F398757

General Info

Members Datasets Scaffolds Average Seq Length
306 174 612 394

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0033766|Ga0373943_0033766_1130_2416
Length 428
Sequence LHTRKRQPDERRGDEIVAVAQGVSRWADVFAARTRQEESDALAAILALANARDVISFSGGFPDPQTFPGEELADLLRELLLAKDASMLQYGPTRGLPGFRDYLAGRLETLEGRRPEEDELLVTSGGVEALELLGKAFLDPRDLTAVEAPTYLGAIMAFQSFQAGVTGIPMDARGLVVDAAADALDEAERRAGRRTKLLYTIPDHQNPAGVSLSAERRRALVDLARRRGLLLIEDVAYRELGFEGTERLPSLWSMAPDVCVQVGTFSKTFFPGVRLGWAAGPAEVVAQMTRAKQNTDQCAGALGQRLLEEYGRRGLLDRGVAASRVLYQHRWEVLSAALDQHMPPAVAWTKPRGGFFTWLTLPEGADASVLAGRAMREHGVAFVPGEPFFPDDRGRANARLSFSRIEDDESGEGVRRLGALFGEAAGGR

Samples

Sample ID Description Type Environment
1 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
71 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
94 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
95 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.84
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373943_0033766 3300035170 Bacteria 2439
2 JGI24735J21928_10013824 3300002067 Bacteria 2532
3 Ga0070658_10131977 3300005327 Bacteria 2082
4 Ga0070683_100011275 3300005329 Bacteria 7717
5 Ga0070680_100042760 3300005336 Bacteria 3678
6 Ga0070680_100059681 3300005336 Bacteria 3122
7 Ga0068868_100020822 3300005338 Bacteria 4935
8 Ga0070660_100048872 3300005339 Bacteria 3250
9 Ga0070674_100028940 3300005356 Unclassified 3642
10 Ga0070659_100008798 3300005366 Bacteria 7395
11 Ga0070714_100082987 3300005435 Bacteria 2793
12 Ga0070713_100203607 3300005436 Bacteria 1788
13 Ga0070678_100009332 3300005456 Bacteria 5937
14 Ga0070681_10028032 3300005458 Bacteria 5661
15 Ga0070681_10077197 3300005458 Bacteria 3289
16 Ga0068867_100074347 3300005459 Bacteria 2547
17 Ga0070706_100015058 3300005467 Bacteria 7143
18 Ga0070706_100116215 3300005467 Bacteria 2492
19 Ga0070679_100020376 3300005530 Bacteria 6464
20 Ga0070679_100026412 3300005530 Bacteria 5704
21 Ga0070684_100014831 3300005535 Bacteria 6323
22 Ga0070684_100062614 3300005535 Bacteria 3259
23 Ga0070697_100267155 3300005536 Bacteria 1466
24 Ga0068864_100224877 3300005618 Bacteria 1733
25 Ga0068861_100057279 3300005719 Bacteria 2976
26 Ga0068870_10033912 3300005840 Bacteria 2609
27 Ga0081455_10025582 3300005937 Bacteria 5445
28 Ga0081455_10027521 3300005937 Bacteria 5210
29 Ga0081538_10000017 3300005981 Bacteria 145769
30 Ga0081538_10000129 3300005981 Bacteria 77457
31 Ga0081538_10000966 3300005981 Bacteria 30669
32 Ga0081538_10007271 3300005981 Bacteria 9598
33 Ga0081538_10069910 3300005981 Bacteria 1941
34 Ga0081539_10010315 3300005985 Bacteria 7612
35 Ga0075432_10005219 3300006058 Bacteria 4422
36 Ga0075428_100003530 3300006844 Bacteria 17129
37 Ga0075431_100161395 3300006847 Bacteria 2304
38 Ga0075433_10098525 3300006852 Bacteria 2588
39 Ga0075429_100018141 3300006880 Bacteria 6090
40 Ga0111539_10127297 3300009094 Bacteria 2983
41 Ga0111539_10237215 3300009094 Bacteria 2123
42 Ga0111539_10341079 3300009094 Bacteria 1744
43 Ga0105245_10008421 3300009098 Bacteria 9006
44 Ga0105245_10015259 3300009098 Bacteria 6693
45 Ga0105245_10086356 3300009098 Bacteria 2877
46 Ga0114129_10028147 3300009147 Bacteria 7963
47 Ga0114129_10051624 3300009147 Bacteria 5772
48 Ga0114129_10124000 3300009147 Bacteria 3553
49 Ga0105243_10022103 3300009148 Bacteria 4834
50 Ga0105243_10077662 3300009148 Bacteria 2701
51 Ga0105248_10195425 3300009177 Bacteria 2279
52 Ga0105238_10101525 3300009551 Bacteria 2859
53 Ga0105239_10016361 3300010375 Bacteria 8203
54 Ga0105246_10084529 3300011119 Bacteria 2271
55 Ga0157372_10531950 3300013307 Bacteria 1370
56 Ga0157375_10005949 3300013308 Bacteria 10632
57 Ga0157375_10037722 3300013308 Bacteria 4633
58 Ga0182008_10051952 3300014497 Bacteria 2032
59 Ga0157377_10012203 3300014745 Bacteria 4315
60 Ga0182007_10013424 3300015262 Bacteria 3124
61 Ga0206356_11092500 3300020070 Bacteria 2321
62 Ga0206353_11161587 3300020082 Bacteria 6948
63 Ga0206353_11442463 3300020082 Bacteria 5514
64 Ga0207647_10025465 3300025904 Bacteria 3886
65 Ga0207643_10038968 3300025908 Bacteria 2672
66 Ga0207684_10064581 3300025910 Bacteria 3108
67 Ga0207707_10055165 3300025912 Bacteria 3457
68 Ga0207707_10096666 3300025912 Bacteria 2581
69 Ga0207660_10166849 3300025917 Unclassified 1702
70 Ga0207657_10059478 3300025919 Bacteria 3283
71 Ga0207652_10020038 3300025921 Bacteria 5507
72 Ga0207681_10072358 3300025923 Bacteria 2408
73 Ga0207659_10067691 3300025926 Bacteria 2595
74 Ga0207687_10017508 3300025927 Bacteria 4719
75 Ga0207700_10273887 3300025928 Bacteria 1449
76 Ga0207706_10024509 3300025933 Bacteria 5409
77 Ga0207711_10095415 3300025941 Bacteria 2623
78 Ga0207661_10062649 3300025944 Bacteria 3009
79 Ga0207661_10102477 3300025944 Bacteria 2407
80 Ga0207661_10147666 3300025944 Bacteria 2030
81 Ga0207678_10192204 3300026067 Unclassified 1744
82 Ga0207708_10067967 3300026075 Bacteria 2727
83 Ga0207648_10050671 3300026089 Bacteria 3630
84 Ga0207674_10059708 3300026116 Bacteria 3858
85 Ga0207674_10081724 3300026116 Bacteria 3233
86 Ga0207675_100010105 3300026118 Bacteria 8845
87 Ga0207428_10009811 3300027907 Bacteria 8579
88 Ga0265319_1001442 3300028563 Bacteria 14212
89 Ga0265334_10000878 3300028573 Bacteria 15049
90 Ga0265318_10000525 3300028577 Bacteria 27575
91 Ga0265322_10001446 3300028654 Bacteria 7776
92 Ga0265338_10005072 3300028800 Bacteria 17380
93 Ga0265330_10001303 3300031235 Bacteria 14580
94 Ga0265332_10001657 3300031238 Bacteria 12168
95 Ga0265328_10004128 3300031239 Bacteria 6338
96 Ga0265325_10000360 3300031241 Bacteria 32073
97 Ga0265329_10001066 3300031242 Bacteria 13558
98 Ga0265340_10001323 3300031247 Bacteria 14203
99 Ga0265339_10008746 3300031249 Bacteria 6418
100 Ga0265331_10004859 3300031250 Bacteria 8272
101 Ga0265327_10009098 3300031251 Bacteria 7244
102 Ga0265316_10007056 3300031344 Bacteria 10640
103 Ga0265313_10006211 3300031595 Bacteria 8544
104 Ga0265314_10008017 3300031711 Bacteria 9108
105 Ga0265342_10008324 3300031712 Bacteria 7456
106 Ga0307415_100069394 3300032126 Bacteria 2471
107 Ga0373956_0085045 3300035119 Unclassified 1454
108 Ga0373947_0019017 3300035725 Bacteria 3958
109 Ga0373925_0019165 3300037068 Bacteria 4975
110 Ga0395899_0057348 3300037312 Bacteria 2876
111 Ga0395900_0008350 3300037418 Bacteria 10658
112 Ga0395900_0009337 3300037418 Bacteria 10055
113 Ga0395898_0196730 3300037466 Unclassified 1925
114 Ga0395905_0035199 3300037471 Bacteria 4702
115 Ga0395905_0116860 3300037471 Bacteria 2507
116 Ga0395901_0061240 3300038443 Bacteria 3916
117 Ga0439433_0005672 3300041999 Bacteria 2680
118 Ga0439442_010329 3300042002 Bacteria 1892
119 Ga0439451_001839 3300042009 Bacteria 4245
120 Ga0439454_001675 3300042011 Bacteria 2188
121 Ga0439462_0017052 3300042015 Unclassified 1881
122 Ga0450920_011132 3300042122 Bacteria 1674
123 Ga0450906_005910 3300042145 Bacteria 2493
124 Ga0439446_0001096 3300042156 Bacteria 5985
125 Ga0466966_0003827 3300044684 Bacteria 9929
126 Ga0466963_0031037 3300044694 Bacteria 3452
127 Ga0466963_0051639 3300044694 Bacteria 2726
128 Ga0466963_0058921 3300044694 Bacteria 2562
129 Ga0466963_0059442 3300044694 Bacteria 2551
130 Ga0466970_0096337 3300044765 Bacteria 1609
131 Ga0466957_0023213 3300044842 Bacteria 3666
132 Ga0466960_0073820 3300044901 Bacteria 1703
133 Ga0466959_0040578 3300045049 Bacteria 3438
134 Ga0451576_0053405 3300045051 Bacteria 4233
135 Ga0466958_0005607 3300045836 Bacteria 6771
136 Ga0466958_0057871 3300045836 Bacteria 2356
137 Ga0466967_0026911 3300045976 Bacteria 4774
138 Ga0466967_0037471 3300045976 Bacteria 4150
139 Ga0466967_0056152 3300045976 Bacteria 3471
140 Ga0466967_0075494 3300045976 Bacteria 3029
141 Ga0466967_0077557 3300045976 Bacteria 2991
142 Ga0495629_0000306 3300046459 Bacteria 41947
143 Ga0495629_0198689 3300046459 Unclassified 1387
144 Ga0495651_0003246 3300046462 Bacteria 12475
145 Ga0495580_0102823 3300046472 Bacteria 1986
146 Ga0495582_0000098 3300046473 Bacteria 44670
147 Ga0495657_0002109 3300046675 Bacteria 16897
148 Ga0495658_0000535 3300046683 Bacteria 20754
149 Ga0495613_0000797 3300046689 Bacteria 24532
150 Ga0495600_0004987 3300046809 Bacteria 7975
151 Ga0495581_0001136 3300047315 Bacteria 14575
152 Ga0495674_0048235 3300047319 Unclassified 3770
153 Ga0495676_0033276 3300047321 Bacteria 4344
154 Ga0495680_0102519 3300047322 Bacteria 2130
155 Ga0495602_0113872 3300048088 Unclassified 2191
156 Ga0495602_0212933 3300048088 Bacteria 1465
157 Ga0495614_0023452 3300048089 Bacteria 2663
158 Ga0496100_0027993 3300048903 Unclassified 3472
159 Ga0496100_0033964 3300048903 Bacteria 3195
160 Ga0496101_0008019 3300048904 Bacteria 6883
161 Ga0496101_0012526 3300048904 Bacteria 5661
162 Ga0496101_0040947 3300048904 Bacteria 3301
163 Ga0496102_0001211 3300048905 Bacteria 23415
164 Ga0496104_0096633 3300048907 Bacteria 2826
165 Ga0496105_0005831 3300048908 Bacteria 9394
166 Ga0496105_0084157 3300048908 Bacteria 2627
167 Ga0496106_0001580 3300048909 Bacteria 17132
168 Ga0496107_0011099 3300048910 Bacteria 6267
169 Ga0496108_0004127 3300048911 Bacteria 11670
170 Ga0496109_0004149 3300048912 Bacteria 12097
171 Ga0496109_0037095 3300048912 Bacteria 4403
172 Ga0496109_0058600 3300048912 Bacteria 3518
173 Ga0496109_0063163 3300048912 Bacteria 3387
174 Ga0496110_0020820 3300048913 Bacteria 5540
175 Ga0496110_0091744 3300048913 Unclassified 2718
176 Ga0496111_0002367 3300048914 Bacteria 11361
177 Ga0496111_0010004 3300048914 Bacteria 6347
178 Ga0496114_0004172 3300048917 Bacteria 11184
179 Ga0496114_0061651 3300048917 Bacteria 3137
180 Ga0496115_0022223 3300048918 Bacteria 4912
181 Ga0496115_0131357 3300048918 Unclassified 2064
182 Ga0501031_0000181 3300049568 Bacteria 35725
183 Ga0501031_0011805 3300049568 Bacteria 5696
184 Ga0501032_0059898 3300049569 Bacteria 2554
185 Ga0501033_0088711 3300049570 Bacteria 2263
186 Ga0501036_0004629 3300049572 Bacteria 11119
187 Ga0501036_0006771 3300049572 Bacteria 9306
188 Ga0501036_0019318 3300049572 Bacteria 5719
189 Ga0501036_0035192 3300049572 Bacteria 4237
190 Ga0501037_0048812 3300049573 Unclassified 3100
191 Ga0501038_0006512 3300049574 Bacteria 10807
192 Ga0501038_0063059 3300049574 Bacteria 3165
193 Ga0501039_0010704 3300049575 Bacteria 6987
194 Ga0501039_0013160 3300049575 Bacteria 6323
195 Ga0501039_0015211 3300049575 Bacteria 5889
196 Ga0501039_0048623 3300049575 Bacteria 3278
197 Ga0501039_0161606 3300049575 Bacteria 1761
198 Ga0501040_0002155 3300049576 Bacteria 12705
199 Ga0501040_0003619 3300049576 Bacteria 10003
200 Ga0501040_0007023 3300049576 Bacteria 7296
201 Ga0501040_0010532 3300049576 Bacteria 6048
202 Ga0501040_0011690 3300049576 Bacteria 5745
203 Ga0501040_0071908 3300049576 Unclassified 2388
204 Ga0501041_0001205 3300049577 Bacteria 14151
205 Ga0501041_0006049 3300049577 Bacteria 7082
206 Ga0501041_0034272 3300049577 Bacteria 3073
207 Ga0501041_0037679 3300049577 Bacteria 2931
208 Ga0501042_0001006 3300049578 Bacteria 16014
209 Ga0501042_0014651 3300049578 Bacteria 5355
210 Ga0501042_0031084 3300049578 Bacteria 3777
211 Ga0501043_0057643 3300049579 Bacteria 3050
212 Ga0501046_0012828 3300049580 Bacteria 7129
213 Ga0501046_0013604 3300049580 Bacteria 6883
214 Ga0501046_0016755 3300049580 Bacteria 6127
215 Ga0501046_0036485 3300049580 Bacteria 3955
216 Ga0501046_0084360 3300049580 Bacteria 2450
217 Ga0501048_0002828 3300049582 Bacteria 13249
218 Ga0501048_0007527 3300049582 Bacteria 8252
219 Ga0501048_0011471 3300049582 Bacteria 6611
220 Ga0501048_0011859 3300049582 Bacteria 6497
221 Ga0501048_0115312 3300049582 Bacteria 1898
222 Ga0501068_0006053 3300049584 Bacteria 6649
223 Ga0501068_0008657 3300049584 Bacteria 5673
224 Ga0501069_0011948 3300049585 Bacteria 4608
225 Ga0501069_0120057 3300049585 Bacteria 1501
226 Ga0501070_0009939 3300049586 Bacteria 8045
227 Ga0501070_0046954 3300049586 Bacteria 3592
228 Ga0501070_0048724 3300049586 Bacteria 3519
229 Ga0501071_0003326 3300049587 Bacteria 10040
230 Ga0501071_0033824 3300049587 Bacteria 3633
231 Ga0501071_0047580 3300049587 Bacteria 3081
232 Ga0501072_0002911 3300049588 Bacteria 12880
233 Ga0501072_0003352 3300049588 Bacteria 12048
234 Ga0501072_0012892 3300049588 Bacteria 6393
235 Ga0501072_0013308 3300049588 Bacteria 6298
236 Ga0501072_0014264 3300049588 Bacteria 6088
237 Ga0501072_0020027 3300049588 Bacteria 5180
238 Ga0501073_0041858 3300049589 Bacteria 3236
239 Ga0501073_0069948 3300049589 Bacteria 2445
240 Ga0501073_0143967 3300049589 Bacteria 1652
241 Ga0501074_0011651 3300049590 Bacteria 6392
242 Ga0501074_0019133 3300049590 Bacteria 4971
243 Ga0501074_0023000 3300049590 Bacteria 4533
244 Ga0501074_0064589 3300049590 Bacteria 2635
245 Ga0501075_0002920 3300049591 Bacteria 11469
246 Ga0501075_0011283 3300049591 Bacteria 6321
247 Ga0501075_0021567 3300049591 Bacteria 4698
248 Ga0501075_0036550 3300049591 Bacteria 3666
249 Ga0501076_0001768 3300049592 Bacteria 14625
250 Ga0501076_0002893 3300049592 Bacteria 11886
251 Ga0501076_0007438 3300049592 Bacteria 7973
252 Ga0501076_0080008 3300049592 Bacteria 2622
253 Ga0501076_0137304 3300049592 Unclassified 1985
254 Ga0501077_0003129 3300049593 Bacteria 9947
255 Ga0501077_0003369 3300049593 Bacteria 9611
256 Ga0501077_0006666 3300049593 Bacteria 7096
257 Ga0501077_0018560 3300049593 Bacteria 4398
258 Ga0501079_0001512 3300049741 Bacteria 16472
259 Ga0501079_0004768 3300049741 Bacteria 10044
260 Ga0501079_0006800 3300049741 Bacteria 8609
261 Ga0501079_0016525 3300049741 Bacteria 5636
262 Ga0501079_0021574 3300049741 Bacteria 4927
263 Ga0501079_0038014 3300049741 Bacteria 3712
264 Ga0501080_0003767 3300049742 Bacteria 13392
265 Ga0501080_0024138 3300049742 Bacteria 5637
266 Ga0501080_0026782 3300049742 Bacteria 5359
267 Ga0501080_0041560 3300049742 Bacteria 4283
268 Ga0501080_0087743 3300049742 Bacteria 2890
269 Ga0501080_0117582 3300049742 Bacteria 2464
270 Ga0501081_0008594 3300049743 Bacteria 6636
271 Ga0501081_0154258 3300049743 Bacteria 1651
272 Ga0501083_0000852 3300049744 Bacteria 20067
273 Ga0501083_0011105 3300049744 Bacteria 6325
274 Ga0501083_0020785 3300049744 Bacteria 4564
275 Ga0501083_0099407 3300049744 Bacteria 1919
276 Ga0501035_0014405 3300049822 Bacteria 7299
277 Ga0501035_0087910 3300049822 Bacteria 2739
278 Ga0501035_0285065 3300049822 Bacteria 1395
279 Ga0501045_0001188 3300049824 Bacteria 17315
280 Ga0501045_0007323 3300049824 Bacteria 7669
281 Ga0501045_0026045 3300049824 Bacteria 4204
282 Ga0501045_0043534 3300049824 Bacteria 3269
283 nmdc:mga05p37_6927_c1 3300050507 Bacteria 13357
284 nmdc:mga08y16_378096_c1 3300050511 Bacteria 1452
285 nmdc:mga0a205_21710_c1 3300050515 Bacteria 6069
286 Ga0495601_0048558 3300053077 Bacteria 2673
287 Ga0495619_0097838 3300053085 Unclassified 1994
288 Ga0501084_0000440 3300054114 Bacteria 31982
289 Ga0501084_0005321 3300054114 Bacteria 10539
290 Ga0501084_0006710 3300054114 Bacteria 9464
291 Ga0501084_0071454 3300054114 Bacteria 2906
292 Ga0501084_0104734 3300054114 Bacteria 2376
293 Ga0590075_009144 3300059424 Bacteria 2371
294 Ga0501082_0002801 3300060353 Bacteria 15217
295 Ga0501082_0003670 3300060353 Bacteria 13413
296 Ga0501082_0004546 3300060353 Bacteria 12106
297 Ga0501082_0012623 3300060353 Bacteria 7261
298 Ga0501082_0019494 3300060353 Bacteria 5848
299 Ga0501082_0080061 3300060353 Bacteria 2819
300 Ga0466962_0020504 3300061719 Bacteria 3176
301 Ga0530510_0004415 3300061734 Bacteria 9739
302 Ga0530510_0005288 3300061734 Bacteria 8918
303 Ga0530510_0006588 3300061734 Bacteria 8098
304 Ga0530510_0026653 3300061734 Bacteria 4138
305 Ga0530510_0062417 3300061734 Bacteria 2697
306 Ga0530510_0113645 3300061734 Bacteria 1984
307 Ga0373943_0033766
308 JGI24735J21928_10013824
309 Ga0070658_10131977
310 Ga0070683_100011275
311 Ga0070680_100042760
312 Ga0070680_100059681
313 Ga0068868_100020822
314 Ga0070660_100048872
315 Ga0070674_100028940
316 Ga0070659_100008798
317 Ga0070714_100082987
318 Ga0070713_100203607
319 Ga0070678_100009332
320 Ga0070681_10028032
321 Ga0070681_10077197
322 Ga0068867_100074347
323 Ga0070706_100015058
324 Ga0070706_100116215
325 Ga0070679_100020376
326 Ga0070679_100026412
327 Ga0070684_100014831
328 Ga0070684_100062614
329 Ga0070697_100267155
330 Ga0068864_100224877
331 Ga0068861_100057279
332 Ga0068870_10033912
333 Ga0081455_10025582
334 Ga0081455_10027521
335 Ga0081538_10000017
336 Ga0081538_10000129
337 Ga0081538_10000966
338 Ga0081538_10007271
339 Ga0081538_10069910
340 Ga0081539_10010315
341 Ga0075432_10005219
342 Ga0075428_100003530
343 Ga0075431_100161395
344 Ga0075433_10098525
345 Ga0075429_100018141
346 Ga0111539_10127297
347 Ga0111539_10237215
348 Ga0111539_10341079
349 Ga0105245_10008421
350 Ga0105245_10015259
351 Ga0105245_10086356
352 Ga0114129_10028147
353 Ga0114129_10051624
354 Ga0114129_10124000
355 Ga0105243_10022103
356 Ga0105243_10077662
357 Ga0105248_10195425
358 Ga0105238_10101525
359 Ga0105239_10016361
360 Ga0105246_10084529
361 Ga0157372_10531950
362 Ga0157375_10005949
363 Ga0157375_10037722
364 Ga0182008_10051952
365 Ga0157377_10012203
366 Ga0182007_10013424
367 Ga0206356_11092500
368 Ga0206353_11161587
369 Ga0206353_11442463
370 Ga0207647_10025465
371 Ga0207643_10038968
372 Ga0207684_10064581
373 Ga0207707_10055165
374 Ga0207707_10096666
375 Ga0207660_10166849
376 Ga0207657_10059478
377 Ga0207652_10020038
378 Ga0207681_10072358
379 Ga0207659_10067691
380 Ga0207687_10017508
381 Ga0207700_10273887
382 Ga0207706_10024509
383 Ga0207711_10095415
384 Ga0207661_10062649
385 Ga0207661_10102477
386 Ga0207661_10147666
387 Ga0207678_10192204
388 Ga0207708_10067967
389 Ga0207648_10050671
390 Ga0207674_10059708
391 Ga0207674_10081724
392 Ga0207675_100010105
393 Ga0207428_10009811
394 Ga0265319_1001442
395 Ga0265334_10000878
396 Ga0265318_10000525
397 Ga0265322_10001446
398 Ga0265338_10005072
399 Ga0265330_10001303
400 Ga0265332_10001657
401 Ga0265328_10004128
402 Ga0265325_10000360
403 Ga0265329_10001066
404 Ga0265340_10001323
405 Ga0265339_10008746
406 Ga0265331_10004859
407 Ga0265327_10009098
408 Ga0265316_10007056
409 Ga0265313_10006211
410 Ga0265314_10008017
411 Ga0265342_10008324
412 Ga0307415_100069394
413 Ga0373956_0085045
414 Ga0373947_0019017
415 Ga0373925_0019165
416 Ga0395899_0057348
417 Ga0395900_0008350
418 Ga0395900_0009337
419 Ga0395898_0196730
420 Ga0395905_0035199
421 Ga0395905_0116860
422 Ga0395901_0061240
423 Ga0439433_0005672
424 Ga0439442_010329
425 Ga0439451_001839
426 Ga0439454_001675
427 Ga0439462_0017052
428 Ga0450920_011132
429 Ga0450906_005910
430 Ga0439446_0001096
431 Ga0466966_0003827
432 Ga0466963_0031037
433 Ga0466963_0051639
434 Ga0466963_0058921
435 Ga0466963_0059442
436 Ga0466970_0096337
437 Ga0466957_0023213
438 Ga0466960_0073820
439 Ga0466959_0040578
440 Ga0451576_0053405
441 Ga0466958_0005607
442 Ga0466958_0057871
443 Ga0466967_0026911
444 Ga0466967_0037471
445 Ga0466967_0056152
446 Ga0466967_0075494
447 Ga0466967_0077557
448 Ga0495629_0000306
449 Ga0495629_0198689
450 Ga0495651_0003246
451 Ga0495580_0102823
452 Ga0495582_0000098
453 Ga0495657_0002109
454 Ga0495658_0000535
455 Ga0495613_0000797
456 Ga0495600_0004987
457 Ga0495581_0001136
458 Ga0495674_0048235
459 Ga0495676_0033276
460 Ga0495680_0102519
461 Ga0495602_0113872
462 Ga0495602_0212933
463 Ga0495614_0023452
464 Ga0496100_0027993
465 Ga0496100_0033964
466 Ga0496101_0008019
467 Ga0496101_0012526
468 Ga0496101_0040947
469 Ga0496102_0001211
470 Ga0496104_0096633
471 Ga0496105_0005831
472 Ga0496105_0084157
473 Ga0496106_0001580
474 Ga0496107_0011099
475 Ga0496108_0004127
476 Ga0496109_0004149
477 Ga0496109_0037095
478 Ga0496109_0058600
479 Ga0496109_0063163
480 Ga0496110_0020820
481 Ga0496110_0091744
482 Ga0496111_0002367
483 Ga0496111_0010004
484 Ga0496114_0004172
485 Ga0496114_0061651
486 Ga0496115_0022223
487 Ga0496115_0131357
488 Ga0501031_0000181
489 Ga0501031_0011805
490 Ga0501032_0059898
491 Ga0501033_0088711
492 Ga0501036_0004629
493 Ga0501036_0006771
494 Ga0501036_0019318
495 Ga0501036_0035192
496 Ga0501037_0048812
497 Ga0501038_0006512
498 Ga0501038_0063059
499 Ga0501039_0010704
500 Ga0501039_0013160
501 Ga0501039_0015211
502 Ga0501039_0048623
503 Ga0501039_0161606
504 Ga0501040_0002155
505 Ga0501040_0003619
506 Ga0501040_0007023
507 Ga0501040_0010532
508 Ga0501040_0011690
509 Ga0501040_0071908
510 Ga0501041_0001205
511 Ga0501041_0006049
512 Ga0501041_0034272
513 Ga0501041_0037679
514 Ga0501042_0001006
515 Ga0501042_0014651
516 Ga0501042_0031084
517 Ga0501043_0057643
518 Ga0501046_0012828
519 Ga0501046_0013604
520 Ga0501046_0016755
521 Ga0501046_0036485
522 Ga0501046_0084360
523 Ga0501048_0002828
524 Ga0501048_0007527
525 Ga0501048_0011471
526 Ga0501048_0011859
527 Ga0501048_0115312
528 Ga0501068_0006053
529 Ga0501068_0008657
530 Ga0501069_0011948
531 Ga0501069_0120057
532 Ga0501070_0009939
533 Ga0501070_0046954
534 Ga0501070_0048724
535 Ga0501071_0003326
536 Ga0501071_0033824
537 Ga0501071_0047580
538 Ga0501072_0002911
539 Ga0501072_0003352
540 Ga0501072_0012892
541 Ga0501072_0013308
542 Ga0501072_0014264
543 Ga0501072_0020027
544 Ga0501073_0041858
545 Ga0501073_0069948
546 Ga0501073_0143967
547 Ga0501074_0011651
548 Ga0501074_0019133
549 Ga0501074_0023000
550 Ga0501074_0064589
551 Ga0501075_0002920
552 Ga0501075_0011283
553 Ga0501075_0021567
554 Ga0501075_0036550
555 Ga0501076_0001768
556 Ga0501076_0002893
557 Ga0501076_0007438
558 Ga0501076_0080008
559 Ga0501076_0137304
560 Ga0501077_0003129
561 Ga0501077_0003369
562 Ga0501077_0006666
563 Ga0501077_0018560
564 Ga0501079_0001512
565 Ga0501079_0004768
566 Ga0501079_0006800
567 Ga0501079_0016525
568 Ga0501079_0021574
569 Ga0501079_0038014
570 Ga0501080_0003767
571 Ga0501080_0024138
572 Ga0501080_0026782
573 Ga0501080_0041560
574 Ga0501080_0087743
575 Ga0501080_0117582
576 Ga0501081_0008594
577 Ga0501081_0154258
578 Ga0501083_0000852
579 Ga0501083_0011105
580 Ga0501083_0020785
581 Ga0501083_0099407
582 Ga0501035_0014405
583 Ga0501035_0087910
584 Ga0501035_0285065
585 Ga0501045_0001188
586 Ga0501045_0007323
587 Ga0501045_0026045
588 Ga0501045_0043534
589 nmdc:mga05p37_6927_c1
590 nmdc:mga08y16_378096_c1
591 nmdc:mga0a205_21710_c1
592 Ga0495601_0048558
593 Ga0495619_0097838
594 Ga0501084_0000440
595 Ga0501084_0005321
596 Ga0501084_0006710
597 Ga0501084_0071454
598 Ga0501084_0104734
599 Ga0590075_009144
600 Ga0501082_0002801
601 Ga0501082_0003670
602 Ga0501082_0004546
603 Ga0501082_0012623
604 Ga0501082_0019494
605 Ga0501082_0080061
606 Ga0466962_0020504
607 Ga0530510_0004415
608 Ga0530510_0005288
609 Ga0530510_0006588
610 Ga0530510_0026653
611 Ga0530510_0062417
612 Ga0530510_0113645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

52

417

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vp4-assembly1.cif.gz_B crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution 0.9598 28 404
1wst-assembly1.cif.gz_A-2 crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus 0.9542 24 402
3av7-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products 0.9541 24 400
6s8w-assembly1.cif.gz_A aromatic aminotransferase aroh (aro8) form aspergillus fumigatus in complex with plp (internal aldimine) 0.9351 71 400
2xh1-assembly1.cif.gz_B crystal structure of human kat ii-inhibitor complex 0.935 70 398
ID Description Score Start End Superfamily
1vp4B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9486 73 289 3.40.640.10
3aovA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9449 73 292 3.40.640.10
2zc0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9431 73 292 3.40.640.10
2dtvA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9407 73 291 3.40.640.10
af_Q86AG8_30_465_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9382 73 402 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A7C6KID8-F1-model_v4 PLP-dependent aminotransferase family protein 0.9751 27 397 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A359L1F5-F1-model_v4 Aminotransferase 0.9745 26 405 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-H2JDM5-F1-model_v4 Transcriptional regulator with HTH domain and aminotransferase domain 0.9742 24 401 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A1V5J543-F1-model_v4 2-aminoadipate transaminase (EC 2.6.1.39) 0.9736 27 401 GO:0009058
GO:0030170
GO:0047536
GO:1901605
AF-W1U1K4-F1-model_v4 Aminotransferase 0.9731 29 400 GO:0008483
GO:0009058
GO:0030170
GO:1901605

Map