083022 149
178 3300025925 Ga0207650_10262682 Ga0207650_102626822 149
179 3300025926 Ga0207659_10120026 Ga0207659_101200262 149
180 3300025926 Ga0207659_10134094 Ga0207659_101340942 149
181 3300025926 Ga0207659_10690943 Ga0207659_106909432 149
182 3300025931 Ga0207644_10049826 Ga0207644_100498262 149
183 3300025932 Ga0207690_10001498 Ga0207690_100014982 149
184 3300025933 Ga0207706_10012385 Ga0207706_1001238510 149
185 3300025934 Ga0207686_10749772 Ga0207686_107497722 149
186 3300025936 Ga0207670_10101491 Ga0207670_101014912 149
187 3300025938 Ga0207704_10297524 Ga0207704_102975242 149
188 3300025938 Ga0207704_10297723 Ga0207704_102977232 149
189 3300025940 Ga0207691_10019220 Ga0207691_100192203 149
190 3300025940 Ga0207691_10051663 Ga0207691_100516632 149
191 3300025942 Ga0207689_10013336 Ga0207689_100133362 149
192 3300025942 Ga0207689_10025742 Ga0207689_100257424 149
193 3300025942 Ga0207689_10095766 Ga0207689_100957662 149
194 3300025942 Ga0207689_10662067 Ga0207689_106620672 149
195 3300025949 Ga0207667_11264573 Ga0207667_112645731 149
196 3300025960 Ga0207651_10491400 Ga0207651_104914001 149
197 3300025960 Ga0207651_10552954 Ga0207651_105529542 149
198 3300025961 Ga0207712_10198773 Ga0207712_101987732 149
199 3300025961 Ga0207712_11272326 Ga0207712_112723261 149
200 3300025972 Ga0207668_10135786 Ga0207668_101357862 149
201 3300025981 Ga0207640_10153145 Ga0207640_101531452 149
202 3300025986 Ga0207658_10261401 Ga0207658_102614012 149
203 3300025986 Ga0207658_10326279 Ga0207658_103262792 149
204 3300025986 Ga0207658_10783591 Ga0207658_107835911 149
205 3300026023 Ga0207677_10034978 Ga0207677_100349782 149
206 3300026023 Ga0207677_10212950 Ga0207677_102129502 149
207 3300026041 Ga0207639_10086513 Ga0207639_100865132 149
208 3300026041 Ga0207639_10115509 Ga0207639_101155092 149
209 3300026075 Ga0207708_10574305 Ga0207708_105743052 149
210 3300026088 Ga0207641_10021980 Ga0207641_100219804 149
211 3300026088 Ga0207641_10176174 Ga0207641_101761742 149
212 3300026089 Ga0207648_10159083 Ga0207648_101590832 149
213 3300026089 Ga0207648_10480893 Ga0207648_104808932 149
214 3300026089 Ga0207648_11750414 Ga0207648_117504141 149
215 3300026089 Ga0207648_11840612 Ga0207648_118406121 149
216 3300026116 Ga0207674_10059366 Ga0207674_100593663 149
217 3300026116 Ga0207674_10322350 Ga0207674_103223502 149
218 3300026118 Ga0207675_100000124 Ga0207675_10000012463 149
219 3300026118 Ga0207675_100234220 Ga0207675_1002342203 149
220 3300026118 Ga0207675_100527933 Ga0207675_1005279332 149
221 3300026121 Ga0207683_10010510 Ga0207683_1001051015 149
222 3300026142 Ga0207698_10209173 Ga0207698_102091732 149
223 3300027471 Ga0209995_1084061 Ga0209995_10840611 149
224 3300027907 Ga0207428_10115480 Ga0207428_101154802 149
225 3300028379 Ga0268266_10097525 Ga0268266_100975251 149
226 3300028381 Ga0268264_10193932 Ga0268264_101939323 149
227 3300028381 Ga0268264_10269666 Ga0268264_102696662 149
228 3300028381 Ga0268264_10393620 Ga0268264_103936202 149
229 3300028381 Ga0268264_10425184 Ga0268264_104251842 149
230 3300030522 Ga0307512_10186638 Ga0307512_101866382 149
231 3300031731 Ga0307405_11039669 Ga0307405_110396691 149
232 3300031852 Ga0307410_10047477 Ga0307410_100474772 149
233 3300032004 Ga0307414_10363547 Ga0307414_103635472 149
234 3300032004 Ga0307414_11808584 Ga0307414_118085842 149
235 3300037312 Ga0395899_0027671 Ga0395899_0027671_3785_4243 149
236 3300037312 Ga0395899_0084609 Ga0395899_0084609_691_1143 149
237 3300037312 Ga0395899_0503327 Ga0395899_0503327_187_642 149
238 3300037418 Ga0395900_0001378 Ga0395900_0001378_4352_4810 149
239 3300037418 Ga0395900_0170532 Ga0395900_0170532_1547_2011 149
240 3300037418 Ga0395900_0266320 Ga0395900_0266320_143_595 149
241 3300037418 Ga0395900_0758079 Ga0395900_0758079_64_519 149
242 3300037466 Ga0395898_0001155 Ga0395898_0001155_35801_36259 149
243 3300037466 Ga0395898_0258567 Ga0395898_0258567_518_970 149
244 3300037471 Ga0395905_0450222 Ga0395905_0450222_97_549 149
245 3300038443 Ga0395901_0009161 Ga0395901_0009161_3043_3501 149
246 3300038443 Ga0395901_0554261 Ga0395901_0554261_691_1143 149
247 3300041406 Ga0439439_0136824 Ga0439439_0136824_167_616 149
248 3300041443 Ga0451789_0947215 Ga0451789_0947215_103_552 149
249 3300041452 Ga0451793_1576346 Ga0451793_1576346_29_481 149
250 3300041486 Ga0451807_0030291 Ga0451807_0030291_204_653 149
251 3300042007 Ga0439449_0003148 Ga0439449_0003148_3458_3907 149
252 3300042014 Ga0439457_019459 Ga0439457_019459_34_483 149
253 3300042156 Ga0439446_0256872 Ga0439446_0256872_57_506 149
254 3300044684 Ga0466966_0000162 Ga0466966_0000162_27195_27653 149
255 3300044693 Ga0466961_0526279 Ga0466961_0526279_157_606 149
256 3300044735 Ga0466968_0056258 Ga0466968_0056258_988_1587 149
257 3300044765 Ga0466970_0336493 Ga0466970_0336493_33_485 149
258 3300044842 Ga0466957_0000105 Ga0466957_0000105_11546_11995 149
259 3300044901 Ga0466960_0182909 Ga0466960_0182909_616_1083 149
260 3300045049 Ga0466959_0000077 Ga0466959_0000077_34239_34697 149
261 3300046492 Ga0495585_0000031 Ga0495585_0000031_122120_122674 149
262 3300046523 Ga0495644_0011577 Ga0495644_0011577_1668_2135 149
263 3300046665 Ga0495661_0005768 Ga0495661_0005768_5877_6344 149
264 3300046794 Ga0495589_0034180 Ga0495589_0034180_212_769 149
265 3300047443 Ga0495687_003643 Ga0495687_003643_9082_9600 149
266 3300048907 Ga0496104_0673702 Ga0496104_0673702_260_712 149
267 3300049568 Ga0501031_0025910 Ga0501031_0025910_1252_1701 149
268 3300049569 Ga0501032_0233720 Ga0501032_0233720_31_480 149
269 3300049571 Ga0501034_0002458 Ga0501034_0002458_17548_18018 149
270 3300049571 Ga0501034_0012297 Ga0501034_0012297_1680_2129 149
271 3300049571 Ga0501034_0054369 Ga0501034_0054369_1219_1671 149
272 3300049573 Ga0501037_0008662 Ga0501037_0008662_738_1187 149
273 3300049573 Ga0501037_0048064 Ga0501037_0048064_984_1433 149
274 3300049573 Ga0501037_0072321 Ga0501037_0072321_1842_2312 149
275 3300049573 Ga0501037_0186079 Ga0501037_0186079_333_839 149
276 3300049573 Ga0501037_0318273 Ga0501037_0318273_246_707 149
277 3300049574 Ga0501038_0030126 Ga0501038_0030126_3152_3601 149
278 3300049574 Ga0501038_0032641 Ga0501038_0032641_803_1252 149
279 3300049575 Ga0501039_0025681 Ga0501039_0025681_3997_4446 149
280 3300049575 Ga0501039_0098135 Ga0501039_0098135_1143_1592 149
281 3300049575 Ga0501039_0242108 Ga0501039_0242108_758_1228 149
282 3300049579 Ga0501043_0005990 Ga0501043_0005990_7061_7510 149
283 3300049579 Ga0501043_0008603 Ga0501043_0008603_6473_6922 149
284 3300049579 Ga0501043_0017398 Ga0501043_0017398_4546_5016 149
285 3300049579 Ga0501043_0063013 Ga0501043_0063013_1050_1556 149
286 3300049580 Ga0501046_0052201 Ga0501046_0052201_1309_1779 149
287 3300049581 Ga0501047_0078084 Ga0501047_0078084_1957_2406 149
288 3300049581 Ga0501047_0191791 Ga0501047_0191791_662_1132 149
289 3300049581 Ga0501047_0815125 Ga0501047_0815125_197_646 149
290 3300049586 Ga0501070_0093112 Ga0501070_0093112_645_1115 149
291 3300049589 Ga0501073_0010670 Ga0501073_0010670_773_1243 149
292 3300049590 Ga0501074_0000952 Ga0501074_0000952_16799_17269 149
293 3300049742 Ga0501080_0048501 Ga0501080_0048501_66_536 149
294 3300049744 Ga0501083_0005031 Ga0501083_0005031_3072_3521 149
295 3300049822 Ga0501035_0010700 Ga0501035_0010700_2995_3444 149
296 3300049822 Ga0501035_0040817 Ga0501035_0040817_1184_1654 149
297 3300049822 Ga0501035_0201198 Ga0501035_0201198_890_1339 149
298 3300049822 Ga0501035_0288559 Ga0501035_0288559_114_563 149
299 3300049823 Ga0501044_0003711 Ga0501044_0003711_10102_10551 149
300 3300049823 Ga0501044_0008589 Ga0501044_0008589_2208_2678 149
301 3300049823 Ga0501044_0048320 Ga0501044_0048320_1401_1850 149
302 3300049823 Ga0501044_0267297 Ga0501044_0267297_670_1119 149
303 3300049823 Ga0501044_0524547 Ga0501044_0524547_605_1066 149
304 3300049824 Ga0501045_0576171 Ga0501045_0576171_301_771 149
305 3300050493 nmdc:mga0k408_156744_c1 nmdc:mga0k408_156744_c1_91_609 149
306 3300050511 nmdc:mga08y16_8765_c1 nmdc:mga08y16_8765_c1_909_1358 149
307 3300053156 Ga0500622_0106683 Ga0500622_0106683_587_1036 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

140

0.83

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

25

143

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

53

139

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b3v-assembly1.cif.gz_A spermine spermidine acetyltransferase in complex with acetylcoa, k26r mutant 0.9336 4 141
3bj7-assembly2.cif.gz_C spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding 0.9196 2 136
2fxf-assembly1.cif.gz_A human spermidine/spermine n1-acetyltransferase 0.9192 2 141
2g3t-assembly1.cif.gz_A crystal structure of human spermidine/spermine n1-acetyltransferase (hssat) 0.9158 2 136
2q4v-assembly1.cif.gz_B ensemble refinement of the protein crystal structure of thialysine n-acetyltransferase (ssat2) from homo sapiens 0.9137 1 136
ID Description Score Start End Superfamily
af_O17731_1_160_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9391 2 133 3.40.630.30
af_Q54W72_6_169_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9209 1 143 3.40.630.30
af_Q8MRT7_5_173_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9191 1 136 3.40.630.30
af_A4ICI2_5_157_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9153 2 145 3.40.630.30
2q4vB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9142 1 136 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A317IEE1-F1-model_v4 GNAT family N-acetyltransferase 0.9545 1 126 GO:0008080
AF-A0A2W1BUP1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9525 2 136 GO:0008080
AF-A0A0K2UUB4-F1-model_v4 Spermidine/spermine N1acetyltransferase family member 2 [Trichechus manatus latirostris] 0.9512 2 136 GO:0008080
AF-A0A0K2UUR4-F1-model_v4 Diamine acetyltransferase 2like [Maylandia zebra] 0.951 2 134 GO:0008080
AF-A0A7M7HGU6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9509 2 136 GO:0008080

Feature Viewer

pLDDT pTM Quality
90.63 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map