F398970

General Info

Members Datasets Scaffolds Average Seq Length
307 223 614 90

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10006452|JGI25153J46596_100064523
Length 94
Sequence MLTLSGAESAASPAVRGRHFRFHWPLLAATALALSGCMPATTQVAAADPADPAAKVAPVGYRSTISPYTNLRPAAPAPWRGRNDAVTPQPKQDR

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
53 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
54 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
155 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
156 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
159 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
160 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
161 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
162 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
163 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
164 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
165 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
166 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
167 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
168 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
169 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
170 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
171 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
172 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
173 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
174 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
175 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
176 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
177 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
178 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
179 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
180 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
181 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
182 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
183 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
184 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
185 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
186 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
187 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
188 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
189 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
190 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
191 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
192 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
193 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
194 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
195 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
196 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
197 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
198 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
199 2922368715
200 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
201 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
202 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
203 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
204 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
205 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
206 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
207 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
208 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
209 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
210 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
211 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
212 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
213 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
214 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
215 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
216 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
217 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
218 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
219 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
220 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
221 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
222 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
223 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.01
Metatranscriptomes 0
Isolates 16.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.48
Nodule 15.31
Rhizoplane 5.54
Rhizosphere 45.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006452 3300003215 Bacteria 5920
2 JGI25165J46597_1013998 3300003214 Bacteria 1096
3 JGI25153J46596_10005144 3300003215 Bacteria 6894
4 JGI25153J46596_10008853 3300003215 Bacteria 4754
5 JGI25153J46596_10014456 3300003215 Bacteria 3279
6 JGI25153J46596_10081951 3300003215 Bacteria 802
7 rootH1_10157346 3300003316 Bacteria 1544
8 JGI25160J50197_1002168 3300003354 Bacteria 9280
9 JGI25160J50197_1002576 3300003354 Bacteria 8381
10 Ga0055524_1077593 3300003775 Bacteria 615
11 Ga0065165_1006694 3300005262 Bacteria 5932
12 Ga0065165_1009553 3300005262 Bacteria 4331
13 Ga0065165_1020150 3300005262 Bacteria 2357
14 Ga0070658_11310688 3300005327 Bacteria 629
15 Ga0068869_100175430 3300005334 Bacteria 1677
16 Ga0070666_10396102 3300005335 Bacteria 992
17 Ga0070682_101600356 3300005337 Bacteria 563
18 Ga0070668_100131180 3300005347 Bacteria 2012
19 Ga0070671_100346482 3300005355 Bacteria 1268
20 Ga0070659_100634873 3300005366 Bacteria 920
21 Ga0070667_100433621 3300005367 Bacteria 1199
22 Ga0070663_100091475 3300005455 Bacteria 2254
23 Ga0070663_100253055 3300005455 Bacteria 1395
24 Ga0070663_101248127 3300005455 Bacteria 654
25 Ga0070662_100337017 3300005457 Bacteria 1233
26 Ga0068867_101805248 3300005459 Bacteria 575
27 Ga0070684_100662546 3300005535 Bacteria 972
28 Ga0068853_100219962 3300005539 Bacteria 1734
29 Ga0068853_100237436 3300005539 Bacteria 1669
30 Ga0070665_100458514 3300005548 Bacteria 1285
31 Ga0068855_100628806 3300005563 Bacteria 1155
32 Ga0068855_100880721 3300005563 Bacteria 947
33 Ga0068857_100864825 3300005577 Bacteria 866
34 Ga0068854_100970046 3300005578 Bacteria 751
35 Ga0068854_101423677 3300005578 Bacteria 627
36 Ga0068856_100059268 3300005614 Bacteria 3781
37 Ga0068852_100686296 3300005616 Bacteria 1033
38 Ga0068859_101364282 3300005617 Bacteria 782
39 Ga0068864_100237141 3300005618 Bacteria 1689
40 Ga0068870_11038952 3300005840 Bacteria 586
41 Ga0075365_10709644 3300006038 Bacteria 710
42 Ga0075363_100008810 3300006048 Bacteria 4718
43 Ga0070712_100845083 3300006175 Bacteria 787
44 Ga0075367_10048033 3300006178 Bacteria 2512
45 Ga0075367_10183340 3300006178 Bacteria 1305
46 Ga0075367_10295464 3300006178 Bacteria 1019
47 Ga0075367_10525619 3300006178 Bacteria 751
48 Ga0075369_10011934 3300006186 Bacteria 3424
49 Ga0075369_10092832 3300006186 Bacteria 1348
50 Ga0075369_10118869 3300006186 Bacteria 1195
51 Ga0075369_10424069 3300006186 Bacteria 628
52 Ga0075366_10008664 3300006195 Bacteria 5663
53 Ga0075366_10054815 3300006195 Bacteria 2368
54 Ga0097621_101137027 3300006237 Bacteria 734
55 Ga0075370_10038730 3300006353 Bacteria 2683
56 Ga0075370_10159227 3300006353 Bacteria 1325
57 Ga0075370_10561779 3300006353 Bacteria 690
58 Ga0097620_101364537 3300006931 Bacteria 782
59 Ga0099822_1080692 3300006943 Bacteria 800
60 Ga0105245_11028965 3300009098 Bacteria 869
61 Ga0105245_11785246 3300009098 Bacteria 668
62 Ga0105243_12178555 3300009148 Bacteria 591
63 Ga0105242_11755736 3300009176 Bacteria 658
64 Ga0105248_10861090 3300009177 Bacteria 1023
65 Ga0105248_12491689 3300009177 Bacteria 589
66 Ga0105237_10013836 3300009545 Bacteria 8448
67 Ga0105237_10020285 3300009545 Bacteria 6856
68 Ga0105237_10740963 3300009545 Bacteria 989
69 Ga0105237_11640834 3300009545 Bacteria 650
70 Ga0105239_10061538 3300010375 Bacteria 4120
71 Ga0105239_10485217 3300010375 Bacteria 1404
72 Ga0105239_10839582 3300010375 Bacteria 1053
73 Ga0105239_11155695 3300010375 Bacteria 892
74 Ga0157371_10415996 3300013102 Bacteria 985
75 Ga0157374_10057968 3300013296 Bacteria 3619
76 Ga0157375_10193908 3300013308 Bacteria 2186
77 Ga0182008_10754335 3300014497 Bacteria 561
78 Ga0157379_10315331 3300014968 Bacteria 1427
79 Ga0157376_10069051 3300014969 Bacteria 2994
80 Ga0182007_10161483 3300015262 Bacteria 766
81 Ga0214544_1000035 3300021320 Bacteria 146874
82 Ga0214544_1032884 3300021320 Bacteria 1577
83 Ga0214544_1045056 3300021320 Bacteria 838
84 Ga0214542_1000181 3300021321 Bacteria 97233
85 Ga0214542_1021207 3300021321 Bacteria 4542
86 Ga0214542_1024362 3300021321 Bacteria 3401
87 Ga0214545_1000094 3300021324 Bacteria 98180
88 Ga0214545_1017840 3300021324 Bacteria 6691
89 Ga0214545_1033798 3300021324 Bacteria 1829
90 Ga0214545_1047183 3300021324 Bacteria 940
91 Ga0214543_1000155 3300021327 Bacteria 97353
92 Ga0214543_1022285 3300021327 Bacteria 4543
93 Ga0207425_1018505 3300025245 Bacteria 1511
94 Ga0209233_1010303 3300025261 Bacteria 2808
95 Ga0209455_1021197 3300025272 Bacteria 1267
96 Ga0209564_1005729 3300025295 Bacteria 6948
97 Ga0209564_1061465 3300025295 Bacteria 837
98 Ga0209758_1000117 3300025297 Bacteria 198325
99 Ga0209758_1006691 3300025297 Bacteria 8137
100 Ga0209758_1007329 3300025297 Bacteria 7554
101 Ga0209758_1056395 3300025297 Bacteria 1327
102 Ga0209758_1073675 3300025297 Bacteria 1063
103 Ga0209758_1077696 3300025297 Bacteria 1016
104 Ga0209256_1003163 3300025299 Bacteria 11933
105 Ga0209256_1061667 3300025299 Bacteria 871
106 Ga0207426_1000223 3300025302 Bacteria 132636
107 Ga0207426_1010622 3300025302 Bacteria 3561
108 Ga0207426_1015165 3300025302 Bacteria 2801
109 Ga0209257_1020770 3300025304 Bacteria 2411
110 Ga0207647_10014375 3300025904 Bacteria 5457
111 Ga0207643_10643252 3300025908 Bacteria 684
112 Ga0207654_10269459 3300025911 Bacteria 1148
113 Ga0207671_10014025 3300025914 Bacteria 6356
114 Ga0207681_11708091 3300025923 Bacteria 526
115 Ga0207650_10672739 3300025925 Bacteria 873
116 Ga0207687_10510451 3300025927 Bacteria 1004
117 Ga0207687_10846097 3300025927 Bacteria 781
118 Ga0207644_10045674 3300025931 Bacteria 3117
119 Ga0207644_10133429 3300025931 Bacteria 1904
120 Ga0207690_11130646 3300025932 Bacteria 653
121 Ga0207709_10149597 3300025935 Bacteria 1615
122 Ga0207709_10212923 3300025935 Bacteria 1388
123 Ga0207670_10905074 3300025936 Bacteria 739
124 Ga0207711_10583338 3300025941 Bacteria 1043
125 Ga0207711_11038091 3300025941 Bacteria 760
126 Ga0207667_11010429 3300025949 Bacteria 818
127 Ga0207667_11821988 3300025949 Bacteria 572
128 Ga0207640_10542587 3300025981 Bacteria 976
129 Ga0207640_10661926 3300025981 Bacteria 891
130 Ga0207658_10508062 3300025986 Bacteria 1074
131 Ga0207639_10719985 3300026041 Bacteria 927
132 Ga0207678_10032912 3300026067 Bacteria 4517
133 Ga0207678_10147000 3300026067 Bacteria 2012
134 Ga0207678_10846271 3300026067 Bacteria 808
135 Ga0207648_10621724 3300026089 Bacteria 997
136 Ga0207676_10220396 3300026095 Bacteria 1689
137 Ga0207674_10859056 3300026116 Bacteria 875
138 Ga0207683_10423292 3300026121 Bacteria 1226
139 Ga0207698_10132158 3300026142 Bacteria 2135
140 Ga0268266_10111045 3300028379 Bacteria 2429
141 Ga0268266_10135036 3300028379 Bacteria 2209
142 Ga0268266_12112434 3300028379 Bacteria 536
143 Ga0451853_0511455 3300041512 Bacteria 789
144 Ga0466972_0003429 3300044658 Bacteria 7864
145 Ga0466965_0019125 3300044683 Bacteria 3289
146 Ga0466965_0391949 3300044683 Bacteria 766
147 Ga0466965_0732339 3300044683 Bacteria 569
148 Ga0466964_0926117 3300044706 Bacteria 500
149 Ga0466971_0287385 3300044719 Bacteria 788
150 Ga0466968_0574017 3300044735 Bacteria 567
151 Ga0466970_0101194 3300044765 Bacteria 1569
152 Ga0466957_0931831 3300044842 Bacteria 622
153 Ga0466960_0287934 3300044901 Bacteria 922
154 Ga0495603_0074728 3300046455 Bacteria 1990
155 Ga0495590_0413250 3300046457 Bacteria 518
156 Ga0495629_0041140 3300046459 Bacteria 3252
157 Ga0495629_0247019 3300046459 Bacteria 1228
158 Ga0495638_0445991 3300046460 Bacteria 662
159 Ga0495605_0088822 3300046474 Bacteria 1435
160 Ga0495605_0195765 3300046474 Bacteria 883
161 Ga0495605_0200977 3300046474 Bacteria 868
162 Ga0495584_0139978 3300046491 Bacteria 1229
163 Ga0495583_0107947 3300046506 Bacteria 1182
164 Ga0495606_0033247 3300046507 Bacteria 3559
165 Ga0495606_0205422 3300046507 Bacteria 1120
166 Ga0495610_0063352 3300046512 Bacteria 1751
167 Ga0495610_0167340 3300046512 Bacteria 925
168 Ga0495632_0207837 3300046519 Bacteria 889
169 Ga0495648_0068622 3300046524 Bacteria 2067
170 Ga0495648_0278064 3300046524 Bacteria 795
171 Ga0495648_0437296 3300046524 Bacteria 575
172 Ga0495652_0475948 3300046529 Bacteria 870
173 Ga0495654_0135871 3300046530 Bacteria 1100
174 Ga0495609_0113240 3300046538 Bacteria 1170
175 Ga0495622_0054987 3300046557 Bacteria 1846
176 Ga0495668_0029726 3300046616 Bacteria 3087
177 Ga0495668_0461610 3300046616 Bacteria 699
178 Ga0495634_0117463 3300046642 Bacteria 1706
179 Ga0495611_0201962 3300046648 Bacteria 927
180 Ga0495625_0120753 3300046660 Bacteria 1783
181 Ga0495661_0317258 3300046665 Bacteria 775
182 Ga0495588_0002554 3300046674 Bacteria 7779
183 Ga0495649_0077710 3300046694 Bacteria 1776
184 Ga0495649_0112419 3300046694 Bacteria 1444
185 Ga0495676_0160206 3300047321 Bacteria 1593
186 Ga0495683_0067425 3300047323 Bacteria 1762
187 Ga0495683_0432207 3300047323 Bacteria 543
188 Ga0495687_023293 3300047443 Bacteria 2959
189 Ga0495687_234436 3300047443 Bacteria 558
190 Ga0495673_0237367 3300047469 Bacteria 669
191 Ga0495686_0240382 3300047472 Bacteria 1021
192 Ga0495686_0429690 3300047472 Bacteria 705
193 Ga0496100_0142024 3300048903 Bacteria 1703
194 Ga0496100_0217805 3300048903 Bacteria 1400
195 Ga0496101_0085901 3300048904 Bacteria 2332
196 Ga0496103_0006418 3300048906 Bacteria 7024
197 Ga0496104_0026310 3300048907 Bacteria 5370
198 Ga0496105_0040041 3300048908 Bacteria 3863
199 Ga0496105_0241790 3300048908 Bacteria 1465
200 Ga0496106_0451841 3300048909 Bacteria 1032
201 Ga0496107_0214875 3300048910 Bacteria 1430
202 Ga0496107_0337379 3300048910 Bacteria 1121
203 Ga0496108_0127815 3300048911 Bacteria 2183
204 Ga0496110_0345986 3300048913 Bacteria 1354
205 Ga0496112_0412580 3300048915 Bacteria 1289
206 Ga0496113_0064995 3300048916 Bacteria 2760
207 Ga0496113_0146992 3300048916 Bacteria 1857
208 Ga0496114_0296432 3300048917 Bacteria 1427
209 Ga0496115_0138198 3300048918 Bacteria 2009
210 Ga0496116_0064577 3300048919 Bacteria 2353
211 Ga0496117_0020298 3300048920 Bacteria 5420
212 Ga0496117_0352627 3300048920 Bacteria 759
213 Ga0496118_0050788 3300048921 Bacteria 3178
214 Ga0496119_0125306 3300048922 Bacteria 1406
215 Ga0496120_0041460 3300048923 Bacteria 2696
216 Ga0496121_0081063 3300048924 Bacteria 2570
217 Ga0496121_0083798 3300048924 Bacteria 2515
218 Ga0496122_0136617 3300048925 Bacteria 1544
219 Ga0496124_0752531 3300048927 Bacteria 610
220 Ga0496125_0051250 3300048928 Bacteria 3406
221 Ga0496125_0105308 3300048928 Bacteria 2062
222 Ga0496126_0156665 3300048929 Bacteria 1949
223 Ga0496126_0254436 3300048929 Bacteria 1462
224 Ga0496126_0925559 3300048929 Bacteria 659
225 Ga0495682_0010092 3300049460 Bacteria 3666
226 Ga0495682_0060409 3300049460 Bacteria 1369
227 Ga0495682_0129689 3300049460 Bacteria 902
228 nmdc:mga03683_73726_c1 3300050489 Bacteria 1463
229 nmdc:mga03n38_28538_c1 3300050490 Bacteria 2327
230 nmdc:mga0yw44_26438_c1 3300050492 Bacteria 3315
231 nmdc:mga0yw44_645040_c1 3300050492 Bacteria 720
232 nmdc:mga0k408_79287_c1 3300050493 Bacteria 1921
233 nmdc:mga0k408_828038_c1 3300050493 Bacteria 539
234 nmdc:mga06z11_367165_c1 3300050494 Bacteria 863
235 nmdc:mga06z11_59940_c1 3300050494 Bacteria 1980
236 nmdc:mga07m45_534058_c1 3300050496 Bacteria 679
237 nmdc:mga0sz30_81455_c1 3300050516 Bacteria 1401
238 Ga0495655_0069266 3300053083 Bacteria 982
239 Ga0500578_0061762 3300053086 Bacteria 2392
240 Ga0500566_0000553 3300053094 Bacteria 20987
241 Ga0500650_0504246 3300053098 Bacteria 514
242 Ga0500556_0063353 3300053104 Bacteria 1366
243 Ga0500608_237367 3300053122 Bacteria 722
244 Ga0500626_179404 3300053128 Bacteria 854
245 Ga0500652_085513 3300053131 Bacteria 1315
246 Ga0500616_0199744 3300053153 Bacteria 886
247 Ga0500638_090713 3300053162 Bacteria 1439
248 Ga0500639_241860 3300053163 Bacteria 732
249 Ga0500636_0392249 3300053177 Bacteria 647
250 Ga0500645_059291 3300053730 Bacteria 1108
251 Ga0500599_000629 3300053736 Bacteria 3758
252 Ga0500601_000174 3300053737 Bacteria 13338
253 Ga0500661_034970 3300055283 Bacteria 888
254 Ga0466962_0058155 3300061719 Bacteria 1846
255 2511401352 2511231028 Bacteria 8046582
256 2513622203 2513237092 Bacteria 8341956
257 2513641416 2513237094 Bacteria 8789602
258 2513651828 2513237095 Bacteria 8976980
259 2513704739 2513237102 Bacteria 7703324
260 2517107902 2517093001 Bacteria 9002274
261 2528852146 2528768022 Bacteria 10457665
262 2617377435 2617270741 Bacteria 8201522
263 2818241993 2816332527 Bacteria 8933356
264 2824623940 2824617872 Bacteria 8814715
265 2824632624 2824626560 Bacteria 8813858
266 2824643408 2824635225 Bacteria 8785348
267 2824651122 2824644064 Bacteria 8743947
268 2824669483 2824661429 Bacteria 9877870
269 2824722321 2824714736 Bacteria 8717648
270 2824731650 2824723954 Bacteria 8758240
271 2824739338 2824732956 Bacteria 7810675
272 2824750224 2824746037 Bacteria 7911610
273 2841963182 2841957949 Bacteria 8652217
274 2842044730 2842038055 Bacteria 8002051
275 2842053083 2842045827 Bacteria 8006841
276 2874618788 2874612657 Bacteria 8252029
277 2879106186 2879099564 Bacteria 10442239
278 2881364265 2881364244 Bacteria 7710352
279 2888386257 2888378607 Bacteria 9652610
280 2888392027 2888388044 Bacteria 7304136
281 2903728050 2903727486 Bacteria 8281579
282 2906627279 2906626472 Bacteria 8826946
283 2922376881
284 2929621525 2929615660 Bacteria 9193770
285 2929631660 2929624759 Bacteria 9339455
286 2932806662 2932801729 Bacteria 7987968
287 2932815931 2932809354 Bacteria 9135765
288 2932824819 2932818245 Bacteria 9955613
289 2933583450 2933577622 Bacteria 9116884
290 2935693354 2935684952 Bacteria 9590419
291 2935720857 2935713505 Bacteria 9608509
292 2935730656 2935722832 Bacteria 9608746
293 2935740579 2935732158 Bacteria 9706831
294 2935749947 2935741537 Bacteria 9707219
295 2935759233 2935750917 Bacteria 9590372
296 2935767316 2935760218 Bacteria 9817913
297 2935817587 2935810662 Bacteria 9401221
298 2936044512 2936037263 Bacteria 9446081
299 2940565241 2940556831 Bacteria 9590747
300 3005488976 3005483717 Bacteria 7877331
301 3005507775 3005506211 Bacteria 6943378
302 3005593971 3005587118 Bacteria 7794411
303 3005723918 3005718088 Bacteria 8283608
304 8016584037 8016583857 Bacteria 10421953
305 8019655140 8019648815 Bacteria 10014479
306 8055744272 8055742211 Bacteria 9226248
307 8056969142 8056967851 Bacteria 9038162
308 JGI25153J46596_10006452
309 JGI25165J46597_1013998
310 JGI25153J46596_10005144
311 JGI25153J46596_10008853
312 JGI25153J46596_10014456
313 JGI25153J46596_10081951
314 rootH1_10157346
315 JGI25160J50197_1002168
316 JGI25160J50197_1002576
317 Ga0055524_1077593
318 Ga0065165_1006694
319 Ga0065165_1009553
320 Ga0065165_1020150
321 Ga0070658_11310688
322 Ga0068869_100175430
323 Ga0070666_10396102
324 Ga0070682_101600356
325 Ga0070668_100131180
326 Ga0070671_100346482
327 Ga0070659_100634873
328 Ga0070667_100433621
329 Ga0070663_100091475
330 Ga0070663_100253055
331 Ga0070663_101248127
332 Ga0070662_100337017
333 Ga0068867_101805248
334 Ga0070684_100662546
335 Ga0068853_100219962
336 Ga0068853_100237436
337 Ga0070665_100458514
338 Ga0068855_100628806
339 Ga0068855_100880721
340 Ga0068857_100864825
341 Ga0068854_100970046
342 Ga0068854_101423677
343 Ga0068856_100059268
344 Ga0068852_100686296
345 Ga0068859_101364282
346 Ga0068864_100237141
347 Ga0068870_11038952
348 Ga0075365_10709644
349 Ga0075363_100008810
350 Ga0070712_100845083
351 Ga0075367_10048033
352 Ga0075367_10183340
353 Ga0075367_10295464
354 Ga0075367_10525619
355 Ga0075369_10011934
356 Ga0075369_10092832
357 Ga0075369_10118869
358 Ga0075369_10424069
359 Ga0075366_10008664
360 Ga0075366_10054815
361 Ga0097621_101137027
362 Ga0075370_10038730
363 Ga0075370_10159227
364 Ga0075370_10561779
365 Ga0097620_101364537
366 Ga0099822_1080692
367 Ga0105245_11028965
368 Ga0105245_11785246
369 Ga0105243_12178555
370 Ga0105242_11755736
371 Ga0105248_10861090
372 Ga0105248_12491689
373 Ga0105237_10013836
374 Ga0105237_10020285
375 Ga0105237_10740963
376 Ga0105237_11640834
377 Ga0105239_10061538
378 Ga0105239_10485217
379 Ga0105239_10839582
380 Ga0105239_11155695
381 Ga0157371_10415996
382 Ga0157374_10057968
383 Ga0157375_10193908
384 Ga0182008_10754335
385 Ga0157379_10315331
386 Ga0157376_10069051
387 Ga0182007_10161483
388 Ga0214544_1000035
389 Ga0214544_1032884
390 Ga0214544_1045056
391 Ga0214542_1000181
392 Ga0214542_1021207
393 Ga0214542_1024362
394 Ga0214545_1000094
395 Ga0214545_1017840
396 Ga0214545_1033798
397 Ga0214545_1047183
398 Ga0214543_1000155
399 Ga0214543_1022285
400 Ga0207425_1018505
401 Ga0209233_1010303
402 Ga0209455_1021197
403 Ga0209564_1005729
404 Ga0209564_1061465
405 Ga0209758_1000117
406 Ga0209758_1006691
407 Ga0209758_1007329
408 Ga0209758_1056395
409 Ga0209758_1073675
410 Ga0209758_1077696
411 Ga0209256_1003163
412 Ga0209256_1061667
413 Ga0207426_1000223
414 Ga0207426_1010622
415 Ga0207426_1015165
416 Ga0209257_1020770
417 Ga0207647_10014375
418 Ga0207643_10643252
419 Ga0207654_10269459
420 Ga0207671_10014025
421 Ga0207681_11708091
422 Ga0207650_10672739
423 Ga0207687_10510451
424 Ga0207687_10846097
425 Ga0207644_10045674
426 Ga0207644_10133429
427 Ga0207690_11130646
428 Ga0207709_10149597
429 Ga0207709_10212923
430 Ga0207670_10905074
431 Ga0207711_10583338
432 Ga0207711_11038091
433 Ga0207667_11010429
434 Ga0207667_11821988
435 Ga0207640_10542587
436 Ga0207640_10661926
437 Ga0207658_10508062
438 Ga0207639_10719985
439 Ga0207678_10032912
440 Ga0207678_10147000
441 Ga0207678_10846271
442 Ga0207648_10621724
443 Ga0207676_10220396
444 Ga0207674_10859056
445 Ga0207683_10423292
446 Ga0207698_10132158
447 Ga0268266_10111045
448 Ga0268266_10135036
449 Ga0268266_12112434
450 Ga0451853_0511455
451 Ga0466972_0003429
452 Ga0466965_0019125
453 Ga0466965_0391949
454 Ga0466965_0732339
455 Ga0466964_0926117
456 Ga0466971_0287385
457 Ga0466968_0574017
458 Ga0466970_0101194
459 Ga0466957_0931831
460 Ga0466960_0287934
461 Ga0495603_0074728
462 Ga0495590_0413250
463 Ga0495629_0041140
464 Ga0495629_0247019
465 Ga0495638_0445991
466 Ga0495605_0088822
467 Ga0495605_0195765
468 Ga0495605_0200977
469 Ga0495584_0139978
470 Ga0495583_0107947
471 Ga0495606_0033247
472 Ga0495606_0205422
473 Ga0495610_0063352
474 Ga0495610_0167340
475 Ga0495632_0207837
476 Ga0495648_0068622
477 Ga0495648_0278064
478 Ga0495648_0437296
479 Ga0495652_0475948
480 Ga0495654_0135871
481 Ga0495609_0113240
482 Ga0495622_0054987
483 Ga0495668_0029726
484 Ga0495668_0461610
485 Ga0495634_0117463
486 Ga0495611_0201962
487 Ga0495625_0120753
488 Ga0495661_0317258
489 Ga0495588_0002554
490 Ga0495649_0077710
491 Ga0495649_0112419
492 Ga0495676_0160206
493 Ga0495683_0067425
494 Ga0495683_0432207
495 Ga0495687_023293
496 Ga0495687_234436
497 Ga0495673_0237367
498 Ga0495686_0240382
499 Ga0495686_0429690
500 Ga0496100_0142024
501 Ga0496100_0217805
502 Ga0496101_0085901
503 Ga0496103_0006418
504 Ga0496104_0026310
505 Ga0496105_0040041
506 Ga0496105_0241790
507 Ga0496106_0451841
508 Ga0496107_0214875
509 Ga0496107_0337379
510 Ga0496108_0127815
511 Ga0496110_0345986
512 Ga0496112_0412580
513 Ga0496113_0064995
514 Ga0496113_0146992
515 Ga0496114_0296432
516 Ga0496115_0138198
517 Ga0496116_0064577
518 Ga0496117_0020298
519 Ga0496117_0352627
520 Ga0496118_0050788
521 Ga0496119_0125306
522 Ga0496120_0041460
523 Ga0496121_0081063
524 Ga0496121_0083798
525 Ga0496122_0136617
526 Ga0496124_0752531
527 Ga0496125_0051250
528 Ga0496125_0105308
529 Ga0496126_0156665
530 Ga0496126_0254436
531 Ga0496126_0925559
532 Ga0495682_0010092
533 Ga0495682_0060409
534 Ga0495682_0129689
535 nmdc:mga03683_73726_c1
536 nmdc:mga03n38_28538_c1
537 nmdc:mga0yw44_26438_c1
538 nmdc:mga0yw44_645040_c1
539 nmdc:mga0k408_79287_c1
540 nmdc:mga0k408_828038_c1
541 nmdc:mga06z11_367165_c1
542 nmdc:mga06z11_59940_c1
543 nmdc:mga07m45_534058_c1
544 nmdc:mga0sz30_81455_c1
545 Ga0495655_0069266
546 Ga0500578_0061762
547 Ga0500566_0000553
548 Ga0500650_0504246
549 Ga0500556_0063353
550 Ga0500608_237367
551 Ga0500626_179404
552 Ga0500652_085513
553 Ga0500616_0199744
554 Ga0500638_090713
555 Ga0500639_241860
556 Ga0500636_0392249
557 Ga0500645_059291
558 Ga0500599_000629
559 Ga0500601_000174
560 Ga0500661_034970
561 Ga0466962_0058155
562 2511401352
563 2513622203
564 2513641416
565 2513651828
566 2513704739
567 2517107902
568 2528852146
569 2617377435
570 2818241993
571 2824623940
572 2824632624
573 2824643408
574 2824651122
575 2824669483
576 2824722321
577 2824731650
578 2824739338
579 2824750224
580 2841963182
581 2842044730
582 2842053083
583 2874618788
584 2879106186
585 2881364265
586 2888386257
587 2888392027
588 2903728050
589 2906627279
590 2922376881
591 2929621525
592 2929631660
593 2932806662
594 2932815931
595 2932824819
596 2933583450
597 2935693354
598 2935720857
599 2935730656
600 2935740579
601 2935749947
602 2935759233
603 2935767316
604 2935817587
605 2936044512
606 2940565241
607 3005488976
608 3005507775
609 3005593971
610 3005723918
611 8016584037
612 8019655140
613 8055744272
614 8056969142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map