F398820

General Info

Members Datasets Scaffolds Average Seq Length
306 194 612 166

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0302493|Ga0495664_0302493_64_621
Length 185
Sequence MALELKDLSPQAIPRALAKAEHYRLLNEPLGAESICLDILRVDPENQKAIVTLLLALTDQFGHGYKMSEVQPRELIARLADPYERAYYAGIVAERQADAILDQGVQNSSFRAHDLLSEAMRYYEEAEKIRPAGNDDALLRWNTCARMMNSKGVHPRAYEPGEEFLRRGRDVRHGRMMSGVLPLPN

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
153 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.21
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 13.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0302493 3300046477 Unclassified 965
2 Ga0065712_10375436 3300005290 Unclassified 758
3 Ga0065715_10414046 3300005293 Bacteria 866
4 Ga0070658_10016298 3300005327 Bacteria 5946
5 Ga0070658_10588722 3300005327 Bacteria 964
6 Ga0070676_10029602 3300005328 Bacteria 3115
7 Ga0070676_10113166 3300005328 Bacteria 1693
8 Ga0070676_10544975 3300005328 Bacteria 830
9 Ga0070683_100023491 3300005329 Bacteria 5515
10 Ga0070690_100105108 3300005330 Bacteria 1876
11 Ga0070670_100038171 3300005331 Bacteria 4130
12 Ga0070670_100711151 3300005331 Bacteria 904
13 Ga0070677_10213435 3300005333 Unclassified 938
14 Ga0068869_100173103 3300005334 Bacteria 1688
15 Ga0070666_10479011 3300005335 Unclassified 901
16 Ga0070680_100732629 3300005336 Bacteria 851
17 Ga0070682_100156209 3300005337 Bacteria 1571
18 Ga0068868_100882191 3300005338 Unclassified 812
19 Ga0068868_101496820 3300005338 Bacteria 632
20 Ga0070660_100317806 3300005339 Bacteria 1279
21 Ga0070689_101048914 3300005340 Bacteria 727
22 Ga0070691_10013984 3300005341 Bacteria 3681
23 Ga0070687_100036778 3300005343 Bacteria 2443
24 Ga0070692_10209292 3300005345 Bacteria 1147
25 Ga0070669_100001994 3300005353 Bacteria 14769
26 Ga0070669_100112800 3300005353 Bacteria 2065
27 Ga0070669_100287640 3300005353 Bacteria 1318
28 Ga0070675_100011954 3300005354 Bacteria 6803
29 Ga0070675_100229982 3300005354 Bacteria 1617
30 Ga0070671_100077291 3300005355 Bacteria 2782
31 Ga0070671_100101307 3300005355 Bacteria 2416
32 Ga0070674_100022145 3300005356 Bacteria 4094
33 Ga0070674_100050430 3300005356 Bacteria 2865
34 Ga0070673_100007150 3300005364 Bacteria 7333
35 Ga0070673_100355224 3300005364 Bacteria 1301
36 Ga0070688_100084541 3300005365 Bacteria 2061
37 Ga0070688_100265860 3300005365 Bacteria 1227
38 Ga0070688_100626701 3300005365 Bacteria 826
39 Ga0070667_100114089 3300005367 Bacteria 2346
40 Ga0070667_100382433 3300005367 Bacteria 1279
41 Ga0070711_100105874 3300005439 Bacteria 2055
42 Ga0070708_100039780 3300005445 Bacteria 4116
43 Ga0070678_100270549 3300005456 Bacteria 1433
44 Ga0070662_100293340 3300005457 Bacteria 1319
45 Ga0070662_100299091 3300005457 Bacteria 1307
46 Ga0070662_100967825 3300005457 Bacteria 728
47 Ga0070681_10734929 3300005458 Bacteria 903
48 Ga0070685_10122097 3300005466 Bacteria 1619
49 Ga0070706_100457129 3300005467 Bacteria 1188
50 Ga0070698_100006078 3300005471 Bacteria 13151
51 Ga0070699_100003942 3300005518 Bacteria 13111
52 Ga0070699_100313804 3300005518 Bacteria 1408
53 Ga0070679_100696305 3300005530 Bacteria 959
54 Ga0070684_100015525 3300005535 Bacteria 6205
55 Ga0070684_100189713 3300005535 Bacteria 1870
56 Ga0070684_100890449 3300005535 Bacteria 834
57 Ga0070697_101243738 3300005536 Bacteria 664
58 Ga0070672_100105188 3300005543 Bacteria 2294
59 Ga0070672_100147793 3300005543 Bacteria 1943
60 Ga0070672_100374724 3300005543 Bacteria 1217
61 Ga0070693_100618699 3300005547 Unclassified 784
62 Ga0070665_100377180 3300005548 Bacteria 1425
63 Ga0070665_100913995 3300005548 Unclassified 890
64 Ga0070664_100027676 3300005564 Bacteria 4712
65 Ga0070664_100040360 3300005564 Bacteria 3934
66 Ga0070664_100047916 3300005564 Bacteria 3612
67 Ga0070664_100239767 3300005564 Bacteria 1627
68 Ga0070664_101229977 3300005564 Unclassified 707
69 Ga0068857_100013257 3300005577 Bacteria 7179
70 Ga0068857_100070163 3300005577 Bacteria 3120
71 Ga0068854_100666382 3300005578 Bacteria 895
72 Ga0068852_100047269 3300005616 Bacteria 3671
73 Ga0068852_100047358 3300005616 Bacteria 3668
74 Ga0068852_100458011 3300005616 Bacteria 1264
75 Ga0068859_100007336 3300005617 Bacteria 11183
76 Ga0068859_100258077 3300005617 Bacteria 1834
77 Ga0068864_101003319 3300005618 Bacteria 828
78 Ga0068864_102138218 3300005618 Unclassified 566
79 Ga0068861_100755951 3300005719 Unclassified 908
80 Ga0068870_10015715 3300005840 Bacteria 3599
81 Ga0068870_10160675 3300005840 Bacteria 1332
82 Ga0068863_100126981 3300005841 Bacteria 2434
83 Ga0068863_100483292 3300005841 Bacteria 1218
84 Ga0068860_100189140 3300005843 Bacteria 1992
85 Ga0068860_100249947 3300005843 Bacteria 1726
86 Ga0068860_101128380 3300005843 Unclassified 804
87 Ga0068862_100192904 3300005844 Bacteria 1834
88 Ga0068862_100640500 3300005844 Unclassified 1024
89 Ga0097621_100016638 3300006237 Bacteria 5565
90 Ga0097621_100296205 3300006237 Bacteria 1428
91 Ga0068871_100111410 3300006358 Bacteria 2302
92 Ga0075428_100032357 3300006844 Bacteria 5776
93 Ga0075428_100975299 3300006844 Bacteria 898
94 Ga0075430_100005563 3300006846 Bacteria 10645
95 Ga0075430_100013564 3300006846 Bacteria 6947
96 Ga0075431_100007584 3300006847 Bacteria 10803
97 Ga0075431_100131951 3300006847 Bacteria 2576
98 Ga0075433_10467796 3300006852 Bacteria 1111
99 Ga0075433_11546563 3300006852 Unclassified 573
100 Ga0075434_100007366 3300006871 Bacteria 10184
101 Ga0075434_100825503 3300006871 Bacteria 943
102 Ga0075429_100001608 3300006880 Bacteria 18640
103 Ga0075429_100006013 3300006880 Bacteria 10493
104 Ga0068865_100013643 3300006881 Bacteria 5144
105 Ga0068865_101277609 3300006881 Unclassified 652
106 Ga0075436_100045558 3300006914 Bacteria 3025
107 Ga0097620_100007336 3300006931 Bacteria 11183
108 Ga0097620_100258088 3300006931 Bacteria 1834
109 Ga0111539_11714194 3300009094 Bacteria 729
110 Ga0105245_10209361 3300009098 Bacteria 1876
111 Ga0105247_10878709 3300009101 Unclassified 690
112 Ga0114129_10005239 3300009147 Bacteria 18269
113 Ga0114129_10151687 3300009147 Bacteria 3171
114 Ga0114129_10176770 3300009147 Bacteria 2907
115 Ga0105243_10068768 3300009148 Bacteria 2855
116 Ga0105243_10131532 3300009148 Bacteria 2123
117 Ga0105242_10297668 3300009176 Bacteria 1471
118 Ga0105248_10034399 3300009177 Bacteria 5666
119 Ga0105248_10803167 3300009177 Bacteria 1062
120 Ga0105237_10346085 3300009545 Bacteria 1491
121 Ga0105249_11188713 3300009553 Bacteria 833
122 Ga0105239_10266517 3300010375 Bacteria 1926
123 Ga0157373_10751896 3300013100 Bacteria 717
124 Ga0157373_11226754 3300013100 Bacteria 566
125 Ga0157369_10122394 3300013105 Bacteria 2760
126 Ga0157369_10951115 3300013105 Unclassified 880
127 Ga0157374_10466438 3300013296 Bacteria 1265
128 Ga0157372_11070374 3300013307 Unclassified 933
129 Ga0157372_11557002 3300013307 Unclassified 761
130 Ga0157375_10012463 3300013308 Bacteria 7547
131 Ga0157375_10101019 3300013308 Bacteria 2966
132 Ga0157375_10103975 3300013308 Bacteria 2928
133 Ga0163163_10116782 3300014325 Bacteria 2700
134 Ga0157380_10170545 3300014326 Bacteria 1901
135 Ga0157380_11915156 3300014326 Unclassified 654
136 Ga0157376_10394909 3300014969 Bacteria 1336
137 Ga0157376_10689982 3300014969 Bacteria 1025
138 Ga0207682_10148612 3300025893 Bacteria 1055
139 Ga0207688_10117025 3300025901 Bacteria 1552
140 Ga0207688_10414533 3300025901 Bacteria 836
141 Ga0207645_10020964 3300025907 Bacteria 4269
142 Ga0207645_10038127 3300025907 Bacteria 3083
143 Ga0207645_10413116 3300025907 Bacteria 908
144 Ga0207643_10034883 3300025908 Bacteria 2820
145 Ga0207705_10224896 3300025909 Bacteria 1426
146 Ga0207705_10230659 3300025909 Unclassified 1408
147 Ga0207684_10384701 3300025910 Bacteria 1207
148 Ga0207663_10181733 3300025916 Bacteria 1503
149 Ga0207657_10071714 3300025919 Bacteria 2932
150 Ga0207649_10114987 3300025920 Bacteria 1804
151 Ga0207652_10569706 3300025921 Bacteria 1017
152 Ga0207646_10863775 3300025922 Bacteria 804
153 Ga0207681_10175706 3300025923 Bacteria 1627
154 Ga0207681_10221412 3300025923 Unclassified 1464
155 Ga0207681_10338334 3300025923 Bacteria 1201
156 Ga0207650_10047623 3300025925 Bacteria 3159
157 Ga0207650_10194613 3300025925 Bacteria 1622
158 Ga0207650_10213428 3300025925 Bacteria 1550
159 Ga0207650_10524040 3300025925 Bacteria 992
160 Ga0207659_10075650 3300025926 Bacteria 2471
161 Ga0207687_10578644 3300025927 Bacteria 944
162 Ga0207644_10129501 3300025931 Bacteria 1930
163 Ga0207690_10278308 3300025932 Bacteria 1302
164 Ga0207690_11436301 3300025932 Bacteria 577
165 Ga0207706_10058661 3300025933 Bacteria 3390
166 Ga0207706_10099685 3300025933 Bacteria 2556
167 Ga0207706_10331177 3300025933 Bacteria 1325
168 Ga0207706_10530218 3300025933 Bacteria 1015
169 Ga0207706_11012744 3300025933 Bacteria 697
170 Ga0207709_10078223 3300025935 Bacteria 2123
171 Ga0207670_10626314 3300025936 Bacteria 885
172 Ga0207669_10021066 3300025937 Bacteria 3433
173 Ga0207669_10114255 3300025937 Bacteria 1817
174 Ga0207691_10034295 3300025940 Bacteria 4721
175 Ga0207691_10081773 3300025940 Bacteria 2902
176 Ga0207691_10149835 3300025940 Bacteria 2051
177 Ga0207691_10500645 3300025940 Bacteria 1032
178 Ga0207711_10392465 3300025941 Bacteria 1289
179 Ga0207661_10019601 3300025944 Bacteria 5047
180 Ga0207661_10172089 3300025944 Bacteria 1885
181 Ga0207661_10587408 3300025944 Bacteria 1022
182 Ga0207661_11236017 3300025944 Unclassified 687
183 Ga0207679_10028518 3300025945 Bacteria 3875
184 Ga0207679_10167518 3300025945 Bacteria 1805
185 Ga0207679_10205834 3300025945 Bacteria 1647
186 Ga0207679_10218836 3300025945 Bacteria 1601
187 Ga0207679_10462301 3300025945 Bacteria 1127
188 Ga0207651_10033885 3300025960 Bacteria 3299
189 Ga0207651_10670733 3300025960 Bacteria 911
190 Ga0207712_11495829 3300025961 Unclassified 605
191 Ga0207668_10224979 3300025972 Bacteria 1509
192 Ga0207640_10818177 3300025981 Unclassified 808
193 Ga0207658_10225597 3300025986 Bacteria 1578
194 Ga0207658_10385856 3300025986 Bacteria 1228
195 Ga0207658_10414131 3300025986 Bacteria 1187
196 Ga0207677_10681440 3300026023 Bacteria 910
197 Ga0207703_10336397 3300026035 Bacteria 1386
198 Ga0207639_10579185 3300026041 Bacteria 1033
199 Ga0207678_11032114 3300026067 Unclassified 728
200 Ga0207708_11522505 3300026075 Unclassified 588
201 Ga0207641_10068437 3300026088 Bacteria 3045
202 Ga0207641_10297275 3300026088 Bacteria 1524
203 Ga0207676_10108322 3300026095 Bacteria 2319
204 Ga0207676_11484074 3300026095 Unclassified 675
205 Ga0207674_10010022 3300026116 Bacteria 10781
206 Ga0207675_100495577 3300026118 Bacteria 1215
207 Ga0207675_101539938 3300026118 Bacteria 685
208 Ga0207683_10008245 3300026121 Bacteria 8910
209 Ga0207698_10041639 3300026142 Bacteria 3425
210 Ga0207698_10158024 3300026142 Bacteria 1978
211 Ga0207698_10578115 3300026142 Bacteria 1105
212 Ga0207698_10932211 3300026142 Unclassified 877
213 Ga0268266_10012962 3300028379 Bacteria 7189
214 Ga0268266_10766504 3300028379 Bacteria 931
215 Ga0268265_10657456 3300028380 Bacteria 1008
216 Ga0268264_10146226 3300028381 Bacteria 2114
217 Ga0307408_101061650 3300031548 Bacteria 749
218 Ga0307413_10253720 3300031824 Bacteria 1306
219 Ga0307413_10544590 3300031824 Unclassified 940
220 Ga0307410_10504360 3300031852 Bacteria 996
221 Ga0307406_10605248 3300031901 Bacteria 904
222 Ga0307407_11328606 3300031903 Unclassified 565
223 Ga0307409_100254788 3300031995 Bacteria 1607
224 Ga0307409_100946675 3300031995 Bacteria 877
225 Ga0373936_0233738 3300035113 Bacteria 818
226 Ga0373939_0019709 3300035114 Bacteria 1823
227 Ga0373947_0130840 3300035725 Bacteria 1602
228 Ga0395905_0888940 3300037471 Bacteria 794
229 Ga0395901_0398730 3300038443 Bacteria 1414
230 Ga0436365_0761269 3300039437 Bacteria 1546
231 Ga0436365_0974462 3300039437 Bacteria 650
232 Ga0436363_0811859 3300039450 Bacteria 1218
233 Ga0453683_0008065 3300044673 Bacteria 7090
234 Ga0466957_0000315 3300044842 Bacteria 23497
235 Ga0451576_0024710 3300045051 Bacteria 6486
236 Ga0451576_0071594 3300045051 Bacteria 3609
237 Ga0466958_0253103 3300045836 Unclassified 1127
238 Ga0466967_0271147 3300045976 Bacteria 1626
239 Ga0495651_0021228 3300046462 Bacteria 5046
240 Ga0495618_0457448 3300046514 Bacteria 774
241 Ga0495628_0205191 3300046516 Bacteria 1484
242 Ga0495630_0037175 3300046517 Bacteria 3640
243 Ga0495587_0167200 3300046536 Bacteria 1250
244 Ga0495621_0022119 3300046539 Bacteria 2104
245 Ga0495667_0460237 3300046559 Bacteria 799
246 Ga0495667_0533818 3300046559 Unclassified 734
247 Ga0495599_0261614 3300046678 Bacteria 1051
248 Ga0495623_0577548 3300046679 Unclassified 586
249 Ga0495623_0614421 3300046679 Unclassified 563
250 Ga0495646_0114093 3300046680 Bacteria 1536
251 Ga0495613_0018039 3300046689 Bacteria 5260
252 Ga0495613_0397826 3300046689 Bacteria 940
253 Ga0495624_0009561 3300046690 Bacteria 6710
254 Ga0495600_0111362 3300046809 Bacteria 1782
255 Ga0495581_0127159 3300047315 Bacteria 1484
256 Ga0495581_0162172 3300047315 Bacteria 1307
257 Ga0495674_0010185 3300047319 Bacteria 8906
258 Ga0495676_0107735 3300047321 Bacteria 2051
259 Ga0495675_0083220 3300047444 Bacteria 2014
260 Ga0496100_0130248 3300048903 Bacteria 1771
261 Ga0496101_0620723 3300048904 Unclassified 855
262 Ga0496104_0337317 3300048907 Bacteria 1420
263 Ga0496104_0432310 3300048907 Bacteria 1228
264 Ga0496105_0430276 3300048908 Unclassified 1044
265 Ga0496106_0317723 3300048909 Bacteria 1250
266 Ga0496107_0289144 3300048910 Bacteria 1220
267 Ga0496108_0173865 3300048911 Bacteria 1864
268 Ga0496109_0377864 3300048912 Bacteria 1338
269 Ga0496109_1357911 3300048912 Bacteria 646
270 Ga0496110_0307938 3300048913 Unclassified 1443
271 Ga0496111_0671795 3300048914 Unclassified 755
272 Ga0496112_0052309 3300048915 Bacteria 4008
273 Ga0496112_0380211 3300048915 Bacteria 1353
274 Ga0496112_1056960 3300048915 Unclassified 731
275 Ga0496113_0041902 3300048916 Bacteria 3381
276 Ga0496115_0263701 3300048918 Bacteria 1416
277 Ga0496115_0320808 3300048918 Bacteria 1267
278 Ga0496115_0485547 3300048918 Bacteria 994
279 Ga0501032_0595269 3300049569 Bacteria 704
280 Ga0501042_0076206 3300049578 Bacteria 2401
281 Ga0501076_0371535 3300049592 Bacteria 1175
282 Ga0501076_0611552 3300049592 Bacteria 899
283 Ga0501035_0221986 3300049822 Bacteria 1613
284 Ga0501044_0811843 3300049823 Bacteria 814
285 nmdc:mga05p37_10914_c1 3300050507 Bacteria 10784
286 nmdc:mga05p37_176364_c1 3300050507 Unclassified 2603
287 nmdc:mga09592_214246_c1 3300050508 Bacteria 1669
288 nmdc:mga09592_2689_c1 3300050508 Bacteria 14379
289 nmdc:mga09592_3555_c1 3300050508 Bacteria 12585
290 nmdc:mga0qj67_17980_c1 3300050509 Bacteria 5383
291 nmdc:mga0qj67_571_c1 3300050509 Bacteria 25137
292 nmdc:mga06r32_112524_c1 3300050510 Bacteria 2679
293 nmdc:mga06r32_2788_c1 3300050510 Bacteria 15647
294 nmdc:mga06r32_99591_c1 3300050510 Bacteria 2851
295 nmdc:mga0n895_13686_c1 3300050512 Bacteria 7334
296 nmdc:mga08x19_4396_c1 3300050514 Bacteria 3245
297 nmdc:mga0a205_10899_c1 3300050515 Bacteria 8363
298 Ga0495601_0002922 3300053077 Bacteria 9726
299 Ga0501084_0689371 3300054114 Bacteria 862
300 Ga0590071_000447 3300059421 Bacteria 11964
301 Ga0590074_015704 3300059423 Bacteria 1286
302 Ga0590075_001008 3300059424 Bacteria 7278
303 Ga0590077_000168 3300059426 Bacteria 18409
304 Ga0501082_0795305 3300060353 Bacteria 827
305 Ga0530510_0421572 3300061734 Bacteria 1007
306 2673164130 2671180531 Bacteria 9045424
307 Ga0495664_0302493
308 Ga0065712_10375436
309 Ga0065715_10414046
310 Ga0070658_10016298
311 Ga0070658_10588722
312 Ga0070676_10029602
313 Ga0070676_10113166
314 Ga0070676_10544975
315 Ga0070683_100023491
316 Ga0070690_100105108
317 Ga0070670_100038171
318 Ga0070670_100711151
319 Ga0070677_10213435
320 Ga0068869_100173103
321 Ga0070666_10479011
322 Ga0070680_100732629
323 Ga0070682_100156209
324 Ga0068868_100882191
325 Ga0068868_101496820
326 Ga0070660_100317806
327 Ga0070689_101048914
328 Ga0070691_10013984
329 Ga0070687_100036778
330 Ga0070692_10209292
331 Ga0070669_100001994
332 Ga0070669_100112800
333 Ga0070669_100287640
334 Ga0070675_100011954
335 Ga0070675_100229982
336 Ga0070671_100077291
337 Ga0070671_100101307
338 Ga0070674_100022145
339 Ga0070674_100050430
340 Ga0070673_100007150
341 Ga0070673_100355224
342 Ga0070688_100084541
343 Ga0070688_100265860
344 Ga0070688_100626701
345 Ga0070667_100114089
346 Ga0070667_100382433
347 Ga0070711_100105874
348 Ga0070708_100039780
349 Ga0070678_100270549
350 Ga0070662_100293340
351 Ga0070662_100299091
352 Ga0070662_100967825
353 Ga0070681_10734929
354 Ga0070685_10122097
355 Ga0070706_100457129
356 Ga0070698_100006078
357 Ga0070699_100003942
358 Ga0070699_100313804
359 Ga0070679_100696305
360 Ga0070684_100015525
361 Ga0070684_100189713
362 Ga0070684_100890449
363 Ga0070697_101243738
364 Ga0070672_100105188
365 Ga0070672_100147793
366 Ga0070672_100374724
367 Ga0070693_100618699
368 Ga0070665_100377180
369 Ga0070665_100913995
370 Ga0070664_100027676
371 Ga0070664_100040360
372 Ga0070664_100047916
373 Ga0070664_100239767
374 Ga0070664_101229977
375 Ga0068857_100013257
376 Ga0068857_100070163
377 Ga0068854_100666382
378 Ga0068852_100047269
379 Ga0068852_100047358
380 Ga0068852_100458011
381 Ga0068859_100007336
382 Ga0068859_100258077
383 Ga0068864_101003319
384 Ga0068864_102138218
385 Ga0068861_100755951
386 Ga0068870_10015715
387 Ga0068870_10160675
388 Ga0068863_100126981
389 Ga0068863_100483292
390 Ga0068860_100189140
391 Ga0068860_100249947
392 Ga0068860_101128380
393 Ga0068862_100192904
394 Ga0068862_100640500
395 Ga0097621_100016638
396 Ga0097621_100296205
397 Ga0068871_100111410
398 Ga0075428_100032357
399 Ga0075428_100975299
400 Ga0075430_100005563
401 Ga0075430_100013564
402 Ga0075431_100007584
403 Ga0075431_100131951
404 Ga0075433_10467796
405 Ga0075433_11546563
406 Ga0075434_100007366
407 Ga0075434_100825503
408 Ga0075429_100001608
409 Ga0075429_100006013
410 Ga0068865_100013643
411 Ga0068865_101277609
412 Ga0075436_100045558
413 Ga0097620_100007336
414 Ga0097620_100258088
415 Ga0111539_11714194
416 Ga0105245_10209361
417 Ga0105247_10878709
418 Ga0114129_10005239
419 Ga0114129_10151687
420 Ga0114129_10176770
421 Ga0105243_10068768
422 Ga0105243_10131532
423 Ga0105242_10297668
424 Ga0105248_10034399
425 Ga0105248_10803167
426 Ga0105237_10346085
427 Ga0105249_11188713
428 Ga0105239_10266517
429 Ga0157373_10751896
430 Ga0157373_11226754
431 Ga0157369_10122394
432 Ga0157369_10951115
433 Ga0157374_10466438
434 Ga0157372_11070374
435 Ga0157372_11557002
436 Ga0157375_10012463
437 Ga0157375_10101019
438 Ga0157375_10103975
439 Ga0163163_10116782
440 Ga0157380_10170545
441 Ga0157380_11915156
442 Ga0157376_10394909
443 Ga0157376_10689982
444 Ga0207682_10148612
445 Ga0207688_10117025
446 Ga0207688_10414533
447 Ga0207645_10020964
448 Ga0207645_10038127
449 Ga0207645_10413116
450 Ga0207643_10034883
451 Ga0207705_10224896
452 Ga0207705_10230659
453 Ga0207684_10384701
454 Ga0207663_10181733
455 Ga0207657_10071714
456 Ga0207649_10114987
457 Ga0207652_10569706
458 Ga0207646_10863775
459 Ga0207681_10175706
460 Ga0207681_10221412
461 Ga0207681_10338334
462 Ga0207650_10047623
463 Ga0207650_10194613
464 Ga0207650_10213428
465 Ga0207650_10524040
466 Ga0207659_10075650
467 Ga0207687_10578644
468 Ga0207644_10129501
469 Ga0207690_10278308
470 Ga0207690_11436301
471 Ga0207706_10058661
472 Ga0207706_10099685
473 Ga0207706_10331177
474 Ga0207706_10530218
475 Ga0207706_11012744
476 Ga0207709_10078223
477 Ga0207670_10626314
478 Ga0207669_10021066
479 Ga0207669_10114255
480 Ga0207691_10034295
481 Ga0207691_10081773
482 Ga0207691_10149835
483 Ga0207691_10500645
484 Ga0207711_10392465
485 Ga0207661_10019601
486 Ga0207661_10172089
487 Ga0207661_10587408
488 Ga0207661_11236017
489 Ga0207679_10028518
490 Ga0207679_10167518
491 Ga0207679_10205834
492 Ga0207679_10218836
493 Ga0207679_10462301
494 Ga0207651_10033885
495 Ga0207651_10670733
496 Ga0207712_11495829
497 Ga0207668_10224979
498 Ga0207640_10818177
499 Ga0207658_10225597
500 Ga0207658_10385856
501 Ga0207658_10414131
502 Ga0207677_10681440
503 Ga0207703_10336397
504 Ga0207639_10579185
505 Ga0207678_11032114
506 Ga0207708_11522505
507 Ga0207641_10068437
508 Ga0207641_10297275
509 Ga0207676_10108322
510 Ga0207676_11484074
511 Ga0207674_10010022
512 Ga0207675_100495577
513 Ga0207675_101539938
514 Ga0207683_10008245
515 Ga0207698_10041639
516 Ga0207698_10158024
517 Ga0207698_10578115
518 Ga0207698_10932211
519 Ga0268266_10012962
520 Ga0268266_10766504
521 Ga0268265_10657456
522 Ga0268264_10146226
523 Ga0307408_101061650
524 Ga0307413_10253720
525 Ga0307413_10544590
526 Ga0307410_10504360
527 Ga0307406_10605248
528 Ga0307407_11328606
529 Ga0307409_100254788
530 Ga0307409_100946675
531 Ga0373936_0233738
532 Ga0373939_0019709
533 Ga0373947_0130840
534 Ga0395905_0888940
535 Ga0395901_0398730
536 Ga0436365_0761269
537 Ga0436365_0974462
538 Ga0436363_0811859
539 Ga0453683_0008065
540 Ga0466957_0000315
541 Ga0451576_0024710
542 Ga0451576_0071594
543 Ga0466958_0253103
544 Ga0466967_0271147
545 Ga0495651_0021228
546 Ga0495618_0457448
547 Ga0495628_0205191
548 Ga0495630_0037175
549 Ga0495587_0167200
550 Ga0495621_0022119
551 Ga0495667_0460237
552 Ga0495667_0533818
553 Ga0495599_0261614
554 Ga0495623_0577548
555 Ga0495623_0614421
556 Ga0495646_0114093
557 Ga0495613_0018039
558 Ga0495613_0397826
559 Ga0495624_0009561
560 Ga0495600_0111362
561 Ga0495581_0127159
562 Ga0495581_0162172
563 Ga0495674_0010185
564 Ga0495676_0107735
565 Ga0495675_0083220
566 Ga0496100_0130248
567 Ga0496101_0620723
568 Ga0496104_0337317
569 Ga0496104_0432310
570 Ga0496105_0430276
571 Ga0496106_0317723
572 Ga0496107_0289144
573 Ga0496108_0173865
574 Ga0496109_0377864
575 Ga0496109_1357911
576 Ga0496110_0307938
577 Ga0496111_0671795
578 Ga0496112_0052309
579 Ga0496112_0380211
580 Ga0496112_1056960
581 Ga0496113_0041902
582 Ga0496115_0263701
583 Ga0496115_0320808
584 Ga0496115_0485547
585 Ga0501032_0595269
586 Ga0501042_0076206
587 Ga0501076_0371535
588 Ga0501076_0611552
589 Ga0501035_0221986
590 Ga0501044_0811843
591 nmdc:mga05p37_10914_c1
592 nmdc:mga05p37_176364_c1
593 nmdc:mga09592_214246_c1
594 nmdc:mga09592_2689_c1
595 nmdc:mga09592_3555_c1
596 nmdc:mga0qj67_17980_c1
597 nmdc:mga0qj67_571_c1
598 nmdc:mga06r32_112524_c1
599 nmdc:mga06r32_2788_c1
600 nmdc:mga06r32_99591_c1
601 nmdc:mga0n895_13686_c1
602 nmdc:mga08x19_4396_c1
603 nmdc:mga0a205_10899_c1
604 Ga0495601_0002922
605 Ga0501084_0689371
606 Ga0590071_000447
607 Ga0590074_015704
608 Ga0590075_001008
609 Ga0590077_000168
610 Ga0501082_0795305
611 Ga0530510_0421572
612 2673164130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8528 13 77
6cae-assembly1.cif.gz_1t crystal structure of the thermus thermophilus 70s ribosome in complex with noso-95179 antibiotic and bound to mrna and a-, p- and e-site trnas at 2.6a resolution 0.7682 82 149
7qv3-assembly1.cif.gz_t bacillus subtilis muts2-collided disome complex (muts2 conf.2; leading 70s) 0.7451 82 149
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.7408 13 77
3gz2-assembly1.cif.gz_B crystal structure of ipgc in complex with an ipab peptide 0.7039 7 147
ID Description Score Start End Superfamily
3pe4C01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8975 12 77 1.25.40.10
af_Q58741_243_314_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8241 12 84 1.25.40.10
af_A0A1P8B3S0_1_63_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8208 9 67 1.25.40.10
af_Q9Y2Z0_19_120_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7951 12 77 1.25.40.10
af_K7KG28_220_293_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7934 19 77 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A3B9LV38-F1-model_v4 Tetratricopeptide repeat protein 0.9921 2 101
AF-A0A2V7YCG8-F1-model_v4 Tetratricopeptide repeat protein 0.9733 1 141
AF-A0A2V9SD52-F1-model_v4 Tetratricopeptide repeat protein 0.9629 1 151
AF-A0A1M3MUY1-F1-model_v4 Tetratricopeptide repeat protein 0.9612 1 149
AF-A0A2V7YCG8-F1-model_v4 Tetratricopeptide repeat protein 0.96 1 141

Map