F398874

General Info

Members Datasets Scaffolds Average Seq Length
306 200 273 96

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0428852|Ga0496125_0428852_103_432
Length 109
Sequence MRRRPPRWQDDGMSFQAYLDAVEAKTGLTPRQLLELAKERGLDDPSVKAGAILEWLKTDYDLGRGHGMAMVHVIQKGPQISTKHVGTDGVHRDESDTLWLDGVATKPKP

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221575 Microbacterium sp. Root61 Isolate Unclassified
3 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
4 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
5 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
6 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
7 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
8 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
9 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
10 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
11 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
12 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
13 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
14 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
15 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
16 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
17 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
18 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
19 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
20 2928153084 Leifsonia sp. 563 Isolate Unclassified
21 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
22 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
23 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
24 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
25 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
26 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
27 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
28 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
29 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
30 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
31 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
32 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
199 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
200 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.24
Metatranscriptomes 0.98
Isolates 10.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 0
Rhizoplane 6.54
Rhizosphere 68.63
Stem 0
Stem Tuber 0
Unclassified 15.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c024559 3300000041 Bacteria 550
2 JGI24739J22299_10010531 3300001989 Bacteria 3431
3 JGI24737J22298_10006087 3300001990 Bacteria 4135
4 JGI24737J22298_10042576 3300001990 Bacteria 1391
5 JGI24735J21928_10008531 3300002067 Bacteria 3309
6 JGI24735J21928_10088515 3300002067 Bacteria 887
7 JGI24738J21930_10122558 3300002075 Bacteria 565
8 rootL2_10009907 3300003322 Bacteria 6470
9 rootL2_10335033 3300003322 Bacteria 1732
10 Ga0006562J51391_1024612 3300003578 Bacteria 3230
11 Ga0006562J51391_1024614 3300003578 Bacteria 1390
12 Ga0006562J51391_1034584 3300003578 Bacteria 605
13 Ga0055542_1008069 3300003762 Bacteria 2085
14 Ga0055540_1050308 3300003792 Bacteria 862
15 Ga0068869_101147599 3300005334 Bacteria 681
16 Ga0070682_100708640 3300005337 Bacteria 808
17 Ga0068868_100424337 3300005338 Bacteria 1152
18 Ga0070661_101295797 3300005344 Bacteria 611
19 Ga0070668_100314477 3300005347 Bacteria 1317
20 Ga0070668_101249640 3300005347 Bacteria 674
21 Ga0070668_101998345 3300005347 Bacteria 535
22 Ga0070675_100158872 3300005354 Bacteria 1943
23 Ga0070674_101901467 3300005356 Bacteria 541
24 Ga0070673_101005550 3300005364 Bacteria 776
25 Ga0070659_100835701 3300005366 Bacteria 802
26 Ga0070714_100660039 3300005435 Bacteria 1007
27 Ga0070710_10000376 3300005437 Bacteria 20895
28 Ga0070700_101292023 3300005441 Bacteria 613
29 Ga0070663_100435133 3300005455 Bacteria 1078
30 Ga0070663_101173129 3300005455 Bacteria 674
31 Ga0070678_101342927 3300005456 Bacteria 666
32 Ga0068853_100655605 3300005539 Bacteria 999
33 Ga0070672_101485820 3300005543 Bacteria 607
34 Ga0070696_100394276 3300005546 Bacteria 1082
35 Ga0070693_100404636 3300005547 Bacteria 947
36 Ga0070665_101213993 3300005548 Bacteria 765
37 Ga0068855_101893389 3300005563 Bacteria 604
38 Ga0068857_100216608 3300005577 Bacteria 1748
39 Ga0068857_101313462 3300005577 Bacteria 702
40 Ga0068852_100581155 3300005616 Bacteria 1123
41 Ga0068852_101849647 3300005616 Bacteria 626
42 Ga0068852_102221135 3300005616 Bacteria 570
43 Ga0068859_100658451 3300005617 Bacteria 1139
44 Ga0068864_101893384 3300005618 Bacteria 602
45 Ga0068861_100585587 3300005719 Bacteria 1022
46 Ga0068870_11281768 3300005840 Bacteria 533
47 Ga0068870_11414636 3300005840 Bacteria 510
48 Ga0068863_100689449 3300005841 Bacteria 1015
49 Ga0068863_100827877 3300005841 Bacteria 924
50 Ga0075365_10040332 3300006038 Bacteria 3044
51 Ga0075365_10118622 3300006038 Bacteria 1824
52 Ga0075365_10126850 3300006038 Bacteria 1763
53 Ga0075365_10334669 3300006038 Bacteria 1067
54 Ga0075365_10393992 3300006038 Bacteria 977
55 Ga0075364_10008190 3300006051 Bacteria 6239
56 Ga0075364_10044822 3300006051 Bacteria 2878
57 Ga0075364_10849804 3300006051 Bacteria 622
58 Ga0075364_11088131 3300006051 Bacteria 543
59 Ga0075367_10883212 3300006178 Bacteria 570
60 Ga0068865_101644949 3300006881 Bacteria 578
61 Ga0097620_100658402 3300006931 Bacteria 1139
62 Ga0105244_10002620 3300009036 Bacteria 13485
63 Ga0111539_10333454 3300009094 Bacteria 1766
64 Ga0111539_11678154 3300009094 Bacteria 737
65 Ga0105247_10422059 3300009101 Bacteria 955
66 Ga0105243_10167817 3300009148 Bacteria 1898
67 Ga0105243_10350789 3300009148 Bacteria 1355
68 Ga0105243_10921992 3300009148 Bacteria 870
69 Ga0105243_11109594 3300009148 Bacteria 800
70 Ga0105238_12577848 3300009551 Bacteria 545
71 Ga0105249_10372084 3300009553 Bacteria 1453
72 Ga0105239_11002224 3300010375 Bacteria 960
73 Ga0105246_10005616 3300011119 Bacteria 7648
74 Ga0105246_10227683 3300011119 Bacteria 1466
75 Ga0105246_10323763 3300011119 Bacteria 1254
76 Ga0157373_10008565 3300013100 Bacteria 7595
77 Ga0157371_10312351 3300013102 Bacteria 1139
78 Ga0157371_10722773 3300013102 Bacteria 747
79 Ga0157370_10210269 3300013104 Bacteria 1803
80 Ga0157369_10541004 3300013105 Unclassified 1204
81 Ga0157369_11991186 3300013105 Bacteria 589
82 Ga0157369_12009657 3300013105 Bacteria 586
83 Ga0157372_10071002 3300013307 Bacteria 3920
84 Ga0157372_10099087 3300013307 Bacteria 3324
85 Ga0157380_10036856 3300014326 Bacteria 3787
86 Ga0157377_10077723 3300014745 Bacteria 1933
87 Ga0157377_10356664 3300014745 Bacteria 983
88 Ga0157379_10620520 3300014968 Bacteria 1010
89 Ga0157379_12466567 3300014968 Unclassified 520
90 Ga0209148_1003178 3300025254 Bacteria 4728
91 Ga0209129_1015997 3300025258 Bacteria 1521
92 Ga0209455_1001463 3300025272 Bacteria 10632
93 Ga0209025_1079074 3300025294 Bacteria 1126
94 Ga0209051_1002618 3300025303 Bacteria 12642
95 Ga0207655_1001980 3300025728 Bacteria 17487
96 Ga0207688_10369421 3300025901 Bacteria 886
97 Ga0207688_10571694 3300025901 Bacteria 711
98 Ga0207647_10021501 3300025904 Bacteria 4306
99 Ga0207647_10222377 3300025904 Bacteria 1088
100 Ga0207643_10668977 3300025908 Bacteria 670
101 Ga0207694_10265078 3300025924 Bacteria 1408
102 Ga0207659_10027941 3300025926 Bacteria 3827
103 Ga0207659_10735660 3300025926 Bacteria 846
104 Ga0207690_10697129 3300025932 Bacteria 835
105 Ga0207709_10108202 3300025935 Bacteria 1853
106 Ga0207689_10149623 3300025942 Bacteria 1924
107 Ga0207651_10720950 3300025960 Bacteria 880
108 Ga0207712_10400861 3300025961 Bacteria 1153
109 Ga0207640_12008436 3300025981 Bacteria 524
110 Ga0207658_10005196 3300025986 Bacteria 8963
111 Ga0207677_10331378 3300026023 Bacteria 1268
112 Ga0207639_10942013 3300026041 Bacteria 808
113 Ga0207678_10387246 3300026067 Bacteria 1209
114 Ga0207678_10620409 3300026067 Bacteria 949
115 Ga0207641_10482232 3300026088 Bacteria 1202
116 Ga0207674_10172024 3300026116 Bacteria 2119
117 Ga0207675_100036764 3300026118 Bacteria 4567
118 Ga0207698_10756983 3300026142 Bacteria 971
119 Ga0207428_10178138 3300027907 Bacteria 1607
120 Ga0307512_10367149 3300030522 Bacteria 624
121 Ga0307408_100103676 3300031548 Bacteria 2172
122 Ga0307405_10415140 3300031731 Bacteria 1057
123 Ga0307405_11317500 3300031731 Bacteria 629
124 Ga0307413_10097546 3300031824 Bacteria 1933
125 Ga0307413_10354582 3300031824 Bacteria 1133
126 Ga0307413_10494453 3300031824 Bacteria 981
127 Ga0307518_10436512 3300031838 Bacteria 709
128 Ga0307410_10006190 3300031852 Bacteria 6430
129 Ga0307410_11786262 3300031852 Bacteria 546
130 Ga0307407_10021648 3300031903 Bacteria 3321
131 Ga0307407_10856253 3300031903 Bacteria 695
132 Ga0307407_11003086 3300031903 Bacteria 645
133 Ga0307412_12250820 3300031911 Bacteria 508
134 Ga0307409_100260502 3300031995 Bacteria 1591
135 Ga0307409_100397819 3300031995 Bacteria 1315
136 Ga0307409_101884167 3300031995 Bacteria 627
137 Ga0307416_100273155 3300032002 Bacteria 1661
138 Ga0307416_102052059 3300032002 Bacteria 674
139 Ga0307416_102512138 3300032002 Bacteria 614
140 Ga0307416_102730224 3300032002 Bacteria 590
141 Ga0307416_103345644 3300032002 Bacteria 537
142 Ga0307414_10587107 3300032004 Bacteria 998
143 Ga0307414_10638569 3300032004 Bacteria 959
144 Ga0307415_100161610 3300032126 Bacteria 1737
145 Ga0395900_0884366 3300037418 Bacteria 817
146 Ga0395898_0254694 3300037466 Bacteria 1674
147 Ga0451791_0189408 3300041451 Bacteria 795
148 Ga0451791_0618914 3300041451 Bacteria 937
149 Ga0451791_1121960 3300041451 Bacteria 534
150 Ga0451793_1654409 3300041452 Bacteria 1119
151 Ga0451795_0043999 3300041456 Bacteria 667
152 Ga0451800_0553936 3300041459 Bacteria 527
153 Ga0451835_0391059 3300041492 Bacteria 566
154 Ga0451841_1383555 3300041498 Bacteria 1099
155 Ga0451849_0243764 3300041505 Bacteria 649
156 Ga0451853_1616335 3300041512 Bacteria 730
157 Ga0451853_2723876 3300041512 Bacteria 506
158 Ga0451853_4051256 3300041512 Bacteria 654
159 Ga0466972_0058833 3300044658 Bacteria 1845
160 Ga0466965_0021755 3300044683 Bacteria 3090
161 Ga0466965_0032834 3300044683 Bacteria 2535
162 Ga0466965_0849384 3300044683 Bacteria 530
163 Ga0466961_0146390 3300044693 Bacteria 1477
164 Ga0466961_0416135 3300044693 Bacteria 815
165 Ga0466968_0360323 3300044735 Bacteria 708
166 Ga0466970_0047807 3300044765 Bacteria 2281
167 Ga0466970_0084575 3300044765 Bacteria 1717
168 Ga0466970_0164595 3300044765 Bacteria 1227
169 Ga0466960_0310057 3300044901 Bacteria 891
170 Ga0466960_0658611 3300044901 Bacteria 625
171 Ga0466967_0531311 3300045976 Bacteria 1156
172 Ga0495582_0711735 3300046473 Bacteria 581
173 Ga0495667_0817796 3300046559 Bacteria 574
174 Ga0495647_0315599 3300046681 Bacteria 707
175 Ga0495658_0482727 3300046683 Bacteria 792
176 Ga0495672_0000129 3300047320 Bacteria 112879
177 Ga0496103_0479101 3300048906 Bacteria 797
178 Ga0496104_0964299 3300048907 Bacteria 757
179 Ga0496105_0341615 3300048908 Bacteria 1197
180 Ga0496109_0281739 3300048912 Bacteria 1567
181 Ga0496109_1646573 3300048912 Bacteria 576
182 Ga0496110_0384029 3300048913 Bacteria 1280
183 Ga0496110_1071999 3300048913 Bacteria 714
184 Ga0496110_1315101 3300048913 Bacteria 632
185 Ga0496111_0148781 3300048914 Bacteria 1737
186 Ga0496111_1083936 3300048914 Bacteria 571
187 Ga0496113_0217872 3300048916 Bacteria 1521
188 Ga0496113_0422561 3300048916 Bacteria 1071
189 Ga0496114_0030043 3300048917 Bacteria 4469
190 Ga0496114_1146403 3300048917 Bacteria 663
191 Ga0496116_0148519 3300048919 Bacteria 1306
192 Ga0496117_0000817 3300048920 Bacteria 48233
193 Ga0496117_0005751 3300048920 Bacteria 12883
194 Ga0496117_0082287 3300048920 Bacteria 2109
195 Ga0496117_0156745 3300048920 Bacteria 1339
196 Ga0496117_0158758 3300048920 Bacteria 1328
197 Ga0496117_0215235 3300048920 Bacteria 1074
198 Ga0496118_0002649 3300048921 Bacteria 23697
199 Ga0496118_0003920 3300048921 Bacteria 18214
200 Ga0496120_0041905 3300048923 Bacteria 2677
201 Ga0496122_0000986 3300048925 Bacteria 50817
202 Ga0496122_0154924 3300048925 Bacteria 1408
203 Ga0496122_0412600 3300048925 Bacteria 682
204 Ga0496123_0000241 3300048926 Bacteria 110078
205 Ga0496123_0006938 3300048926 Bacteria 10821
206 Ga0496124_0006349 3300048927 Bacteria 12902
207 Ga0496124_0117998 3300048927 Bacteria 2125
208 Ga0496125_0002894 3300048928 Bacteria 21630
209 Ga0496125_0015880 3300048928 Bacteria 7254
210 Ga0496125_0428852 3300048928 Bacteria 764
211 Ga0496126_0016052 3300048929 Bacteria 7509
212 Ga0496126_0319203 3300048929 Bacteria 1277
213 Ga0496126_0898132 3300048929 Bacteria 672
214 Ga0501032_0003744 3300049569 Bacteria 11532
215 Ga0501033_0001662 3300049570 Bacteria 19465
216 Ga0501033_0043491 3300049570 Bacteria 3346
217 Ga0501033_0185038 3300049570 Bacteria 1492
218 Ga0501034_0002598 3300049571 Bacteria 21475
219 Ga0501034_0013399 3300049571 Bacteria 8440
220 Ga0501036_0304739 3300049572 Bacteria 1332
221 Ga0501036_0893539 3300049572 Bacteria 729
222 Ga0501036_1264809 3300049572 Bacteria 600
223 Ga0501037_0010807 3300049573 Bacteria 6709
224 Ga0501037_0038901 3300049573 Bacteria 3503
225 Ga0501038_0018629 3300049574 Bacteria 6270
226 Ga0501038_1188017 3300049574 Bacteria 554
227 Ga0501038_1235292 3300049574 Bacteria 541
228 Ga0501039_0008685 3300049575 Bacteria 7739
229 Ga0501039_0286517 3300049575 Bacteria 1295
230 Ga0501040_0392067 3300049576 Bacteria 997
231 Ga0501040_0703805 3300049576 Bacteria 731
232 Ga0501041_0844745 3300049577 Bacteria 588
233 Ga0501042_0025507 3300049578 Bacteria 4152
234 Ga0501042_0244477 3300049578 Bacteria 1295
235 Ga0501043_0003435 3300049579 Bacteria 13011
236 Ga0501043_0750318 3300049579 Bacteria 709
237 Ga0501046_0002527 3300049580 Bacteria 17113
238 Ga0501047_0012148 3300049581 Bacteria 8151
239 Ga0501048_0040499 3300049582 Bacteria 3338
240 Ga0501048_0494559 3300049582 Bacteria 877
241 Ga0501069_0858123 3300049585 Bacteria 551
242 Ga0501070_0124188 3300049586 Bacteria 2133
243 Ga0501070_0888416 3300049586 Bacteria 696
244 Ga0501071_0223997 3300049587 Bacteria 1416
245 Ga0501071_0402654 3300049587 Bacteria 1045
246 Ga0501073_0013281 3300049589 Bacteria 6000
247 Ga0501074_0050343 3300049590 Bacteria 3007
248 Ga0501080_0146284 3300049742 Bacteria 2184
249 Ga0501080_0842941 3300049742 Bacteria 802
250 Ga0501035_0000587 3300049822 Bacteria 40047
251 Ga0501035_0066979 3300049822 Bacteria 3186
252 Ga0501044_0003485 3300049823 Bacteria 17720
253 Ga0501044_0138871 3300049823 Bacteria 2419
254 Ga0501044_0203241 3300049823 Bacteria 1938
255 Ga0501045_0012420 3300049824 Bacteria 5996
256 nmdc:mga03n38_348755_c1 3300050490 Bacteria 805
257 nmdc:mga00v17_30181_c1 3300050491 Bacteria 3188
258 nmdc:mga00v17_36793_c1 3300050491 Bacteria 2919
259 nmdc:mga00v17_678879_c1 3300050491 Bacteria 661
260 nmdc:mga0yw44_461047_c1 3300050492 Bacteria 861
261 nmdc:mga0yw44_86396_c1 3300050492 Bacteria 1975
262 nmdc:mga0yw44_98266_c1 3300050492 Bacteria 1861
263 nmdc:mga07m45_494600_c1 3300050496 Bacteria 708
264 nmdc:mga08y16_1236731_c1 3300050511 Bacteria 716
265 nmdc:mga08y16_239381_c1 3300050511 Bacteria 1876
266 nmdc:mga0sz30_62138_c1 3300050516 Bacteria 1597
267 Ga0500556_0000145 3300053104 Bacteria 59342
268 Ga0500628_081454 3300053129 Bacteria 829
269 Ga0501084_0172300 3300054114 Bacteria 1827
270 Ga0501084_0494487 3300054114 Bacteria 1034
271 Ga0501082_2012892 3300060353 Bacteria 503
272 Ga0466962_0206446 3300061719 Bacteria 961
273 Ga0466962_0570566 3300061719 Bacteria 576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2884994152 2884997609 91
2 iso_pu_bacteria 2932431166 2932431259 91
3 iso_pu_bacteria 8033684223 8033684370 91
4 iso_pu_bacteria 2585428094 2587861831 92
5 iso_pu_bacteria 2751185725 2753037081 92
6 iso_pu_bacteria 2751185792 2753324950 92
7 iso_pu_bacteria 2844841374 2844842909 92
8 iso_pu_bacteria 2844852863 2844854172 92
9 iso_pu_bacteria 2857729791 2857731634 92
10 iso_pu_bacteria 2862993130 2862994421 92
11 iso_pu_bacteria 2919055335 2919058884 92
12 iso_pu_bacteria 2919523602 2919525540 92
13 iso_pu_bacteria 2928121344 2928124463 92
14 iso_pu_bacteria 2928153084 2928156809 92
15 iso_pu_bacteria 2932398195 2932400848 92
16 iso_pu_bacteria 2939657138 2939660044 92
17 iso_pu_bacteria 2946033335 2946036520 92
18 iso_pu_bacteria 2964326757 2964328040 92
19 iso_pu_bacteria 8056037122 8056040009 92
20 iso_pu_bacteria 8057345674 8057347268 92
21 iso_pu_bacteria 8057345674 8057348627 92
22 3300005338 Ga0068868_100424337 Ga0068868_1004243372 93
23 3300005347 Ga0070668_101998345 Ga0070668_1019983451 93
24 3300005356 Ga0070674_101901467 Ga0070674_1019014671 93
25 3300005437 Ga0070710_10000376 Ga0070710_1000037631 93
26 3300005455 Ga0070663_101173129 Ga0070663_1011731292 93
27 3300005616 Ga0068852_101849647 Ga0068852_1018496472 93
28 3300005840 Ga0068870_11414636 Ga0068870_114146361 93
29 3300006038 Ga0075365_10040332 Ga0075365_100403323 93
30 3300006038 Ga0075365_10118622 Ga0075365_101186223 93
31 3300006038 Ga0075365_10126850 Ga0075365_101268503 93
32 3300006038 Ga0075365_10334669 Ga0075365_103346693 93
33 3300006051 Ga0075364_10008190 Ga0075364_100081904 93
34 3300006051 Ga0075364_11088131 Ga0075364_110881311 93
35 3300006178 Ga0075367_10883212 Ga0075367_108832122 93
36 3300006881 Ga0068865_101644949 Ga0068865_1016449492 93
37 3300009094 Ga0111539_11678154 Ga0111539_116781542 93
38 3300014968 Ga0157379_12466567 Ga0157379_124665671 93
39 3300025908 Ga0207643_10668977 Ga0207643_106689771 93
40 3300026023 Ga0207677_10331378 Ga0207677_103313782 93
41 3300031824 Ga0307413_10097546 Ga0307413_100975462 93
42 3300031903 Ga0307407_10856253 Ga0307407_108562532 93
43 3300031995 Ga0307409_100397819 Ga0307409_1003978192 93
44 3300041505 Ga0451849_0243764 Ga0451849_0243764_304_585 93
45 3300041512 Ga0451853_1616335 Ga0451853_1616335_374_655 93
46 3300041512 Ga0451853_2723876 Ga0451853_2723876_20_301 93
47 3300044735 Ga0466968_0360323 Ga0466968_0360323_30_311 93
48 3300047320 Ga0495672_0000129 Ga0495672_0000129_76361_76642 93
49 3300048913 Ga0496110_0384029 Ga0496110_0384029_483_764 93
50 3300048913 Ga0496110_1071999 Ga0496110_1071999_111_392 93
51 3300048914 Ga0496111_0148781 Ga0496111_0148781_611_892 93
52 3300049572 Ga0501036_0893539 Ga0501036_0893539_370_651 93
53 3300049574 Ga0501038_1235292 Ga0501038_1235292_70_351 93
54 3300049575 Ga0501039_0286517 Ga0501039_0286517_66_347 93
55 3300049576 Ga0501040_0392067 Ga0501040_0392067_420_701 93
56 3300049576 Ga0501040_0703805 Ga0501040_0703805_230_511 93
57 3300049577 Ga0501041_0844745 Ga0501041_0844745_97_378 93
58 3300049578 Ga0501042_0244477 Ga0501042_0244477_808_1089 93
59 3300049582 Ga0501048_0494559 Ga0501048_0494559_573_854 93
60 3300049587 Ga0501071_0223997 Ga0501071_0223997_653_934 93
61 3300049742 Ga0501080_0842941 Ga0501080_0842941_170_451 93
62 3300050490 nmdc:mga03n38_348755_c1 nmdc:mga03n38_348755_c1_459_740 93
63 3300050491 nmdc:mga00v17_30181_c1 nmdc:mga00v17_30181_c1_2850_3131 93
64 3300050492 nmdc:mga0yw44_461047_c1 nmdc:mga0yw44_461047_c1_449_730 93
65 3300050492 nmdc:mga0yw44_86396_c1 nmdc:mga0yw44_86396_c1_336_617 93
66 3300050492 nmdc:mga0yw44_98266_c1 nmdc:mga0yw44_98266_c1_1167_1448 93
67 3300050511 nmdc:mga08y16_1236731_c1 nmdc:mga08y16_1236731_c1_107_388 93
68 3300054114 Ga0501084_0172300 Ga0501084_0172300_230_511 93
69 3300060353 Ga0501082_2012892 Ga0501082_2012892_177_458 93
70 iso_pu_bacteria 2643221575 2643886777 93
71 iso_pu_bacteria 2643221681 2644457971 93
72 iso_pu_bacteria 2852677369 2852679579 93
73 iso_pu_bacteria 2857733635 2857734003 93
74 iso_pu_bacteria 2857740372 2857743439 93
75 iso_pu_bacteria 2904776348 2904780260 93
76 iso_pu_bacteria 2910809715 2910811032 93
77 iso_pu_bacteria 2919538618 2919541652 93
78 iso_pu_bacteria 2932426870 2932429578 93
79 iso_pu_bacteria 2933418574 2933420458 93
80 iso_pu_bacteria 2939674588 2939677919 93
81 iso_pu_bacteria 2946024296 2946024877 93
82 3300005840 Ga0068870_11281768 Ga0068870_112817682 94
83 3300041451 Ga0451791_0189408 Ga0451791_0189408_224_508 94
84 3300041452 Ga0451793_1654409 Ga0451793_1654409_495_779 94
85 3300041456 Ga0451795_0043999 Ga0451795_0043999_38_322 94
86 3300041498 Ga0451841_1383555 Ga0451841_1383555_50_334 94
87 3300048912 Ga0496109_0281739 Ga0496109_0281739_475_759 94
88 3300048917 Ga0496114_0030043 Ga0496114_0030043_292_576 94
89 3300005456 Ga0070678_101342927 Ga0070678_1013429271 95
90 3300005547 Ga0070693_100404636 Ga0070693_1004046361 95
91 3300005563 Ga0068855_101893389 Ga0068855_1018933892 95
92 3300005616 Ga0068852_102221135 Ga0068852_1022211352 95
93 3300009101 Ga0105247_10422059 Ga0105247_104220592 95
94 3300009551 Ga0105238_12577848 Ga0105238_125778482 95
95 3300013105 Ga0157369_12009657 Ga0157369_120096572 95
96 3300013307 Ga0157372_10099087 Ga0157372_100990875 95
97 3300025924 Ga0207694_10265078 Ga0207694_102650782 95
98 3300025981 Ga0207640_12008436 Ga0207640_120084361 95
99 3300026142 Ga0207698_10756983 Ga0207698_107569832 95
100 3300031731 Ga0307405_10415140 Ga0307405_104151402 95
101 3300032002 Ga0307416_102052059 Ga0307416_1020520591 95
102 3300044683 Ga0466965_0021755 Ga0466965_0021755_1155_1442 95
103 3300044693 Ga0466961_0416135 Ga0466961_0416135_503_790 95
104 3300044765 Ga0466970_0047807 Ga0466970_0047807_417_704 95
105 3300044765 Ga0466970_0164595 Ga0466970_0164595_535_822 95
106 3300044901 Ga0466960_0658611 Ga0466960_0658611_85_372 95
107 3300048916 Ga0496113_0422561 Ga0496113_0422561_424_714 95
108 3300053104 Ga0500556_0000145 Ga0500556_0000145_6176_6505 95
109 3300061719 Ga0466962_0570566 Ga0466962_0570566_164_451 95
110 3300001990 JGI24737J22298_10042576 JGI24737J22298_100425762 96
111 3300002067 JGI24735J21928_10008531 JGI24735J21928_100085315 96
112 3300003578 Ga0006562J51391_1024612 Ga0006562J51391_10246125 96
113 3300003578 Ga0006562J51391_1024614 Ga0006562J51391_10246142 96
114 3300005435 Ga0070714_100660039 Ga0070714_1006600392 96
115 3300005455 Ga0070663_100435133 Ga0070663_1004351331 96
116 3300005577 Ga0068857_101313462 Ga0068857_1013134622 96
117 3300005616 Ga0068852_100581155 Ga0068852_1005811552 96
118 3300006051 Ga0075364_10044822 Ga0075364_100448223 96
119 3300009094 Ga0111539_10333454 Ga0111539_103334541 96
120 3300009148 Ga0105243_10167817 Ga0105243_101678173 96
121 3300013102 Ga0157371_10312351 Ga0157371_103123513 96
122 3300013105 Ga0157369_11991186 Ga0157369_119911861 96
123 3300013307 Ga0157372_10071002 Ga0157372_100710025 96
124 3300025258 Ga0209129_1015997 Ga0209129_10159972 96
125 3300025294 Ga0209025_1079074 Ga0209025_10790742 96
126 3300025904 Ga0207647_10222377 Ga0207647_102223773 96
127 3300025935 Ga0207709_10108202 Ga0207709_101082023 96
128 3300025986 Ga0207658_10005196 Ga0207658_100051969 96
129 3300026067 Ga0207678_10620409 Ga0207678_106204091 96
130 3300027907 Ga0207428_10178138 Ga0207428_101781382 96
131 3300031852 Ga0307410_11786262 Ga0307410_117862621 96
132 3300031903 Ga0307407_11003086 Ga0307407_110030862 96
133 3300031911 Ga0307412_12250820 Ga0307412_122508202 96
134 3300031995 Ga0307409_101884167 Ga0307409_1018841671 96
135 3300032002 Ga0307416_102512138 Ga0307416_1025121382 96
136 3300032002 Ga0307416_102730224 Ga0307416_1027302242 96
137 3300032002 Ga0307416_103345644 Ga0307416_1033456442 96
138 3300032004 Ga0307414_10587107 Ga0307414_105871072 96
139 3300032004 Ga0307414_10638569 Ga0307414_106385692 96
140 3300032126 Ga0307415_100161610 Ga0307415_1001616102 96
141 3300037418 Ga0395900_0884366 Ga0395900_0884366_424_747 96
142 3300037466 Ga0395898_0254694 Ga0395898_0254694_826_1149 96
143 3300041451 Ga0451791_0618914 Ga0451791_0618914_205_495 96
144 3300041459 Ga0451800_0553936 Ga0451800_0553936_226_516 96
145 3300041512 Ga0451853_4051256 Ga0451853_4051256_129_419 96
146 3300044658 Ga0466972_0058833 Ga0466972_0058833_711_1001 96
147 3300044683 Ga0466965_0032834 Ga0466965_0032834_1054_1344 96
148 3300044683 Ga0466965_0849384 Ga0466965_0849384_192_497 96
149 3300044693 Ga0466961_0146390 Ga0466961_0146390_909_1199 96
150 3300044765 Ga0466970_0084575 Ga0466970_0084575_1377_1667 96
151 3300044901 Ga0466960_0310057 Ga0466960_0310057_528_818 96
152 3300045976 Ga0466967_0531311 Ga0466967_0531311_243_533 96
153 3300046473 Ga0495582_0711735 Ga0495582_0711735_74_364 96
154 3300046559 Ga0495667_0817796 Ga0495667_0817796_89_379 96
155 3300046681 Ga0495647_0315599 Ga0495647_0315599_268_558 96
156 3300046683 Ga0495658_0482727 Ga0495658_0482727_417_707 96
157 3300048908 Ga0496105_0341615 Ga0496105_0341615_785_1081 96
158 3300048914 Ga0496111_1083936 Ga0496111_1083936_149_442 96
159 3300048916 Ga0496113_0217872 Ga0496113_0217872_654_944 96
160 3300048919 Ga0496116_0148519 Ga0496116_0148519_541_837 96
161 3300048920 Ga0496117_0000817 Ga0496117_0000817_33926_34219 96
162 3300048920 Ga0496117_0005751 Ga0496117_0005751_9048_9338 96
163 3300048920 Ga0496117_0082287 Ga0496117_0082287_1113_1409 96
164 3300048920 Ga0496117_0156745 Ga0496117_0156745_250_546 96
165 3300048920 Ga0496117_0158758 Ga0496117_0158758_363_656 96
166 3300048920 Ga0496117_0215235 Ga0496117_0215235_492_785 96
167 3300048921 Ga0496118_0002649 Ga0496118_0002649_12816_13109 96
168 3300048921 Ga0496118_0003920 Ga0496118_0003920_2392_2688 96
169 3300048923 Ga0496120_0041905 Ga0496120_0041905_2373_2666 96
170 3300048925 Ga0496122_0000986 Ga0496122_0000986_11057_11350 96
171 3300048925 Ga0496122_0154924 Ga0496122_0154924_1064_1354 96
172 3300048925 Ga0496122_0412600 Ga0496122_0412600_375_668 96
173 3300048926 Ga0496123_0000241 Ga0496123_0000241_16982_17275 96
174 3300048926 Ga0496123_0006938 Ga0496123_0006938_3830_4129 96
175 3300048927 Ga0496124_0006349 Ga0496124_0006349_4959_5252 96
176 3300048927 Ga0496124_0117998 Ga0496124_0117998_800_1099 96
177 3300048928 Ga0496125_0002894 Ga0496125_0002894_11243_11539 96
178 3300048928 Ga0496125_0015880 Ga0496125_0015880_3414_3707 96
179 3300048929 Ga0496126_0016052 Ga0496126_0016052_4892_5185 96
180 3300049569 Ga0501032_0003744 Ga0501032_0003744_4833_5123 96
181 3300049570 Ga0501033_0001662 Ga0501033_0001662_2257_2547 96
182 3300049570 Ga0501033_0043491 Ga0501033_0043491_1363_1656 96
183 3300049570 Ga0501033_0185038 Ga0501033_0185038_748_1038 96
184 3300049571 Ga0501034_0002598 Ga0501034_0002598_9802_10092 96
185 3300049571 Ga0501034_0013399 Ga0501034_0013399_62_352 96
186 3300049572 Ga0501036_0304739 Ga0501036_0304739_510_800 96
187 3300049572 Ga0501036_1264809 Ga0501036_1264809_17_307 96
188 3300049573 Ga0501037_0010807 Ga0501037_0010807_4327_4617 96
189 3300049573 Ga0501037_0038901 Ga0501037_0038901_1196_1486 96
190 3300049574 Ga0501038_0018629 Ga0501038_0018629_2008_2298 96
191 3300049574 Ga0501038_1188017 Ga0501038_1188017_13_303 96
192 3300049575 Ga0501039_0008685 Ga0501039_0008685_553_843 96
193 3300049578 Ga0501042_0025507 Ga0501042_0025507_66_356 96
194 3300049579 Ga0501043_0003435 Ga0501043_0003435_12631_12921 96
195 3300049579 Ga0501043_0750318 Ga0501043_0750318_15_305 96
196 3300049580 Ga0501046_0002527 Ga0501046_0002527_6071_6361 96
197 3300049581 Ga0501047_0012148 Ga0501047_0012148_814_1104 96
198 3300049582 Ga0501048_0040499 Ga0501048_0040499_1421_1711 96
199 3300049585 Ga0501069_0858123 Ga0501069_0858123_121_411 96
200 3300049586 Ga0501070_0124188 Ga0501070_0124188_1585_1875 96
201 3300049586 Ga0501070_0888416 Ga0501070_0888416_76_369 96
202 3300049587 Ga0501071_0402654 Ga0501071_0402654_659_949 96
203 3300049589 Ga0501073_0013281 Ga0501073_0013281_5556_5846 96
204 3300049590 Ga0501074_0050343 Ga0501074_0050343_1191_1481 96
205 3300049742 Ga0501080_0146284 Ga0501080_0146284_1774_2064 96
206 3300049822 Ga0501035_0000587 Ga0501035_0000587_20607_20897 96
207 3300049822 Ga0501035_0066979 Ga0501035_0066979_2879_3169 96
208 3300049823 Ga0501044_0003485 Ga0501044_0003485_7605_7895 96
209 3300049823 Ga0501044_0138871 Ga0501044_0138871_749_1039 96
210 3300049823 Ga0501044_0203241 Ga0501044_0203241_1273_1563 96
211 3300049824 Ga0501045_0012420 Ga0501045_0012420_4815_5105 96
212 3300050491 nmdc:mga00v17_36793_c1 nmdc:mga00v17_36793_c1_1659_1949 96
213 3300050496 nmdc:mga07m45_494600_c1 nmdc:mga07m45_494600_c1_61_351 96
214 3300050511 nmdc:mga08y16_239381_c1 nmdc:mga08y16_239381_c1_1547_1837 96
215 3300050516 nmdc:mga0sz30_62138_c1 nmdc:mga0sz30_62138_c1_1163_1453 96
216 3300054114 Ga0501084_0494487 Ga0501084_0494487_295_585 96
217 3300061719 Ga0466962_0206446 Ga0466962_0206446_327_617 96
218 3300000041 ARcpr5oldR_c024559 ARcpr5oldR_0245592 97
219 3300001989 JGI24739J22299_10010531 JGI24739J22299_100105315 97
220 3300001990 JGI24737J22298_10006087 JGI24737J22298_100060873 97
221 3300002067 JGI24735J21928_10088515 JGI24735J21928_100885152 97
222 3300002075 JGI24738J21930_10122558 JGI24738J21930_101225582 97
223 3300003322 rootL2_10009907 rootL2_100099074 97
224 3300003322 rootL2_10335033 rootL2_103350332 97
225 3300003578 Ga0006562J51391_1034584 Ga0006562J51391_10345841 97
226 3300003762 Ga0055542_1008069 Ga0055542_10080692 97
227 3300003792 Ga0055540_1050308 Ga0055540_10503082 97
228 3300005334 Ga0068869_101147599 Ga0068869_1011475991 97
229 3300005337 Ga0070682_100708640 Ga0070682_1007086401 97
230 3300005344 Ga0070661_101295797 Ga0070661_1012957971 97
231 3300005347 Ga0070668_100314477 Ga0070668_1003144772 97
232 3300005347 Ga0070668_101249640 Ga0070668_1012496402 97
233 3300005354 Ga0070675_100158872 Ga0070675_1001588723 97
234 3300005364 Ga0070673_101005550 Ga0070673_1010055501 97
235 3300005366 Ga0070659_100835701 Ga0070659_1008357012 97
236 3300005441 Ga0070700_101292023 Ga0070700_1012920231 97
237 3300005539 Ga0068853_100655605 Ga0068853_1006556052 97
238 3300005543 Ga0070672_101485820 Ga0070672_1014858202 97
239 3300005546 Ga0070696_100394276 Ga0070696_1003942762 97
240 3300005548 Ga0070665_101213993 Ga0070665_1012139932 97
241 3300005577 Ga0068857_100216608 Ga0068857_1002166083 97
242 3300005617 Ga0068859_100658451 Ga0068859_1006584512 97
243 3300005618 Ga0068864_101893384 Ga0068864_1018933842 97
244 3300005719 Ga0068861_100585587 Ga0068861_1005855872 97
245 3300005841 Ga0068863_100689449 Ga0068863_1006894492 97
246 3300005841 Ga0068863_100827877 Ga0068863_1008278772 97
247 3300006038 Ga0075365_10393992 Ga0075365_103939922 97
248 3300006051 Ga0075364_10849804 Ga0075364_108498042 97
249 3300006931 Ga0097620_100658402 Ga0097620_1006584022 97
250 3300009036 Ga0105244_10002620 Ga0105244_1000262016 97
251 3300009148 Ga0105243_10350789 Ga0105243_103507892 97
252 3300009148 Ga0105243_10921992 Ga0105243_109219922 97
253 3300009148 Ga0105243_11109594 Ga0105243_111095942 97
254 3300009553 Ga0105249_10372084 Ga0105249_103720841 97
255 3300010375 Ga0105239_11002224 Ga0105239_110022242 97
256 3300011119 Ga0105246_10005616 Ga0105246_1000561610 97
257 3300011119 Ga0105246_10227683 Ga0105246_102276832 97
258 3300011119 Ga0105246_10323763 Ga0105246_103237631 97
259 3300013100 Ga0157373_10008565 Ga0157373_100085651 97
260 3300013102 Ga0157371_10722773 Ga0157371_107227732 97
261 3300013104 Ga0157370_10210269 Ga0157370_102102692 97
262 3300013105 Ga0157369_10541004 Ga0157369_105410042 97
263 3300014326 Ga0157380_10036856 Ga0157380_100368562 97
264 3300014745 Ga0157377_10077723 Ga0157377_100777232 97
265 3300014745 Ga0157377_10356664 Ga0157377_103566642 97
266 3300014968 Ga0157379_10620520 Ga0157379_106205202 97
267 3300025254 Ga0209148_1003178 Ga0209148_10031782 97
268 3300025272 Ga0209455_1001463 Ga0209455_10014638 97
269 3300025303 Ga0209051_1002618 Ga0209051_100261813 97
270 3300025728 Ga0207655_1001980 Ga0207655_100198020 97
271 3300025901 Ga0207688_10369421 Ga0207688_103694212 97
272 3300025901 Ga0207688_10571694 Ga0207688_105716941 97
273 3300025904 Ga0207647_10021501 Ga0207647_100215015 97
274 3300025926 Ga0207659_10027941 Ga0207659_100279415 97
275 3300025926 Ga0207659_10735660 Ga0207659_107356601 97
276 3300025932 Ga0207690_10697129 Ga0207690_106971292 97
277 3300025942 Ga0207689_10149623 Ga0207689_101496233 97
278 3300025960 Ga0207651_10720950 Ga0207651_107209502 97
279 3300025961 Ga0207712_10400861 Ga0207712_104008612 97
280 3300026041 Ga0207639_10942013 Ga0207639_109420132 97
281 3300026067 Ga0207678_10387246 Ga0207678_103872462 97
282 3300026088 Ga0207641_10482232 Ga0207641_104822322 97
283 3300026116 Ga0207674_10172024 Ga0207674_101720243 97
284 3300026118 Ga0207675_100036764 Ga0207675_1000367646 97
285 3300030522 Ga0307512_10367149 Ga0307512_103671492 97
286 3300031548 Ga0307408_100103676 Ga0307408_1001036763 97
287 3300031731 Ga0307405_11317500 Ga0307405_113175002 97
288 3300031824 Ga0307413_10354582 Ga0307413_103545822 97
289 3300031824 Ga0307413_10494453 Ga0307413_104944532 97
290 3300031838 Ga0307518_10436512 Ga0307518_104365122 97
291 3300031852 Ga0307410_10006190 Ga0307410_100061904 97
292 3300031903 Ga0307407_10021648 Ga0307407_100216482 97
293 3300031995 Ga0307409_100260502 Ga0307409_1002605022 97
294 3300032002 Ga0307416_100273155 Ga0307416_1002731553 97
295 3300041451 Ga0451791_1121960 Ga0451791_1121960_22_315 97
296 3300041492 Ga0451835_0391059 Ga0451835_0391059_104_403 97
297 3300048906 Ga0496103_0479101 Ga0496103_0479101_482_778 97
298 3300048907 Ga0496104_0964299 Ga0496104_0964299_69_365 97
299 3300048912 Ga0496109_1646573 Ga0496109_1646573_121_417 97
300 3300048913 Ga0496110_1315101 Ga0496110_1315101_169_465 97
301 3300048917 Ga0496114_1146403 Ga0496114_1146403_108_401 97
302 3300048928 Ga0496125_0428852 Ga0496125_0428852_103_432 97
303 3300048929 Ga0496126_0319203 Ga0496126_0319203_631_936 97
304 3300048929 Ga0496126_0898132 Ga0496126_0898132_237_530 97
305 3300050491 nmdc:mga00v17_678879_c1 nmdc:mga00v17_678879_c1_326_628 97
306 3300053129 Ga0500628_081454 Ga0500628_081454_169_465 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14117

DUF4287

Domain of unknown function (DUF4287)

14

76

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ezx-assembly1.cif.gz_A solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure 0.7212 19 62
8f2u-assembly1.cif.gz_I human ccc complex 0.6312 19 62
4oe9-assembly2.cif.gz_B the crystal structure of the n-terminal domain of commd9 0.5794 1 63
2dkz-assembly1.cif.gz_A solution structure of the sam_pnt-domain of the hypothetical protein loc64762 0.5754 37 77
8esd-assembly1.cif.gz_N crystal structure of commd7-commd9-commd5-commd10 tetramer 0.5452 3 62
ID Description Score Start End Superfamily
1qckA00 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Barrier-to-autointegration factor, BAF 0.7437 19 62 1.10.150.40
af_O33192_24_118_1.10.110.10 Mainly Alpha;Orthogonal Bundle;Hydrophobic Seed Protein;Plant lipid-transfer and hydrophobic proteins 0.7012 18 62 1.10.110.10
af_Q76NP9_1_134_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.6791 33 62 1.25.40.180
2jhnB02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.6371 32 61 1.10.340.30
2dkzA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Transcription Factor, Ets-1 0.615 32 62 1.10.150.50
ID Description Score Start End GO Terms
AF-A0A542ZX10-F1-model_v4 Uncharacterized protein DUF4287 0.9762 1 95
AF-A0A4V3D8U6-F1-model_v4 Uncharacterized protein DUF4287 0.976 2 95
AF-A3TPK8-F1-model_v4 Valyl-tRNA synthetase 0.9674 1 92
AF-A0A495KY93-F1-model_v4 Uncharacterized protein DUF4287 0.9626 1 97
AF-A0A7J9UYT5-F1-model_v4 DUF4287 domain-containing protein 0.9585 1 95

Feature Viewer

pLDDT pTM Quality
90.19 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map