F398860

General Info

Members Datasets Scaffolds Average Seq Length
306 188 612 165

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0274821|Ga0496111_0274821_46_585
Length 179
Sequence MLSLTASSGSEDDHVTSIDLDAINAERERIKQDLLTSEAERPDSSARGLHHFALICSDVRRTIEFYQGVLEFPLTEIFENRDYPGSNHFFFDIGNGNLIAFFDLPGLDLGPYAEVLGGLHHLAISVTPEKWEHLRGKLDAAGVEYLVESEKSIYFRDPDGARLELLADPLGEMYGTKVL

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
111 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
176 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
182 2643221615 Nocardioides sp. Root224 Isolate Unclassified
183 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
184 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
185 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
186 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
187 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
188 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0.33
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.5
Nodule 0
Rhizoplane 5.56
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0274821 3300048914 Bacteria 1250
2 JGI24737J22298_10018205 3300001990 Bacteria 2256
3 JGI24735J21928_10020274 3300002067 Bacteria 2038
4 JGI24735J21928_10172113 3300002067 Bacteria 626
5 JGI24738J21930_10083104 3300002075 Bacteria 672
6 JGI25404J52841_10128787 3300003659 Bacteria 535
7 Ga0070658_10188712 3300005327 Bacteria 1737
8 Ga0070658_10549002 3300005327 Bacteria 1000
9 Ga0070683_100001135 3300005329 Bacteria 20137
10 Ga0070683_100001834 3300005329 Bacteria 16570
11 Ga0070683_100064845 3300005329 Bacteria 3401
12 Ga0068869_100176099 3300005334 Bacteria 1674
13 Ga0070680_100104558 3300005336 Bacteria 2353
14 Ga0070682_100009729 3300005337 Bacteria 5444
15 Ga0070682_100251669 3300005337 Bacteria 1274
16 Ga0070682_100274084 3300005337 Bacteria 1227
17 Ga0068868_100332054 3300005338 Bacteria 1298
18 Ga0068868_100799144 3300005338 Bacteria 851
19 Ga0070660_100008616 3300005339 Bacteria 7139
20 Ga0070691_10214109 3300005341 Bacteria 1018
21 Ga0070661_100231905 3300005344 Bacteria 1419
22 Ga0070692_10036809 3300005345 Bacteria 2485
23 Ga0070668_100002262 3300005347 Bacteria 14176
24 Ga0070668_100220555 3300005347 Bacteria 1564
25 Ga0070668_100451942 3300005347 Bacteria 1105
26 Ga0070659_100160286 3300005366 Bacteria 1839
27 Ga0070659_100371051 3300005366 Bacteria 1204
28 Ga0070667_100064613 3300005367 Bacteria 3105
29 Ga0070667_100331498 3300005367 Bacteria 1375
30 Ga0070714_100136610 3300005435 Bacteria 2196
31 Ga0070694_100579839 3300005444 Bacteria 901
32 Ga0070663_100003080 3300005455 Bacteria 9533
33 Ga0070663_100165998 3300005455 Bacteria 1703
34 Ga0070678_100062235 3300005456 Bacteria 2755
35 Ga0070678_100954645 3300005456 Bacteria 786
36 Ga0070681_10069390 3300005458 Bacteria 3491
37 Ga0070685_10045587 3300005466 Bacteria 2515
38 Ga0070679_100063817 3300005530 Bacteria 3671
39 Ga0070679_100171828 3300005530 Bacteria 2140
40 Ga0070684_100002960 3300005535 Bacteria 12646
41 Ga0070684_100010058 3300005535 Bacteria 7478
42 Ga0070672_100401484 3300005543 Bacteria 1175
43 Ga0070695_100549850 3300005545 Bacteria 900
44 Ga0070696_100361964 3300005546 Bacteria 1126
45 Ga0068855_100337291 3300005563 Bacteria 1663
46 Ga0070664_100072581 3300005564 Bacteria 2952
47 Ga0070664_100125063 3300005564 Bacteria 2254
48 Ga0068857_100912301 3300005577 Bacteria 843
49 Ga0068856_100035835 3300005614 Bacteria 4864
50 Ga0068852_100166128 3300005616 Bacteria 2065
51 Ga0068864_100043543 3300005618 Bacteria 3844
52 Ga0068864_101144051 3300005618 Bacteria 776
53 Ga0068863_100424343 3300005841 Bacteria 1303
54 Ga0068860_100000403 3300005843 Bacteria 56312
55 Ga0068860_100475503 3300005843 Bacteria 1245
56 Ga0068862_100107920 3300005844 Bacteria 2441
57 Ga0068862_101077624 3300005844 Bacteria 798
58 Ga0081455_10258969 3300005937 Bacteria 1268
59 Ga0081540_1009121 3300005983 Bacteria 6848
60 Ga0075365_10024674 3300006038 Bacteria 3797
61 Ga0075365_10715213 3300006038 Bacteria 707
62 Ga0075368_10000823 3300006042 Bacteria 9545
63 Ga0075363_100001883 3300006048 Bacteria 8282
64 Ga0075363_100007443 3300006048 Bacteria 5033
65 Ga0075363_100036002 3300006048 Bacteria 2594
66 Ga0075363_100655909 3300006048 Bacteria 632
67 Ga0075364_10005779 3300006051 Bacteria 7216
68 Ga0075364_10236439 3300006051 Bacteria 1241
69 Ga0075364_10337509 3300006051 Bacteria 1027
70 Ga0075367_10003259 3300006178 Bacteria 7679
71 Ga0075367_10027728 3300006178 Bacteria 3225
72 Ga0075370_10121062 3300006353 Bacteria 1523
73 Ga0068865_100084291 3300006881 Bacteria 2290
74 Ga0105245_10006006 3300009098 Bacteria 10674
75 Ga0105245_11062237 3300009098 Bacteria 855
76 Ga0105245_11081493 3300009098 Bacteria 848
77 Ga0105245_11318701 3300009098 Bacteria 771
78 Ga0105243_10248797 3300009148 Bacteria 1586
79 Ga0105243_10300666 3300009148 Bacteria 1454
80 Ga0105241_10533061 3300009174 Bacteria 1051
81 Ga0105241_11361150 3300009174 Bacteria 678
82 Ga0105248_10060205 3300009177 Bacteria 4263
83 Ga0105248_10420294 3300009177 Bacteria 1505
84 Ga0105237_10298146 3300009545 Bacteria 1615
85 Ga0105238_10112580 3300009551 Bacteria 2701
86 Ga0105249_10188669 3300009553 Bacteria 2011
87 Ga0105249_11401984 3300009553 Bacteria 771
88 Ga0105239_10070224 3300010375 Bacteria 3847
89 Ga0105239_11655154 3300010375 Bacteria 740
90 Ga0105246_10072124 3300011119 Bacteria 2434
91 Ga0105246_10512053 3300011119 Bacteria 1021
92 Ga0105246_10829213 3300011119 Bacteria 823
93 Ga0105246_10938337 3300011119 Bacteria 779
94 Ga0157369_10089317 3300013105 Bacteria 3290
95 Ga0157369_10637102 3300013105 Bacteria 1100
96 Ga0157369_10744514 3300013105 Bacteria 1008
97 Ga0157378_11965733 3300013297 Bacteria 634
98 Ga0163162_10034784 3300013306 Bacteria 5016
99 Ga0157372_10018723 3300013307 Bacteria 7450
100 Ga0157372_10545681 3300013307 Bacteria 1351
101 Ga0157372_10965647 3300013307 Bacteria 988
102 Ga0157375_10067498 3300013308 Bacteria 3574
103 Ga0157375_10449485 3300013308 Bacteria 1454
104 Ga0157375_11350068 3300013308 Bacteria 839
105 Ga0163163_11751848 3300014325 Bacteria 682
106 Ga0157380_10487955 3300014326 Bacteria 1193
107 Ga0157377_10854169 3300014745 Bacteria 676
108 Ga0157379_10030816 3300014968 Bacteria 4776
109 Ga0157376_11007721 3300014969 Bacteria 856
110 Ga0182006_1100609 3300015261 Bacteria 1026
111 Ga0163161_10567792 3300017792 Bacteria 932
112 Ga0207688_10012542 3300025901 Bacteria 4612
113 Ga0207647_10004906 3300025904 Bacteria 9871
114 Ga0207647_10081615 3300025904 Bacteria 1937
115 Ga0207643_10026523 3300025908 Bacteria 3208
116 Ga0207707_10128667 3300025912 Bacteria 2214
117 Ga0207671_10205695 3300025914 Bacteria 1538
118 Ga0207660_10092390 3300025917 Bacteria 2246
119 Ga0207657_10024438 3300025919 Bacteria 5592
120 Ga0207649_10113761 3300025920 Bacteria 1813
121 Ga0207649_10258886 3300025920 Bacteria 1257
122 Ga0207652_10005690 3300025921 Bacteria 10118
123 Ga0207652_11038694 3300025921 Bacteria 719
124 Ga0207694_10094484 3300025924 Bacteria 2363
125 Ga0207687_10067064 3300025927 Bacteria 2552
126 Ga0207687_10424433 3300025927 Bacteria 1098
127 Ga0207690_10042846 3300025932 Bacteria 2976
128 Ga0207704_10069124 3300025938 Bacteria 2230
129 Ga0207691_10450945 3300025940 Bacteria 1095
130 Ga0207711_10031214 3300025941 Bacteria 4497
131 Ga0207689_10450234 3300025942 Bacteria 1076
132 Ga0207689_10758804 3300025942 Bacteria 819
133 Ga0207661_10001855 3300025944 Bacteria 14463
134 Ga0207661_10046327 3300025944 Bacteria 3448
135 Ga0207661_10092648 3300025944 Bacteria 2519
136 Ga0207661_10139934 3300025944 Bacteria 2082
137 Ga0207679_10025198 3300025945 Bacteria 4088
138 Ga0207679_10138824 3300025945 Bacteria 1962
139 Ga0207667_10076727 3300025949 Bacteria 3467
140 Ga0207712_10126801 3300025961 Bacteria 1939
141 Ga0207712_10640632 3300025961 Bacteria 923
142 Ga0207668_10012419 3300025972 Bacteria 5214
143 Ga0207640_10630412 3300025981 Bacteria 911
144 Ga0207640_10719467 3300025981 Bacteria 858
145 Ga0207658_10082542 3300025986 Bacteria 2468
146 Ga0207658_10129415 3300025986 Bacteria 2026
147 Ga0207677_11167985 3300026023 Bacteria 704
148 Ga0207703_10914589 3300026035 Bacteria 840
149 Ga0207678_10008392 3300026067 Bacteria 9115
150 Ga0207678_10023248 3300026067 Bacteria 5421
151 Ga0207678_10579363 3300026067 Bacteria 983
152 Ga0207702_10162289 3300026078 Bacteria 2042
153 Ga0207641_10855959 3300026088 Bacteria 901
154 Ga0207676_10050969 3300026095 Bacteria 3230
155 Ga0207676_11087200 3300026095 Bacteria 790
156 Ga0207674_10015856 3300026116 Bacteria 8261
157 Ga0207674_10108006 3300026116 Bacteria 2759
158 Ga0207674_10237411 3300026116 Bacteria 1770
159 Ga0207683_10079883 3300026121 Bacteria 2900
160 Ga0207683_10171106 3300026121 Bacteria 1967
161 Ga0207698_10286169 3300026142 Bacteria 1527
162 Ga0209813_10035477 3300027866 Bacteria 1494
163 Ga0268266_10329866 3300028379 Bacteria 1430
164 Ga0268266_10478535 3300028379 Bacteria 1187
165 Ga0268265_10438386 3300028380 Bacteria 1217
166 Ga0268265_10623806 3300028380 Bacteria 1033
167 Ga0268264_10000355 3300028381 Bacteria 68889
168 Ga0268264_10084691 3300028381 Bacteria 2719
169 Ga0307509_10005722 3300031507 Bacteria 17126
170 Ga0307509_10140563 3300031507 Bacteria 2351
171 Ga0307416_101488899 3300032002 Bacteria 783
172 Ga0373935_0071519 3300035692 Bacteria 2238
173 Ga0395901_0534327 3300038443 Bacteria 1190
174 Ga0395901_1433398 3300038443 Bacteria 648
175 Ga0436363_0248120 3300039450 Bacteria 861
176 Ga0436363_0381218 3300039450 Bacteria 605
177 Ga0451787_076808 3300041441 Bacteria 737
178 Ga0439464_0012340 3300042439 Bacteria 2275
179 Ga0466972_0001200 3300044658 Bacteria 12460
180 Ga0466972_0031389 3300044658 Bacteria 2613
181 Ga0466972_0217358 3300044658 Bacteria 894
182 Ga0466965_0128854 3300044683 Bacteria 1311
183 Ga0466965_0164886 3300044683 Bacteria 1163
184 Ga0466966_0281286 3300044684 Bacteria 1001
185 Ga0466966_0599012 3300044684 Bacteria 663
186 Ga0466961_0019023 3300044693 Bacteria 4419
187 Ga0466961_0037178 3300044693 Bacteria 3124
188 Ga0466963_0044240 3300044694 Bacteria 2931
189 Ga0466963_0178740 3300044694 Bacteria 1481
190 Ga0466963_0378607 3300044694 Bacteria 997
191 Ga0466971_0004217 3300044719 Bacteria 6194
192 Ga0466968_0002711 3300044735 Bacteria 6537
193 Ga0466970_0003301 3300044765 Bacteria 7842
194 Ga0466970_0073611 3300044765 Bacteria 1838
195 Ga0466970_0108354 3300044765 Bacteria 1516
196 Ga0466970_0276250 3300044765 Bacteria 944
197 Ga0466970_0757789 3300044765 Bacteria 567
198 Ga0466957_0622224 3300044842 Bacteria 757
199 Ga0466960_0006277 3300044901 Bacteria 4760
200 Ga0466960_0221814 3300044901 Bacteria 1041
201 Ga0466960_0242701 3300044901 Bacteria 998
202 Ga0466958_0083968 3300045836 Bacteria 1963
203 Ga0466958_0128471 3300045836 Bacteria 1590
204 Ga0466958_0455136 3300045836 Bacteria 829
205 Ga0466967_0017403 3300045976 Bacteria 5705
206 Ga0466967_0056942 3300045976 Bacteria 3449
207 Ga0466967_0143889 3300045976 Bacteria 2223
208 Ga0466967_0148505 3300045976 Bacteria 2188
209 Ga0466967_0331795 3300045976 Bacteria 1469
210 Ga0466967_0576766 3300045976 Bacteria 1109
211 Ga0466967_1491258 3300045976 Bacteria 674
212 Ga0495592_0796376 3300046454 Bacteria 562
213 Ga0495629_0091549 3300046459 Bacteria 2122
214 Ga0495641_0058293 3300046461 Bacteria 1747
215 Ga0495582_0139239 3300046473 Bacteria 1374
216 Ga0495647_0166474 3300046681 Bacteria 953
217 Ga0495658_0367788 3300046683 Bacteria 915
218 Ga0495649_0542214 3300046694 Bacteria 576
219 Ga0495581_0039737 3300047315 Bacteria 2724
220 Ga0495676_0878028 3300047321 Bacteria 575
221 Ga0496102_0145093 3300048905 Bacteria 2227
222 Ga0496102_0376658 3300048905 Bacteria 1336
223 Ga0496102_0655005 3300048905 Bacteria 973
224 Ga0496103_0076240 3300048906 Bacteria 2104
225 Ga0496105_0129611 3300048908 Bacteria 2080
226 Ga0496106_0086992 3300048909 Bacteria 2408
227 Ga0496108_0319819 3300048911 Bacteria 1353
228 Ga0496109_0362511 3300048912 Bacteria 1369
229 Ga0496109_0976419 3300048912 Bacteria 785
230 Ga0496110_0018107 3300048913 Bacteria 5900
231 Ga0496111_0016756 3300048914 Bacteria 5055
232 Ga0496111_0132916 3300048914 Bacteria 1842
233 Ga0496113_0230692 3300048916 Bacteria 1476
234 Ga0496114_0044323 3300048917 Bacteria 3690
235 Ga0496115_0154874 3300048918 Bacteria 1893
236 Ga0501034_0081959 3300049571 Bacteria 3228
237 Ga0501034_0771418 3300049571 Bacteria 856
238 Ga0501036_0108398 3300049572 Bacteria 2348
239 Ga0501036_0621492 3300049572 Bacteria 895
240 Ga0501037_0020894 3300049573 Bacteria 4834
241 Ga0501038_0234663 3300049574 Bacteria 1458
242 Ga0501039_0128462 3300049575 Bacteria 1989
243 Ga0501039_0388182 3300049575 Bacteria 1097
244 Ga0501039_0620149 3300049575 Bacteria 847
245 Ga0501040_0125227 3300049576 Bacteria 1805
246 Ga0501041_0131703 3300049577 Bacteria 1558
247 Ga0501042_0132017 3300049578 Bacteria 1800
248 Ga0501047_0237114 3300049581 Bacteria 1676
249 Ga0501067_0006108 3300049583 Bacteria 6678
250 Ga0501067_0071751 3300049583 Bacteria 1918
251 Ga0501067_0309713 3300049583 Bacteria 879
252 Ga0501068_0028218 3300049584 Bacteria 3317
253 Ga0501068_0200242 3300049584 Bacteria 1266
254 Ga0501068_0447490 3300049584 Bacteria 835
255 Ga0501069_0010896 3300049585 Bacteria 4817
256 Ga0501070_0085254 3300049586 Bacteria 2615
257 Ga0501070_0203788 3300049586 Bacteria 1624
258 Ga0501071_0020603 3300049587 Bacteria 4584
259 Ga0501071_0119039 3300049587 Bacteria 1957
260 Ga0501071_0412094 3300049587 Bacteria 1032
261 Ga0501073_0139882 3300049589 Bacteria 1677
262 Ga0501074_0024840 3300049590 Bacteria 4352
263 Ga0501074_0027871 3300049590 Bacteria 4094
264 Ga0501075_1195448 3300049591 Bacteria 577
265 Ga0501077_0021168 3300049593 Bacteria 4115
266 Ga0501079_0880258 3300049741 Bacteria 705
267 Ga0501080_0185242 3300049742 Bacteria 1914
268 Ga0501080_0201676 3300049742 Bacteria 1826
269 Ga0501081_0454607 3300049743 Bacteria 952
270 Ga0501083_0027270 3300049744 Bacteria 3942
271 Ga0501035_0046157 3300049822 Bacteria 3918
272 Ga0501044_0001815 3300049823 Bacteria 24871
273 Ga0501045_0032185 3300049824 Bacteria 3799
274 Ga0501045_0140939 3300049824 Bacteria 1793
275 Ga0501045_0343449 3300049824 Bacteria 1111
276 Ga0501045_1070848 3300049824 Bacteria 590
277 nmdc:mga03n38_19188_c1 3300050490 Bacteria 2713
278 nmdc:mga03n38_39730_c1 3300050490 Bacteria 2041
279 nmdc:mga00v17_104404_c1 3300050491 Bacteria 1792
280 nmdc:mga00v17_23560_c1 3300050491 Bacteria 3561
281 nmdc:mga00v17_269723_c1 3300050491 Bacteria 1104
282 nmdc:mga0yw44_27016_c1 3300050492 Bacteria 3284
283 nmdc:mga06z11_1121_c1 3300050494 Bacteria 9748
284 nmdc:mga06z11_24362_c1 3300050494 Bacteria 2854
285 nmdc:mga04h51_42336_c1 3300050495 Bacteria 1493
286 nmdc:mga07m45_95927_c1 3300050496 Bacteria 1702
287 Ga0495595_0043622 3300053084 Bacteria 2058
288 Ga0500634_0191319 3300053161 Bacteria 909
289 Ga0500656_032433 3300053732 Bacteria 701
290 Ga0501084_0285340 3300054114 Bacteria 1394
291 Ga0501084_0293437 3300054114 Bacteria 1373
292 Ga0501084_0515165 3300054114 Bacteria 1011
293 Ga0587090_009746 3300059510 Bacteria 1317
294 Ga0501082_0152372 3300060353 Bacteria 2008
295 Ga0501082_0553857 3300060353 Bacteria 1006
296 Ga0466962_0044812 3300061719 Bacteria 2115
297 Ga0530510_0147195 3300061734 Bacteria 1738
298 Ga0530510_0382609 3300061734 Bacteria 1059
299 Ga0530510_1114349 3300061734 Bacteria 605
300 2644089162 2643221615 Bacteria 5487866
301 2644319007 2643221657 Bacteria 5490246
302 2873321383 2873314349 Bacteria 8512634
303 2917740627 2917736166 Bacteria 9690793
304 8003319800 8003314358 Bacteria 10575343
305 8055071962 8055066027 Bacteria 9479577
306 8055173394 8055172936 Bacteria 9305943
307 Ga0496111_0274821
308 JGI24737J22298_10018205
309 JGI24735J21928_10020274
310 JGI24735J21928_10172113
311 JGI24738J21930_10083104
312 JGI25404J52841_10128787
313 Ga0070658_10188712
314 Ga0070658_10549002
315 Ga0070683_100001135
316 Ga0070683_100001834
317 Ga0070683_100064845
318 Ga0068869_100176099
319 Ga0070680_100104558
320 Ga0070682_100009729
321 Ga0070682_100251669
322 Ga0070682_100274084
323 Ga0068868_100332054
324 Ga0068868_100799144
325 Ga0070660_100008616
326 Ga0070691_10214109
327 Ga0070661_100231905
328 Ga0070692_10036809
329 Ga0070668_100002262
330 Ga0070668_100220555
331 Ga0070668_100451942
332 Ga0070659_100160286
333 Ga0070659_100371051
334 Ga0070667_100064613
335 Ga0070667_100331498
336 Ga0070714_100136610
337 Ga0070694_100579839
338 Ga0070663_100003080
339 Ga0070663_100165998
340 Ga0070678_100062235
341 Ga0070678_100954645
342 Ga0070681_10069390
343 Ga0070685_10045587
344 Ga0070679_100063817
345 Ga0070679_100171828
346 Ga0070684_100002960
347 Ga0070684_100010058
348 Ga0070672_100401484
349 Ga0070695_100549850
350 Ga0070696_100361964
351 Ga0068855_100337291
352 Ga0070664_100072581
353 Ga0070664_100125063
354 Ga0068857_100912301
355 Ga0068856_100035835
356 Ga0068852_100166128
357 Ga0068864_100043543
358 Ga0068864_101144051
359 Ga0068863_100424343
360 Ga0068860_100000403
361 Ga0068860_100475503
362 Ga0068862_100107920
363 Ga0068862_101077624
364 Ga0081455_10258969
365 Ga0081540_1009121
366 Ga0075365_10024674
367 Ga0075365_10715213
368 Ga0075368_10000823
369 Ga0075363_100001883
370 Ga0075363_100007443
371 Ga0075363_100036002
372 Ga0075363_100655909
373 Ga0075364_10005779
374 Ga0075364_10236439
375 Ga0075364_10337509
376 Ga0075367_10003259
377 Ga0075367_10027728
378 Ga0075370_10121062
379 Ga0068865_100084291
380 Ga0105245_10006006
381 Ga0105245_11062237
382 Ga0105245_11081493
383 Ga0105245_11318701
384 Ga0105243_10248797
385 Ga0105243_10300666
386 Ga0105241_10533061
387 Ga0105241_11361150
388 Ga0105248_10060205
389 Ga0105248_10420294
390 Ga0105237_10298146
391 Ga0105238_10112580
392 Ga0105249_10188669
393 Ga0105249_11401984
394 Ga0105239_10070224
395 Ga0105239_11655154
396 Ga0105246_10072124
397 Ga0105246_10512053
398 Ga0105246_10829213
399 Ga0105246_10938337
400 Ga0157369_10089317
401 Ga0157369_10637102
402 Ga0157369_10744514
403 Ga0157378_11965733
404 Ga0163162_10034784
405 Ga0157372_10018723
406 Ga0157372_10545681
407 Ga0157372_10965647
408 Ga0157375_10067498
409 Ga0157375_10449485
410 Ga0157375_11350068
411 Ga0163163_11751848
412 Ga0157380_10487955
413 Ga0157377_10854169
414 Ga0157379_10030816
415 Ga0157376_11007721
416 Ga0182006_1100609
417 Ga0163161_10567792
418 Ga0207688_10012542
419 Ga0207647_10004906
420 Ga0207647_10081615
421 Ga0207643_10026523
422 Ga0207707_10128667
423 Ga0207671_10205695
424 Ga0207660_10092390
425 Ga0207657_10024438
426 Ga0207649_10113761
427 Ga0207649_10258886
428 Ga0207652_10005690
429 Ga0207652_11038694
430 Ga0207694_10094484
431 Ga0207687_10067064
432 Ga0207687_10424433
433 Ga0207690_10042846
434 Ga0207704_10069124
435 Ga0207691_10450945
436 Ga0207711_10031214
437 Ga0207689_10450234
438 Ga0207689_10758804
439 Ga0207661_10001855
440 Ga0207661_10046327
441 Ga0207661_10092648
442 Ga0207661_10139934
443 Ga0207679_10025198
444 Ga0207679_10138824
445 Ga0207667_10076727
446 Ga0207712_10126801
447 Ga0207712_10640632
448 Ga0207668_10012419
449 Ga0207640_10630412
450 Ga0207640_10719467
451 Ga0207658_10082542
452 Ga0207658_10129415
453 Ga0207677_11167985
454 Ga0207703_10914589
455 Ga0207678_10008392
456 Ga0207678_10023248
457 Ga0207678_10579363
458 Ga0207702_10162289
459 Ga0207641_10855959
460 Ga0207676_10050969
461 Ga0207676_11087200
462 Ga0207674_10015856
463 Ga0207674_10108006
464 Ga0207674_10237411
465 Ga0207683_10079883
466 Ga0207683_10171106
467 Ga0207698_10286169
468 Ga0209813_10035477
469 Ga0268266_10329866
470 Ga0268266_10478535
471 Ga0268265_10438386
472 Ga0268265_10623806
473 Ga0268264_10000355
474 Ga0268264_10084691
475 Ga0307509_10005722
476 Ga0307509_10140563
477 Ga0307416_101488899
478 Ga0373935_0071519
479 Ga0395901_0534327
480 Ga0395901_1433398
481 Ga0436363_0248120
482 Ga0436363_0381218
483 Ga0451787_076808
484 Ga0439464_0012340
485 Ga0466972_0001200
486 Ga0466972_0031389
487 Ga0466972_0217358
488 Ga0466965_0128854
489 Ga0466965_0164886
490 Ga0466966_0281286
491 Ga0466966_0599012
492 Ga0466961_0019023
493 Ga0466961_0037178
494 Ga0466963_0044240
495 Ga0466963_0178740
496 Ga0466963_0378607
497 Ga0466971_0004217
498 Ga0466968_0002711
499 Ga0466970_0003301
500 Ga0466970_0073611
501 Ga0466970_0108354
502 Ga0466970_0276250
503 Ga0466970_0757789
504 Ga0466957_0622224
505 Ga0466960_0006277
506 Ga0466960_0221814
507 Ga0466960_0242701
508 Ga0466958_0083968
509 Ga0466958_0128471
510 Ga0466958_0455136
511 Ga0466967_0017403
512 Ga0466967_0056942
513 Ga0466967_0143889
514 Ga0466967_0148505
515 Ga0466967_0331795
516 Ga0466967_0576766
517 Ga0466967_1491258
518 Ga0495592_0796376
519 Ga0495629_0091549
520 Ga0495641_0058293
521 Ga0495582_0139239
522 Ga0495647_0166474
523 Ga0495658_0367788
524 Ga0495649_0542214
525 Ga0495581_0039737
526 Ga0495676_0878028
527 Ga0496102_0145093
528 Ga0496102_0376658
529 Ga0496102_0655005
530 Ga0496103_0076240
531 Ga0496105_0129611
532 Ga0496106_0086992
533 Ga0496108_0319819
534 Ga0496109_0362511
535 Ga0496109_0976419
536 Ga0496110_0018107
537 Ga0496111_0016756
538 Ga0496111_0132916
539 Ga0496113_0230692
540 Ga0496114_0044323
541 Ga0496115_0154874
542 Ga0501034_0081959
543 Ga0501034_0771418
544 Ga0501036_0108398
545 Ga0501036_0621492
546 Ga0501037_0020894
547 Ga0501038_0234663
548 Ga0501039_0128462
549 Ga0501039_0388182
550 Ga0501039_0620149
551 Ga0501040_0125227
552 Ga0501041_0131703
553 Ga0501042_0132017
554 Ga0501047_0237114
555 Ga0501067_0006108
556 Ga0501067_0071751
557 Ga0501067_0309713
558 Ga0501068_0028218
559 Ga0501068_0200242
560 Ga0501068_0447490
561 Ga0501069_0010896
562 Ga0501070_0085254
563 Ga0501070_0203788
564 Ga0501071_0020603
565 Ga0501071_0119039
566 Ga0501071_0412094
567 Ga0501073_0139882
568 Ga0501074_0024840
569 Ga0501074_0027871
570 Ga0501075_1195448
571 Ga0501077_0021168
572 Ga0501079_0880258
573 Ga0501080_0185242
574 Ga0501080_0201676
575 Ga0501081_0454607
576 Ga0501083_0027270
577 Ga0501035_0046157
578 Ga0501044_0001815
579 Ga0501045_0032185
580 Ga0501045_0140939
581 Ga0501045_0343449
582 Ga0501045_1070848
583 nmdc:mga03n38_19188_c1
584 nmdc:mga03n38_39730_c1
585 nmdc:mga00v17_104404_c1
586 nmdc:mga00v17_23560_c1
587 nmdc:mga00v17_269723_c1
588 nmdc:mga0yw44_27016_c1
589 nmdc:mga06z11_1121_c1
590 nmdc:mga06z11_24362_c1
591 nmdc:mga04h51_42336_c1
592 nmdc:mga07m45_95927_c1
593 Ga0495595_0043622
594 Ga0500634_0191319
595 Ga0500656_032433
596 Ga0501084_0285340
597 Ga0501084_0293437
598 Ga0501084_0515165
599 Ga0587090_009746
600 Ga0501082_0152372
601 Ga0501082_0553857
602 Ga0466962_0044812
603 Ga0530510_0147195
604 Ga0530510_0382609
605 Ga0530510_1114349
606 2644089162
607 2644319007
608 2873321383
609 2917740627
610 8003319800
611 8055071962
612 8055173394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

48

165

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8513 29 155
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8287 29 155
4naz-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with zn and sulfate at 1.15 angstrom resolution 0.8278 29 155
4nb0-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.824 29 155
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.816 30 154
ID Description Score Start End Superfamily
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.834 30 89 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8278 29 155 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8131 36 153 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8108 32 154 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8044 32 154 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A6J7KC72-F1-model_v4 Unannotated protein 0.9345 39 163
AF-A0A2W6D648-F1-model_v4 VOC family protein 0.9208 20 164
AF-A0A6J7KC72-F1-model_v4 Unannotated protein 0.9202 39 163
AF-A0A2W6D648-F1-model_v4 VOC family protein 0.9148 20 164
AF-A0A6J6RHY9-F1-model_v4 Unannotated protein 0.9121 10 163 GO:0016491

Map