F398744
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 164 | 306 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10086846|Ga0307516_100868462 |
| Length | 273 |
| Sequence | MTAFVKMHGLGNDFVVFDARDTAVSLDAAKAKAIADRHFGVGCDTVVLIQPGGAKADAGLLFYNADGSEAEACFNATRCVARLLLDERGLARVKLSTKADILTCSDAGGKMVTLDAGSPKLDWREIPLAKNVDTADFPLDIGGLSASAVSMGNPHCVLFVPDAQAAPVTQLGPKIETLPLFPNRTNVEFAQVLNRERIRMRVWERGVGVTLACGTGACATAVAAIRRGLVGRKVELVLDGGSLTIEWREEDGHILMTGPTAMPFRGRLELDKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 20 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 21 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 22 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 23 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 24 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 29 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 51 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 93 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 97 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 98 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 102 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 106 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 108 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 110 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 118 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 120 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 135 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 140 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 157 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 158 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 159 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 160 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 161 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 162 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 163 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.58 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 92.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000047 | 3300003214 | Bacteria | 254601 |
| 2 | JGI25165J46597_1000066 | 3300003214 | Bacteria | 199459 |
| 3 | Ga0070658_10125064 | 3300005327 | Bacteria | 2140 |
| 4 | Ga0070658_10428992 | 3300005327 | Bacteria | 1138 |
| 5 | Ga0070676_10190101 | 3300005328 | Bacteria | 1340 |
| 6 | Ga0070683_100115103 | 3300005329 | Bacteria | 2538 |
| 7 | Ga0070666_10005142 | 3300005335 | Bacteria | 8009 |
| 8 | Ga0070666_10102907 | 3300005335 | Bacteria | 1970 |
| 9 | Ga0070680_100018524 | 3300005336 | Bacteria | 5503 |
| 10 | Ga0070680_100091385 | 3300005336 | Bacteria | 2520 |
| 11 | Ga0068868_100060641 | 3300005338 | Bacteria | 2996 |
| 12 | Ga0068868_100201206 | 3300005338 | Bacteria | 1661 |
| 13 | Ga0070661_100137762 | 3300005344 | Bacteria | 1838 |
| 14 | Ga0070661_100593519 | 3300005344 | Bacteria | 895 |
| 15 | Ga0070673_100312338 | 3300005364 | Bacteria | 1387 |
| 16 | Ga0070678_100172051 | 3300005456 | Bacteria | 1765 |
| 17 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 18 | Ga0070681_10185648 | 3300005458 | Bacteria | 2000 |
| 19 | Ga0068867_100046788 | 3300005459 | Bacteria | 3179 |
| 20 | Ga0070679_100004777 | 3300005530 | Bacteria | 12494 |
| 21 | Ga0070679_100050876 | 3300005530 | Bacteria | 4127 |
| 22 | Ga0070679_100555678 | 3300005530 | Bacteria | 1092 |
| 23 | Ga0070672_100326417 | 3300005543 | Bacteria | 1305 |
| 24 | Ga0070665_100000685 | 3300005548 | Bacteria | 45385 |
| 25 | Ga0070665_100016071 | 3300005548 | Bacteria | 7510 |
| 26 | Ga0070665_100035650 | 3300005548 | Bacteria | 5003 |
| 27 | Ga0070665_100175870 | 3300005548 | Bacteria | 2141 |
| 28 | Ga0070665_100314306 | 3300005548 | Bacteria | 1570 |
| 29 | Ga0068855_100000034 | 3300005563 | Bacteria | 166436 |
| 30 | Ga0068855_100019580 | 3300005563 | Bacteria | 8128 |
| 31 | Ga0068855_100410599 | 3300005563 | Bacteria | 1482 |
| 32 | Ga0068857_100048884 | 3300005577 | Bacteria | 3752 |
| 33 | Ga0068856_100079853 | 3300005614 | Bacteria | 3244 |
| 34 | Ga0068856_100203544 | 3300005614 | Bacteria | 1994 |
| 35 | Ga0068852_100320993 | 3300005616 | Bacteria | 1504 |
| 36 | Ga0068859_100491339 | 3300005617 | Bacteria | 1323 |
| 37 | Ga0068866_10082935 | 3300005718 | Bacteria | 1726 |
| 38 | Ga0068861_100168403 | 3300005719 | Bacteria | 1814 |
| 39 | Ga0068863_100307403 | 3300005841 | Bacteria | 1538 |
| 40 | Ga0068858_100191052 | 3300005842 | Bacteria | 1935 |
| 41 | Ga0068860_100064722 | 3300005843 | Bacteria | 3473 |
| 42 | Ga0068860_100160057 | 3300005843 | Bacteria | 2171 |
| 43 | Ga0081455_10151428 | 3300005937 | Bacteria | 1788 |
| 44 | Ga0097621_100000164 | 3300006237 | Bacteria | 41441 |
| 45 | Ga0068871_100012735 | 3300006358 | Bacteria | 6218 |
| 46 | Ga0068871_100033487 | 3300006358 | Bacteria | 4069 |
| 47 | Ga0068871_100040423 | 3300006358 | Bacteria | 3735 |
| 48 | Ga0068871_100203090 | 3300006358 | Bacteria | 1712 |
| 49 | Ga0068871_100212394 | 3300006358 | Bacteria | 1674 |
| 50 | Ga0068871_100558155 | 3300006358 | Bacteria | 1038 |
| 51 | Ga0097620_100491322 | 3300006931 | Bacteria | 1323 |
| 52 | Ga0105240_10000596 | 3300009093 | Bacteria | 67093 |
| 53 | Ga0105240_10041751 | 3300009093 | Bacteria | 5850 |
| 54 | Ga0105240_10100124 | 3300009093 | Bacteria | 3527 |
| 55 | Ga0105240_10159393 | 3300009093 | Bacteria | 2682 |
| 56 | Ga0105240_10203418 | 3300009093 | Bacteria | 2319 |
| 57 | Ga0105240_10255968 | 3300009093 | Bacteria | 2022 |
| 58 | Ga0105240_10815983 | 3300009093 | Bacteria | 1009 |
| 59 | Ga0105245_10022725 | 3300009098 | Bacteria | 5504 |
| 60 | Ga0105245_10072923 | 3300009098 | Bacteria | 3120 |
| 61 | Ga0105247_10050900 | 3300009101 | Bacteria | 2549 |
| 62 | Ga0105243_10001795 | 3300009148 | Bacteria | 18418 |
| 63 | Ga0105241_10008211 | 3300009174 | Bacteria | 7685 |
| 64 | Ga0105241_10344332 | 3300009174 | Bacteria | 1292 |
| 65 | Ga0105242_10011760 | 3300009176 | Bacteria | 6733 |
| 66 | Ga0105242_10448432 | 3300009176 | Bacteria | 1216 |
| 67 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 68 | Ga0105248_10039580 | 3300009177 | Bacteria | 5282 |
| 69 | Ga0105237_10395993 | 3300009545 | Bacteria | 1386 |
| 70 | Ga0105238_10178659 | 3300009551 | Bacteria | 2099 |
| 71 | Ga0105239_10210779 | 3300010375 | Bacteria | 2178 |
| 72 | Ga0105239_10451551 | 3300010375 | Bacteria | 1458 |
| 73 | Ga0105246_10025650 | 3300011119 | Bacteria | 3844 |
| 74 | Ga0105246_10068176 | 3300011119 | Bacteria | 2494 |
| 75 | Ga0157369_10284659 | 3300013105 | Bacteria | 1721 |
| 76 | Ga0157369_10432775 | 3300013105 | Bacteria | 1363 |
| 77 | Ga0157374_10101236 | 3300013296 | Bacteria | 2763 |
| 78 | Ga0157374_10192494 | 3300013296 | Bacteria | 1995 |
| 79 | Ga0157378_10135158 | 3300013297 | Bacteria | 2286 |
| 80 | Ga0163162_10187426 | 3300013306 | Bacteria | 2196 |
| 81 | Ga0157375_10041600 | 3300013308 | Bacteria | 4439 |
| 82 | Ga0163163_10000252 | 3300014325 | Bacteria | 54262 |
| 83 | Ga0163163_10092151 | 3300014325 | Bacteria | 3045 |
| 84 | Ga0157379_10004078 | 3300014968 | Bacteria | 12458 |
| 85 | Ga0157379_10008649 | 3300014968 | Bacteria | 8865 |
| 86 | Ga0157379_10091631 | 3300014968 | Bacteria | 2726 |
| 87 | Ga0157376_10061349 | 3300014969 | Bacteria | 3161 |
| 88 | Ga0163161_10014965 | 3300017792 | Bacteria | 5404 |
| 89 | Ga0213876_10009484 | 3300021384 | Bacteria | 5236 |
| 90 | Ga0209233_1000045 | 3300025261 | Bacteria | 473379 |
| 91 | Ga0209233_1018508 | 3300025261 | Bacteria | 1873 |
| 92 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 93 | Ga0207688_10027705 | 3300025901 | Bacteria | 3116 |
| 94 | Ga0207688_10297518 | 3300025901 | Bacteria | 986 |
| 95 | Ga0207680_10260986 | 3300025903 | Bacteria | 1199 |
| 96 | Ga0207647_10182365 | 3300025904 | Bacteria | 1219 |
| 97 | Ga0207705_10005288 | 3300025909 | Bacteria | 9657 |
| 98 | Ga0207654_10017805 | 3300025911 | Bacteria | 3721 |
| 99 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 100 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 101 | Ga0207695_10059683 | 3300025913 | Bacteria | 3953 |
| 102 | Ga0207695_10123192 | 3300025913 | Bacteria | 2558 |
| 103 | Ga0207695_10207208 | 3300025913 | Bacteria | 1873 |
| 104 | Ga0207695_10218895 | 3300025913 | Bacteria | 1812 |
| 105 | Ga0207695_10415838 | 3300025913 | Bacteria | 1229 |
| 106 | Ga0207671_10015696 | 3300025914 | Bacteria | 5920 |
| 107 | Ga0207671_10121562 | 3300025914 | Bacteria | 1996 |
| 108 | Ga0207671_10268185 | 3300025914 | Bacteria | 1345 |
| 109 | Ga0207663_10144908 | 3300025916 | Bacteria | 1659 |
| 110 | Ga0207660_10003699 | 3300025917 | Bacteria | 9964 |
| 111 | Ga0207660_10073081 | 3300025917 | Bacteria | 2499 |
| 112 | Ga0207660_10271429 | 3300025917 | Bacteria | 1344 |
| 113 | Ga0207657_10052225 | 3300025919 | Bacteria | 3548 |
| 114 | Ga0207652_10000506 | 3300025921 | Bacteria | 39607 |
| 115 | Ga0207652_10069987 | 3300025921 | Bacteria | 3047 |
| 116 | Ga0207652_10101581 | 3300025921 | Bacteria | 2540 |
| 117 | Ga0207652_10171121 | 3300025921 | Bacteria | 1949 |
| 118 | Ga0207694_10010519 | 3300025924 | Bacteria | 6979 |
| 119 | Ga0207694_10118011 | 3300025924 | Bacteria | 2116 |
| 120 | Ga0207694_10145562 | 3300025924 | Bacteria | 1907 |
| 121 | Ga0207694_10351400 | 3300025924 | Bacteria | 1220 |
| 122 | Ga0207650_10275034 | 3300025925 | Bacteria | 1370 |
| 123 | Ga0207687_10005387 | 3300025927 | Bacteria | 8460 |
| 124 | Ga0207687_10114230 | 3300025927 | Bacteria | 2009 |
| 125 | Ga0207700_10445201 | 3300025928 | Bacteria | 1141 |
| 126 | Ga0207706_10251906 | 3300025933 | Bacteria | 1542 |
| 127 | Ga0207686_10141681 | 3300025934 | Bacteria | 1663 |
| 128 | Ga0207709_10007529 | 3300025935 | Bacteria | 6052 |
| 129 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 130 | Ga0207711_10064282 | 3300025941 | Bacteria | 3169 |
| 131 | Ga0207689_10365420 | 3300025942 | Bacteria | 1200 |
| 132 | Ga0207661_10005016 | 3300025944 | Bacteria | 9281 |
| 133 | Ga0207661_10200998 | 3300025944 | Bacteria | 1752 |
| 134 | Ga0207667_10000065 | 3300025949 | Bacteria | 186655 |
| 135 | Ga0207667_10301803 | 3300025949 | Bacteria | 1636 |
| 136 | Ga0207712_10173858 | 3300025961 | Bacteria | 1686 |
| 137 | Ga0207640_10160393 | 3300025981 | Bacteria | 1663 |
| 138 | Ga0207658_10068594 | 3300025986 | Bacteria | 2676 |
| 139 | Ga0207677_10061793 | 3300026023 | Bacteria | 2596 |
| 140 | Ga0207677_10195966 | 3300026023 | Bacteria | 1602 |
| 141 | Ga0207703_10101454 | 3300026035 | Bacteria | 2440 |
| 142 | Ga0207702_10052163 | 3300026078 | Bacteria | 3460 |
| 143 | Ga0207641_10174814 | 3300026088 | Bacteria | 1963 |
| 144 | Ga0207648_10063049 | 3300026089 | Bacteria | 3231 |
| 145 | Ga0207648_10097468 | 3300026089 | Bacteria | 2573 |
| 146 | Ga0207648_10167898 | 3300026089 | Bacteria | 1939 |
| 147 | Ga0207674_10041437 | 3300026116 | Bacteria | 4763 |
| 148 | Ga0207674_10097655 | 3300026116 | Bacteria | 2921 |
| 149 | Ga0207674_10106788 | 3300026116 | Bacteria | 2777 |
| 150 | Ga0207675_100076876 | 3300026118 | Bacteria | 3126 |
| 151 | Ga0207683_10012407 | 3300026121 | Bacteria | 7271 |
| 152 | Ga0207683_10207349 | 3300026121 | Bacteria | 1783 |
| 153 | Ga0207683_10446221 | 3300026121 | Bacteria | 1192 |
| 154 | Ga0207698_10005150 | 3300026142 | Bacteria | 8039 |
| 155 | Ga0207698_10240437 | 3300026142 | Bacteria | 1650 |
| 156 | Ga0268266_10000329 | 3300028379 | Bacteria | 74608 |
| 157 | Ga0268266_10015934 | 3300028379 | Bacteria | 6431 |
| 158 | Ga0268266_10016602 | 3300028379 | Bacteria | 6291 |
| 159 | Ga0268266_10270070 | 3300028379 | Bacteria | 1578 |
| 160 | Ga0268265_10314560 | 3300028380 | Bacteria | 1415 |
| 161 | Ga0268264_10044600 | 3300028381 | Bacteria | 3679 |
| 162 | Ga0268264_10191390 | 3300028381 | Bacteria | 1865 |
| 163 | Ga0265334_10014788 | 3300028573 | Bacteria | 3249 |
| 164 | Ga0265318_10004889 | 3300028577 | Bacteria | 6396 |
| 165 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 166 | Ga0265338_10007645 | 3300028800 | Bacteria | 13335 |
| 167 | Ga0265338_10179904 | 3300028800 | Bacteria | 1613 |
| 168 | Ga0265332_10010364 | 3300031238 | Bacteria | 4150 |
| 169 | Ga0265332_10155088 | 3300031238 | Bacteria | 957 |
| 170 | Ga0265328_10059753 | 3300031239 | Bacteria | 1399 |
| 171 | Ga0265320_10000039 | 3300031240 | Bacteria | 134478 |
| 172 | Ga0265325_10000007 | 3300031241 | Bacteria | 208874 |
| 173 | Ga0265325_10001182 | 3300031241 | Bacteria | 18613 |
| 174 | Ga0265325_10002832 | 3300031241 | Bacteria | 11567 |
| 175 | Ga0265340_10006735 | 3300031247 | Bacteria | 6292 |
| 176 | Ga0265340_10051667 | 3300031247 | Bacteria | 1990 |
| 177 | Ga0265340_10069755 | 3300031247 | Bacteria | 1668 |
| 178 | Ga0265340_10095343 | 3300031247 | Bacteria | 1387 |
| 179 | Ga0265339_10005068 | 3300031249 | Bacteria | 8848 |
| 180 | Ga0265339_10050408 | 3300031249 | Bacteria | 2277 |
| 181 | Ga0265331_10004152 | 3300031250 | Bacteria | 9078 |
| 182 | Ga0265331_10031678 | 3300031250 | Bacteria | 2626 |
| 183 | Ga0265331_10117697 | 3300031250 | Bacteria | 1215 |
| 184 | Ga0265316_10047545 | 3300031344 | Bacteria | 3394 |
| 185 | Ga0265316_10131700 | 3300031344 | Bacteria | 1883 |
| 186 | Ga0265316_10252479 | 3300031344 | Bacteria | 1294 |
| 187 | Ga0265313_10001337 | 3300031595 | Bacteria | 23225 |
| 188 | Ga0265313_10001744 | 3300031595 | Bacteria | 19971 |
| 189 | Ga0265313_10004411 | 3300031595 | Bacteria | 10847 |
| 190 | Ga0265313_10010027 | 3300031595 | Bacteria | 6063 |
| 191 | Ga0265314_10000193 | 3300031711 | Bacteria | 90595 |
| 192 | Ga0265314_10019097 | 3300031711 | Bacteria | 5319 |
| 193 | Ga0265314_10019737 | 3300031711 | Bacteria | 5214 |
| 194 | Ga0265314_10096173 | 3300031711 | Bacteria | 1916 |
| 195 | Ga0265314_10131783 | 3300031711 | Bacteria | 1558 |
| 196 | Ga0265314_10265352 | 3300031711 | Bacteria | 978 |
| 197 | Ga0265342_10002997 | 3300031712 | Bacteria | 14168 |
| 198 | Ga0265342_10022314 | 3300031712 | Bacteria | 4027 |
| 199 | Ga0307516_10045601 | 3300031730 | Bacteria | 4329 |
| 200 | Ga0307516_10047329 | 3300031730 | Bacteria | 4237 |
| 201 | Ga0307516_10086846 | 3300031730 | Bacteria | 2963 |
| 202 | Ga0373936_0103476 | 3300035113 | Bacteria | 1203 |
| 203 | Ga0373943_0000736 | 3300035170 | Bacteria | 14273 |
| 204 | Ga0373946_0095182 | 3300035171 | Bacteria | 1326 |
| 205 | Ga0373935_0083053 | 3300035692 | Bacteria | 2085 |
| 206 | Ga0373927_0067466 | 3300035695 | Bacteria | 2315 |
| 207 | Ga0373937_0145411 | 3300036401 | Bacteria | 2219 |
| 208 | Ga0373925_0012402 | 3300037068 | Bacteria | 6171 |
| 209 | Ga0395899_0180426 | 3300037312 | Bacteria | 1483 |
| 210 | Ga0395900_0034844 | 3300037418 | Bacteria | 5186 |
| 211 | Ga0395898_0515982 | 3300037466 | Bacteria | 1136 |
| 212 | Ga0395901_0670938 | 3300038443 | Bacteria | 1037 |
| 213 | Ga0436365_0148064 | 3300039437 | Bacteria | 1804 |
| 214 | Ga0436365_1376305 | 3300039437 | Bacteria | 6022 |
| 215 | Ga0451789_1251644 | 3300041443 | Bacteria | 2118 |
| 216 | Ga0451795_0608028 | 3300041456 | Bacteria | 1296 |
| 217 | Ga0495580_0014039 | 3300046472 | Bacteria | 6092 |
| 218 | Ga0495582_0110219 | 3300046473 | Bacteria | 1546 |
| 219 | Ga0495606_0120525 | 3300046507 | Bacteria | 1571 |
| 220 | Ga0495652_0246365 | 3300046529 | Bacteria | 1327 |
| 221 | Ga0495587_0030113 | 3300046536 | Bacteria | 3292 |
| 222 | Ga0495587_0098797 | 3300046536 | Bacteria | 1683 |
| 223 | Ga0495621_0022149 | 3300046539 | Bacteria | 2103 |
| 224 | Ga0495645_0027780 | 3300046543 | Bacteria | 4111 |
| 225 | Ga0495622_0001870 | 3300046557 | Bacteria | 10378 |
| 226 | Ga0495658_0004729 | 3300046683 | Bacteria | 6686 |
| 227 | Ga0495613_0068020 | 3300046689 | Bacteria | 2599 |
| 228 | Ga0495671_0162620 | 3300046692 | Bacteria | 1086 |
| 229 | Ga0495589_0029508 | 3300046794 | Bacteria | 2765 |
| 230 | Ga0495636_0044164 | 3300047318 | Bacteria | 1855 |
| 231 | Ga0495674_0088171 | 3300047319 | Bacteria | 2654 |
| 232 | Ga0496126_0148226 | 3300048929 | Bacteria | 2013 |
| 233 | Ga0495682_0000512 | 3300049460 | Bacteria | 26836 |
| 234 | Ga0501032_0104383 | 3300049569 | Bacteria | 1878 |
| 235 | Ga0501033_0001777 | 3300049570 | Bacteria | 18831 |
| 236 | Ga0501033_0014336 | 3300049570 | Bacteria | 6023 |
| 237 | Ga0501033_0046829 | 3300049570 | Bacteria | 3215 |
| 238 | Ga0501033_0070966 | 3300049570 | Bacteria | 2559 |
| 239 | Ga0501033_0115405 | 3300049570 | Bacteria | 1951 |
| 240 | Ga0501034_0025010 | 3300049571 | Bacteria | 6076 |
| 241 | Ga0501034_0159076 | 3300049571 | Bacteria | 2231 |
| 242 | Ga0501034_0355755 | 3300049571 | Bacteria | 1392 |
| 243 | Ga0501036_0022180 | 3300049572 | Bacteria | 5341 |
| 244 | Ga0501036_0402679 | 3300049572 | Bacteria | 1142 |
| 245 | Ga0501037_0047064 | 3300049573 | Bacteria | 3162 |
| 246 | Ga0501038_0174135 | 3300049574 | Bacteria | 1740 |
| 247 | Ga0501038_0229731 | 3300049574 | Bacteria | 1477 |
| 248 | Ga0501038_0289130 | 3300049574 | Bacteria | 1289 |
| 249 | Ga0501043_0075794 | 3300049579 | Bacteria | 2642 |
| 250 | Ga0501043_0108784 | 3300049579 | Bacteria | 2177 |
| 251 | Ga0501043_0333071 | 3300049579 | Bacteria | 1156 |
| 252 | Ga0501046_0188557 | 3300049580 | Bacteria | 1539 |
| 253 | Ga0501047_0001999 | 3300049581 | Bacteria | 19548 |
| 254 | Ga0501047_0010610 | 3300049581 | Bacteria | 8712 |
| 255 | Ga0501047_0057984 | 3300049581 | Bacteria | 3742 |
| 256 | Ga0501047_0097680 | 3300049581 | Bacteria | 2815 |
| 257 | Ga0501047_0183202 | 3300049581 | Bacteria | 1960 |
| 258 | Ga0501047_0192931 | 3300049581 | Bacteria | 1900 |
| 259 | Ga0501047_0198571 | 3300049581 | Bacteria | 1867 |
| 260 | Ga0501047_0211409 | 3300049581 | Bacteria | 1798 |
| 261 | Ga0501047_0242073 | 3300049581 | Bacteria | 1654 |
| 262 | Ga0501047_0396610 | 3300049581 | Bacteria | 1213 |
| 263 | Ga0501047_0447006 | 3300049581 | Bacteria | 1122 |
| 264 | Ga0501067_0007491 | 3300049583 | Bacteria | 6062 |
| 265 | Ga0501067_0048067 | 3300049583 | Bacteria | 2366 |
| 266 | Ga0501069_0001549 | 3300049585 | Bacteria | 11366 |
| 267 | Ga0501070_0003820 | 3300049586 | Bacteria | 13000 |
| 268 | Ga0501070_0033643 | 3300049586 | Bacteria | 4290 |
| 269 | Ga0501070_0222268 | 3300049586 | Bacteria | 1548 |
| 270 | Ga0501072_0030732 | 3300049588 | Bacteria | 4201 |
| 271 | Ga0501073_0019392 | 3300049589 | Bacteria | 4910 |
| 272 | Ga0501073_0026986 | 3300049589 | Bacteria | 4110 |
| 273 | Ga0501073_0043797 | 3300049589 | Bacteria | 3156 |
| 274 | Ga0501074_0140196 | 3300049590 | Bacteria | 1730 |
| 275 | Ga0501074_0142432 | 3300049590 | Bacteria | 1714 |
| 276 | Ga0501079_0020826 | 3300049741 | Bacteria | 5014 |
| 277 | Ga0501079_0121400 | 3300049741 | Bacteria | 2032 |
| 278 | Ga0501080_0015583 | 3300049742 | Bacteria | 7010 |
| 279 | Ga0501080_0078808 | 3300049742 | Bacteria | 3063 |
| 280 | Ga0501080_0243072 | 3300049742 | Bacteria | 1642 |
| 281 | Ga0501080_0308271 | 3300049742 | Bacteria | 1435 |
| 282 | Ga0501080_0351872 | 3300049742 | Bacteria | 1330 |
| 283 | Ga0501080_0609252 | 3300049742 | Bacteria | 969 |
| 284 | Ga0501080_0733565 | 3300049742 | Bacteria | 870 |
| 285 | Ga0501083_0100978 | 3300049744 | Bacteria | 1902 |
| 286 | Ga0501035_0008982 | 3300049822 | Bacteria | 9294 |
| 287 | Ga0501035_0037701 | 3300049822 | Bacteria | 4376 |
| 288 | Ga0501035_0041321 | 3300049822 | Bacteria | 4164 |
| 289 | Ga0501044_0013241 | 3300049823 | Bacteria | 8929 |
| 290 | Ga0501044_0044605 | 3300049823 | Bacteria | 4600 |
| 291 | Ga0501044_0049305 | 3300049823 | Bacteria | 4347 |
| 292 | Ga0501044_0089074 | 3300049823 | Bacteria | 3115 |
| 293 | Ga0501044_0150893 | 3300049823 | Bacteria | 2306 |
| 294 | Ga0501044_0220127 | 3300049823 | Bacteria | 1849 |
| 295 | Ga0501044_0327467 | 3300049823 | Bacteria | 1455 |
| 296 | Ga0500643_000006 | 3300053087 | Bacteria | 479605 |
| 297 | Ga0500646_0011716 | 3300053090 | Bacteria | 2258 |
| 298 | Ga0500595_001244 | 3300053119 | Bacteria | 14031 |
| 299 | Ga0500595_005425 | 3300053119 | Bacteria | 5567 |
| 300 | Ga0500655_000866 | 3300053133 | Bacteria | 5876 |
| 301 | Ga0500655_013884 | 3300053133 | Bacteria | 1472 |
| 302 | Ga0500559_0031449 | 3300053136 | Bacteria | 2277 |
| 303 | Ga0500568_0023291 | 3300053139 | Bacteria | 2635 |
| 304 | Ga0500573_0000520 | 3300053140 | Bacteria | 16721 |
| 305 | Ga0501084_0058112 | 3300054114 | Bacteria | 3236 |
| 306 | Ga0501082_0095886 | 3300060353 | Bacteria | 2564 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049574 | Ga0501038_0289130 | Ga0501038_0289130_70_939 | 260 |
| 2 | 3300049581 | Ga0501047_0198571 | Ga0501047_0198571_806_1675 | 260 |
| 3 | 3300049822 | Ga0501035_0041321 | Ga0501035_0041321_1070_1939 | 260 |
| 4 | 3300049823 | Ga0501044_0150893 | Ga0501044_0150893_1028_1897 | 260 |
| 5 | 3300005842 | Ga0068858_100191052 | Ga0068858_1001910522 | 261 |
| 6 | 3300028577 | Ga0265318_10004889 | Ga0265318_100048892 | 262 |
| 7 | 3300031250 | Ga0265331_10117697 | Ga0265331_101176972 | 262 |
| 8 | 3300031595 | Ga0265313_10001744 | Ga0265313_1000174413 | 262 |
| 9 | 3300031595 | Ga0265313_10010027 | Ga0265313_100100272 | 262 |
| 10 | 3300031711 | Ga0265314_10019737 | Ga0265314_100197371 | 262 |
| 11 | 3300049569 | Ga0501032_0104383 | Ga0501032_0104383_679_1509 | 265 |
| 12 | 3300049570 | Ga0501033_0046829 | Ga0501033_0046829_230_1096 | 265 |
| 13 | 3300049571 | Ga0501034_0355755 | Ga0501034_0355755_254_1120 | 265 |
| 14 | 3300049579 | Ga0501043_0108784 | Ga0501043_0108784_742_1608 | 265 |
| 15 | 3300049581 | Ga0501047_0192931 | Ga0501047_0192931_756_1622 | 265 |
| 16 | 3300049742 | Ga0501080_0308271 | Ga0501080_0308271_242_1108 | 265 |
| 17 | 3300049823 | Ga0501044_0327467 | Ga0501044_0327467_121_987 | 265 |
| 18 | 3300049570 | Ga0501033_0001777 | Ga0501033_0001777_14577_15404 | 266 |
| 19 | 3300049573 | Ga0501037_0047064 | Ga0501037_0047064_1803_2630 | 266 |
| 20 | 3300049574 | Ga0501038_0174135 | Ga0501038_0174135_524_1351 | 266 |
| 21 | 3300049581 | Ga0501047_0010610 | Ga0501047_0010610_4729_5556 | 266 |
| 22 | 3300049823 | Ga0501044_0220127 | Ga0501044_0220127_819_1646 | 266 |
| 23 | 3300049572 | Ga0501036_0402679 | Ga0501036_0402679_206_1036 | 267 |
| 24 | 3300049586 | Ga0501070_0033643 | Ga0501070_0033643_15_821 | 268 |
| 25 | 3300035695 | Ga0373927_0067466 | Ga0373927_0067466_650_1480 | 269 |
| 26 | 3300041443 | Ga0451789_1251644 | Ga0451789_1251644_1292_2101 | 269 |
| 27 | 3300046529 | Ga0495652_0246365 | Ga0495652_0246365_502_1317 | 269 |
| 28 | 3300046536 | Ga0495587_0098797 | Ga0495587_0098797_11_826 | 269 |
| 29 | 3300049581 | Ga0501047_0447006 | Ga0501047_0447006_297_1106 | 269 |
| 30 | 3300005937 | Ga0081455_10151428 | Ga0081455_101514282 | 271 |
| 31 | 3300031730 | Ga0307516_10086846 | Ga0307516_100868462 | 273 |
| 32 | 3300046794 | Ga0495589_0029508 | Ga0495589_0029508_1066_1887 | 273 |
| 33 | 3300005327 | Ga0070658_10428992 | Ga0070658_104289921 | 274 |
| 34 | 3300005328 | Ga0070676_10190101 | Ga0070676_101901012 | 274 |
| 35 | 3300005329 | Ga0070683_100115103 | Ga0070683_1001151032 | 274 |
| 36 | 3300005335 | Ga0070666_10005142 | Ga0070666_100051427 | 274 |
| 37 | 3300005338 | Ga0068868_100201206 | Ga0068868_1002012062 | 274 |
| 38 | 3300005617 | Ga0068859_100491339 | Ga0068859_1004913391 | 274 |
| 39 | 3300005843 | Ga0068860_100064722 | Ga0068860_1000647222 | 274 |
| 40 | 3300006358 | Ga0068871_100012735 | Ga0068871_1000127353 | 274 |
| 41 | 3300006358 | Ga0068871_100040423 | Ga0068871_1000404232 | 274 |
| 42 | 3300006931 | Ga0097620_100491322 | Ga0097620_1004913221 | 274 |
| 43 | 3300009174 | Ga0105241_10008211 | Ga0105241_100082114 | 274 |
| 44 | 3300010375 | Ga0105239_10210779 | Ga0105239_102107792 | 274 |
| 45 | 3300011119 | Ga0105246_10068176 | Ga0105246_100681762 | 274 |
| 46 | 3300013296 | Ga0157374_10101236 | Ga0157374_101012362 | 274 |
| 47 | 3300013297 | Ga0157378_10135158 | Ga0157378_101351582 | 274 |
| 48 | 3300013306 | Ga0163162_10187426 | Ga0163162_101874262 | 274 |
| 49 | 3300013308 | Ga0157375_10041600 | Ga0157375_100416004 | 274 |
| 50 | 3300014325 | Ga0163163_10000252 | Ga0163163_1000025222 | 274 |
| 51 | 3300014325 | Ga0163163_10092151 | Ga0163163_100921512 | 274 |
| 52 | 3300014968 | Ga0157379_10004078 | Ga0157379_100040785 | 274 |
| 53 | 3300014969 | Ga0157376_10061349 | Ga0157376_100613492 | 274 |
| 54 | 3300017792 | Ga0163161_10014965 | Ga0163161_100149654 | 274 |
| 55 | 3300025911 | Ga0207654_10017805 | Ga0207654_100178053 | 274 |
| 56 | 3300025914 | Ga0207671_10121562 | Ga0207671_101215622 | 274 |
| 57 | 3300025986 | Ga0207658_10068594 | Ga0207658_100685942 | 274 |
| 58 | 3300026035 | Ga0207703_10101454 | Ga0207703_101014542 | 274 |
| 59 | 3300026088 | Ga0207641_10174814 | Ga0207641_101748142 | 274 |
| 60 | 3300026089 | Ga0207648_10097468 | Ga0207648_100974682 | 274 |
| 61 | 3300026121 | Ga0207683_10012407 | Ga0207683_100124074 | 274 |
| 62 | 3300028381 | Ga0268264_10044600 | Ga0268264_100446003 | 274 |
| 63 | 3300028800 | Ga0265338_10179904 | Ga0265338_101799042 | 274 |
| 64 | 3300031241 | Ga0265325_10002832 | Ga0265325_100028322 | 274 |
| 65 | 3300031344 | Ga0265316_10047545 | Ga0265316_100475452 | 274 |
| 66 | 3300031595 | Ga0265313_10001337 | Ga0265313_100013376 | 274 |
| 67 | 3300031711 | Ga0265314_10096173 | Ga0265314_100961732 | 274 |
| 68 | 3300031712 | Ga0265342_10022314 | Ga0265342_100223144 | 274 |
| 69 | 3300049570 | Ga0501033_0014336 | Ga0501033_0014336_1485_2309 | 274 |
| 70 | 3300049570 | Ga0501033_0070966 | Ga0501033_0070966_1002_1826 | 274 |
| 71 | 3300049570 | Ga0501033_0115405 | Ga0501033_0115405_683_1507 | 274 |
| 72 | 3300049574 | Ga0501038_0229731 | Ga0501038_0229731_189_1013 | 274 |
| 73 | 3300049580 | Ga0501046_0188557 | Ga0501046_0188557_473_1297 | 274 |
| 74 | 3300049581 | Ga0501047_0097680 | Ga0501047_0097680_1117_1941 | 274 |
| 75 | 3300049581 | Ga0501047_0183202 | Ga0501047_0183202_762_1586 | 274 |
| 76 | 3300049589 | Ga0501073_0043797 | Ga0501073_0043797_2270_3094 | 274 |
| 77 | 3300049742 | Ga0501080_0733565 | Ga0501080_0733565_25_849 | 274 |
| 78 | 3300049822 | Ga0501035_0008982 | Ga0501035_0008982_3177_4001 | 274 |
| 79 | 3300049823 | Ga0501044_0044605 | Ga0501044_0044605_1196_2020 | 274 |
| 80 | 3300049823 | Ga0501044_0049305 | Ga0501044_0049305_2793_3617 | 274 |
| 81 | 3300053119 | Ga0500595_001244 | Ga0500595_001244_6005_6865 | 274 |
| 82 | 3300053136 | Ga0500559_0031449 | Ga0500559_0031449_424_1248 | 274 |
| 83 | 3300003214 | JGI25165J46597_1000047 | JGI25165J46597_1000047168 | 275 |
| 84 | 3300003214 | JGI25165J46597_1000066 | JGI25165J46597_1000066159 | 275 |
| 85 | 3300005327 | Ga0070658_10125064 | Ga0070658_101250642 | 275 |
| 86 | 3300005335 | Ga0070666_10102907 | Ga0070666_101029072 | 275 |
| 87 | 3300005336 | Ga0070680_100018524 | Ga0070680_1000185245 | 275 |
| 88 | 3300005336 | Ga0070680_100091385 | Ga0070680_1000913852 | 275 |
| 89 | 3300005338 | Ga0068868_100060641 | Ga0068868_1000606411 | 275 |
| 90 | 3300005344 | Ga0070661_100137762 | Ga0070661_1001377622 | 275 |
| 91 | 3300005344 | Ga0070661_100593519 | Ga0070661_1005935191 | 275 |
| 92 | 3300005364 | Ga0070673_100312338 | Ga0070673_1003123382 | 275 |
| 93 | 3300005456 | Ga0070678_100172051 | Ga0070678_1001720512 | 275 |
| 94 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001926 | 275 |
| 95 | 3300005458 | Ga0070681_10185648 | Ga0070681_101856482 | 275 |
| 96 | 3300005459 | Ga0068867_100046788 | Ga0068867_1000467883 | 275 |
| 97 | 3300005530 | Ga0070679_100004777 | Ga0070679_10000477714 | 275 |
| 98 | 3300005530 | Ga0070679_100050876 | Ga0070679_1000508763 | 275 |
| 99 | 3300005530 | Ga0070679_100555678 | Ga0070679_1005556781 | 275 |
| 100 | 3300005543 | Ga0070672_100326417 | Ga0070672_1003264172 | 275 |
| 101 | 3300005548 | Ga0070665_100000685 | Ga0070665_10000068533 | 275 |
| 102 | 3300005548 | Ga0070665_100016071 | Ga0070665_1000160714 | 275 |
| 103 | 3300005548 | Ga0070665_100035650 | Ga0070665_1000356502 | 275 |
| 104 | 3300005548 | Ga0070665_100175870 | Ga0070665_1001758702 | 275 |
| 105 | 3300005548 | Ga0070665_100314306 | Ga0070665_1003143061 | 275 |
| 106 | 3300005563 | Ga0068855_100000034 | Ga0068855_10000003455 | 275 |
| 107 | 3300005563 | Ga0068855_100019580 | Ga0068855_1000195807 | 275 |
| 108 | 3300005563 | Ga0068855_100410599 | Ga0068855_1004105991 | 275 |
| 109 | 3300005577 | Ga0068857_100048884 | Ga0068857_1000488842 | 275 |
| 110 | 3300005614 | Ga0068856_100079853 | Ga0068856_1000798532 | 275 |
| 111 | 3300005614 | Ga0068856_100203544 | Ga0068856_1002035442 | 275 |
| 112 | 3300005616 | Ga0068852_100320993 | Ga0068852_1003209932 | 275 |
| 113 | 3300005718 | Ga0068866_10082935 | Ga0068866_100829352 | 275 |
| 114 | 3300005719 | Ga0068861_100168403 | Ga0068861_1001684032 | 275 |
| 115 | 3300005841 | Ga0068863_100307403 | Ga0068863_1003074032 | 275 |
| 116 | 3300005843 | Ga0068860_100160057 | Ga0068860_1001600572 | 275 |
| 117 | 3300006237 | Ga0097621_100000164 | Ga0097621_10000016412 | 275 |
| 118 | 3300006358 | Ga0068871_100033487 | Ga0068871_1000334874 | 275 |
| 119 | 3300006358 | Ga0068871_100203090 | Ga0068871_1002030902 | 275 |
| 120 | 3300006358 | Ga0068871_100212394 | Ga0068871_1002123942 | 275 |
| 121 | 3300006358 | Ga0068871_100558155 | Ga0068871_1005581551 | 275 |
| 122 | 3300009093 | Ga0105240_10000596 | Ga0105240_1000059644 | 275 |
| 123 | 3300009093 | Ga0105240_10041751 | Ga0105240_100417514 | 275 |
| 124 | 3300009093 | Ga0105240_10100124 | Ga0105240_101001243 | 275 |
| 125 | 3300009093 | Ga0105240_10159393 | Ga0105240_101593932 | 275 |
| 126 | 3300009093 | Ga0105240_10203418 | Ga0105240_102034181 | 275 |
| 127 | 3300009093 | Ga0105240_10255968 | Ga0105240_102559682 | 275 |
| 128 | 3300009093 | Ga0105240_10815983 | Ga0105240_108159831 | 275 |
| 129 | 3300009098 | Ga0105245_10022725 | Ga0105245_100227252 | 275 |
| 130 | 3300009098 | Ga0105245_10072923 | Ga0105245_100729232 | 275 |
| 131 | 3300009101 | Ga0105247_10050900 | Ga0105247_100509002 | 275 |
| 132 | 3300009148 | Ga0105243_10001795 | Ga0105243_1000179516 | 275 |
| 133 | 3300009174 | Ga0105241_10344332 | Ga0105241_103443322 | 275 |
| 134 | 3300009176 | Ga0105242_10011760 | Ga0105242_100117602 | 275 |
| 135 | 3300009176 | Ga0105242_10448432 | Ga0105242_104484321 | 275 |
| 136 | 3300009177 | Ga0105248_10000001 | Ga0105248_10000001557 | 275 |
| 137 | 3300009177 | Ga0105248_10039580 | Ga0105248_100395804 | 275 |
| 138 | 3300009545 | Ga0105237_10395993 | Ga0105237_103959932 | 275 |
| 139 | 3300009551 | Ga0105238_10178659 | Ga0105238_101786592 | 275 |
| 140 | 3300010375 | Ga0105239_10451551 | Ga0105239_104515512 | 275 |
| 141 | 3300011119 | Ga0105246_10025650 | Ga0105246_100256502 | 275 |
| 142 | 3300013105 | Ga0157369_10284659 | Ga0157369_102846591 | 275 |
| 143 | 3300013105 | Ga0157369_10432775 | Ga0157369_104327752 | 275 |
| 144 | 3300013296 | Ga0157374_10192494 | Ga0157374_101924942 | 275 |
| 145 | 3300014968 | Ga0157379_10008649 | Ga0157379_100086498 | 275 |
| 146 | 3300014968 | Ga0157379_10091631 | Ga0157379_100916312 | 275 |
| 147 | 3300021384 | Ga0213876_10009484 | Ga0213876_100094844 | 275 |
| 148 | 3300025261 | Ga0209233_1000045 | Ga0209233_1000045275 | 275 |
| 149 | 3300025261 | Ga0209233_1018508 | Ga0209233_10185082 | 275 |
| 150 | 3300025297 | Ga0209758_1000008 | Ga0209758_10000081009 | 275 |
| 151 | 3300025901 | Ga0207688_10027705 | Ga0207688_100277052 | 275 |
| 152 | 3300025901 | Ga0207688_10297518 | Ga0207688_102975182 | 275 |
| 153 | 3300025903 | Ga0207680_10260986 | Ga0207680_102609862 | 275 |
| 154 | 3300025904 | Ga0207647_10182365 | Ga0207647_101823652 | 275 |
| 155 | 3300025909 | Ga0207705_10005288 | Ga0207705_1000528813 | 275 |
| 156 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001605 | 275 |
| 157 | 3300025913 | Ga0207695_10000004 | Ga0207695_100000041034 | 275 |
| 158 | 3300025913 | Ga0207695_10059683 | Ga0207695_100596832 | 275 |
| 159 | 3300025913 | Ga0207695_10123192 | Ga0207695_101231922 | 275 |
| 160 | 3300025913 | Ga0207695_10207208 | Ga0207695_102072082 | 275 |
| 161 | 3300025913 | Ga0207695_10218895 | Ga0207695_102188952 | 275 |
| 162 | 3300025913 | Ga0207695_10415838 | Ga0207695_104158381 | 275 |
| 163 | 3300025914 | Ga0207671_10015696 | Ga0207671_100156962 | 275 |
| 164 | 3300025914 | Ga0207671_10268185 | Ga0207671_102681852 | 275 |
| 165 | 3300025916 | Ga0207663_10144908 | Ga0207663_101449082 | 275 |
| 166 | 3300025917 | Ga0207660_10003699 | Ga0207660_100036993 | 275 |
| 167 | 3300025917 | Ga0207660_10073081 | Ga0207660_100730812 | 275 |
| 168 | 3300025917 | Ga0207660_10271429 | Ga0207660_102714291 | 275 |
| 169 | 3300025919 | Ga0207657_10052225 | Ga0207657_100522252 | 275 |
| 170 | 3300025921 | Ga0207652_10000506 | Ga0207652_1000050630 | 275 |
| 171 | 3300025921 | Ga0207652_10069987 | Ga0207652_100699872 | 275 |
| 172 | 3300025921 | Ga0207652_10101581 | Ga0207652_101015812 | 275 |
| 173 | 3300025921 | Ga0207652_10171121 | Ga0207652_101711212 | 275 |
| 174 | 3300025924 | Ga0207694_10010519 | Ga0207694_100105195 | 275 |
| 175 | 3300025924 | Ga0207694_10118011 | Ga0207694_101180112 | 275 |
| 176 | 3300025924 | Ga0207694_10145562 | Ga0207694_101455622 | 275 |
| 177 | 3300025924 | Ga0207694_10351400 | Ga0207694_103514002 | 275 |
| 178 | 3300025925 | Ga0207650_10275034 | Ga0207650_102750342 | 275 |
| 179 | 3300025927 | Ga0207687_10005387 | Ga0207687_100053875 | 275 |
| 180 | 3300025927 | Ga0207687_10114230 | Ga0207687_101142302 | 275 |
| 181 | 3300025928 | Ga0207700_10445201 | Ga0207700_104452011 | 275 |
| 182 | 3300025933 | Ga0207706_10251906 | Ga0207706_102519062 | 275 |
| 183 | 3300025934 | Ga0207686_10141681 | Ga0207686_101416812 | 275 |
| 184 | 3300025935 | Ga0207709_10007529 | Ga0207709_100075292 | 275 |
| 185 | 3300025941 | Ga0207711_10000001 | Ga0207711_100000011313 | 275 |
| 186 | 3300025941 | Ga0207711_10064282 | Ga0207711_100642821 | 275 |
| 187 | 3300025942 | Ga0207689_10365420 | Ga0207689_103654202 | 275 |
| 188 | 3300025944 | Ga0207661_10005016 | Ga0207661_100050162 | 275 |
| 189 | 3300025944 | Ga0207661_10200998 | Ga0207661_102009982 | 275 |
| 190 | 3300025949 | Ga0207667_10000065 | Ga0207667_10000065155 | 275 |
| 191 | 3300025949 | Ga0207667_10301803 | Ga0207667_103018032 | 275 |
| 192 | 3300025961 | Ga0207712_10173858 | Ga0207712_101738582 | 275 |
| 193 | 3300025981 | Ga0207640_10160393 | Ga0207640_101603932 | 275 |
| 194 | 3300026023 | Ga0207677_10061793 | Ga0207677_100617932 | 275 |
| 195 | 3300026023 | Ga0207677_10195966 | Ga0207677_101959662 | 275 |
| 196 | 3300026078 | Ga0207702_10052163 | Ga0207702_100521632 | 275 |
| 197 | 3300026089 | Ga0207648_10063049 | Ga0207648_100630492 | 275 |
| 198 | 3300026089 | Ga0207648_10167898 | Ga0207648_101678982 | 275 |
| 199 | 3300026116 | Ga0207674_10041437 | Ga0207674_100414374 | 275 |
| 200 | 3300026116 | Ga0207674_10097655 | Ga0207674_100976552 | 275 |
| 201 | 3300026116 | Ga0207674_10106788 | Ga0207674_101067883 | 275 |
| 202 | 3300026118 | Ga0207675_100076876 | Ga0207675_1000768762 | 275 |
| 203 | 3300026121 | Ga0207683_10207349 | Ga0207683_102073492 | 275 |
| 204 | 3300026121 | Ga0207683_10446221 | Ga0207683_104462212 | 275 |
| 205 | 3300026142 | Ga0207698_10005150 | Ga0207698_100051508 | 275 |
| 206 | 3300026142 | Ga0207698_10240437 | Ga0207698_102404372 | 275 |
| 207 | 3300028379 | Ga0268266_10000329 | Ga0268266_1000032937 | 275 |
| 208 | 3300028379 | Ga0268266_10015934 | Ga0268266_100159342 | 275 |
| 209 | 3300028379 | Ga0268266_10016602 | Ga0268266_100166022 | 275 |
| 210 | 3300028379 | Ga0268266_10270070 | Ga0268266_102700702 | 275 |
| 211 | 3300028380 | Ga0268265_10314560 | Ga0268265_103145602 | 275 |
| 212 | 3300028381 | Ga0268264_10191390 | Ga0268264_101913902 | 275 |
| 213 | 3300028573 | Ga0265334_10014788 | Ga0265334_100147883 | 275 |
| 214 | 3300028800 | Ga0265338_10000006 | Ga0265338_10000006155 | 275 |
| 215 | 3300028800 | Ga0265338_10007645 | Ga0265338_1000764511 | 275 |
| 216 | 3300031238 | Ga0265332_10010364 | Ga0265332_100103642 | 275 |
| 217 | 3300031238 | Ga0265332_10155088 | Ga0265332_101550881 | 275 |
| 218 | 3300031239 | Ga0265328_10059753 | Ga0265328_100597532 | 275 |
| 219 | 3300031240 | Ga0265320_10000039 | Ga0265320_1000003980 | 275 |
| 220 | 3300031241 | Ga0265325_10000007 | Ga0265325_10000007155 | 275 |
| 221 | 3300031241 | Ga0265325_10001182 | Ga0265325_1000118217 | 275 |
| 222 | 3300031247 | Ga0265340_10006735 | Ga0265340_100067358 | 275 |
| 223 | 3300031247 | Ga0265340_10051667 | Ga0265340_100516672 | 275 |
| 224 | 3300031247 | Ga0265340_10069755 | Ga0265340_100697552 | 275 |
| 225 | 3300031247 | Ga0265340_10095343 | Ga0265340_100953432 | 275 |
| 226 | 3300031249 | Ga0265339_10005068 | Ga0265339_100050682 | 275 |
| 227 | 3300031249 | Ga0265339_10050408 | Ga0265339_100504082 | 275 |
| 228 | 3300031250 | Ga0265331_10004152 | Ga0265331_100041525 | 275 |
| 229 | 3300031250 | Ga0265331_10031678 | Ga0265331_100316782 | 275 |
| 230 | 3300031344 | Ga0265316_10131700 | Ga0265316_101317002 | 275 |
| 231 | 3300031344 | Ga0265316_10252479 | Ga0265316_102524792 | 275 |
| 232 | 3300031595 | Ga0265313_10004411 | Ga0265313_100044112 | 275 |
| 233 | 3300031711 | Ga0265314_10000193 | Ga0265314_1000019356 | 275 |
| 234 | 3300031711 | Ga0265314_10019097 | Ga0265314_100190973 | 275 |
| 235 | 3300031711 | Ga0265314_10131783 | Ga0265314_101317832 | 275 |
| 236 | 3300031711 | Ga0265314_10265352 | Ga0265314_102653521 | 275 |
| 237 | 3300031712 | Ga0265342_10002997 | Ga0265342_100029976 | 275 |
| 238 | 3300031730 | Ga0307516_10045601 | Ga0307516_100456012 | 275 |
| 239 | 3300031730 | Ga0307516_10047329 | Ga0307516_100473292 | 275 |
| 240 | 3300035113 | Ga0373936_0103476 | Ga0373936_0103476_235_1071 | 275 |
| 241 | 3300035170 | Ga0373943_0000736 | Ga0373943_0000736_6087_6923 | 275 |
| 242 | 3300035171 | Ga0373946_0095182 | Ga0373946_0095182_462_1298 | 275 |
| 243 | 3300035692 | Ga0373935_0083053 | Ga0373935_0083053_609_1445 | 275 |
| 244 | 3300036401 | Ga0373937_0145411 | Ga0373937_0145411_788_1624 | 275 |
| 245 | 3300037068 | Ga0373925_0012402 | Ga0373925_0012402_2632_3468 | 275 |
| 246 | 3300037312 | Ga0395899_0180426 | Ga0395899_0180426_594_1424 | 275 |
| 247 | 3300037418 | Ga0395900_0034844 | Ga0395900_0034844_4248_5078 | 275 |
| 248 | 3300037466 | Ga0395898_0515982 | Ga0395898_0515982_109_939 | 275 |
| 249 | 3300038443 | Ga0395901_0670938 | Ga0395901_0670938_111_941 | 275 |
| 250 | 3300039437 | Ga0436365_0148064 | Ga0436365_0148064_861_1688 | 275 |
| 251 | 3300039437 | Ga0436365_1376305 | Ga0436365_1376305_3903_4733 | 275 |
| 252 | 3300041456 | Ga0451795_0608028 | Ga0451795_0608028_233_1060 | 275 |
| 253 | 3300046472 | Ga0495580_0014039 | Ga0495580_0014039_3359_4195 | 275 |
| 254 | 3300046473 | Ga0495582_0110219 | Ga0495582_0110219_545_1381 | 275 |
| 255 | 3300046507 | Ga0495606_0120525 | Ga0495606_0120525_732_1559 | 275 |
| 256 | 3300046536 | Ga0495587_0030113 | Ga0495587_0030113_270_1103 | 275 |
| 257 | 3300046539 | Ga0495621_0022149 | Ga0495621_0022149_1007_1834 | 275 |
| 258 | 3300046543 | Ga0495645_0027780 | Ga0495645_0027780_1151_1984 | 275 |
| 259 | 3300046557 | Ga0495622_0001870 | Ga0495622_0001870_7118_7945 | 275 |
| 260 | 3300046683 | Ga0495658_0004729 | Ga0495658_0004729_2544_3380 | 275 |
| 261 | 3300046689 | Ga0495613_0068020 | Ga0495613_0068020_661_1497 | 275 |
| 262 | 3300046692 | Ga0495671_0162620 | Ga0495671_0162620_42_869 | 275 |
| 263 | 3300047318 | Ga0495636_0044164 | Ga0495636_0044164_633_1460 | 275 |
| 264 | 3300047319 | Ga0495674_0088171 | Ga0495674_0088171_1679_2515 | 275 |
| 265 | 3300048929 | Ga0496126_0148226 | Ga0496126_0148226_573_1436 | 275 |
| 266 | 3300049460 | Ga0495682_0000512 | Ga0495682_0000512_14356_15189 | 275 |
| 267 | 3300049571 | Ga0501034_0025010 | Ga0501034_0025010_173_1006 | 275 |
| 268 | 3300049571 | Ga0501034_0159076 | Ga0501034_0159076_1346_2179 | 275 |
| 269 | 3300049572 | Ga0501036_0022180 | Ga0501036_0022180_1641_2474 | 275 |
| 270 | 3300049579 | Ga0501043_0075794 | Ga0501043_0075794_583_1416 | 275 |
| 271 | 3300049579 | Ga0501043_0333071 | Ga0501043_0333071_150_977 | 275 |
| 272 | 3300049581 | Ga0501047_0001999 | Ga0501047_0001999_2166_2999 | 275 |
| 273 | 3300049581 | Ga0501047_0057984 | Ga0501047_0057984_1707_2540 | 275 |
| 274 | 3300049581 | Ga0501047_0211409 | Ga0501047_0211409_245_1072 | 275 |
| 275 | 3300049581 | Ga0501047_0242073 | Ga0501047_0242073_684_1517 | 275 |
| 276 | 3300049581 | Ga0501047_0396610 | Ga0501047_0396610_115_942 | 275 |
| 277 | 3300049583 | Ga0501067_0007491 | Ga0501067_0007491_3356_4189 | 275 |
| 278 | 3300049583 | Ga0501067_0048067 | Ga0501067_0048067_930_1763 | 275 |
| 279 | 3300049585 | Ga0501069_0001549 | Ga0501069_0001549_8149_8982 | 275 |
| 280 | 3300049586 | Ga0501070_0003820 | Ga0501070_0003820_9752_10585 | 275 |
| 281 | 3300049586 | Ga0501070_0222268 | Ga0501070_0222268_569_1402 | 275 |
| 282 | 3300049588 | Ga0501072_0030732 | Ga0501072_0030732_1183_2016 | 275 |
| 283 | 3300049589 | Ga0501073_0019392 | Ga0501073_0019392_1888_2721 | 275 |
| 284 | 3300049589 | Ga0501073_0026986 | Ga0501073_0026986_1326_2159 | 275 |
| 285 | 3300049590 | Ga0501074_0140196 | Ga0501074_0140196_364_1197 | 275 |
| 286 | 3300049590 | Ga0501074_0142432 | Ga0501074_0142432_481_1314 | 275 |
| 287 | 3300049741 | Ga0501079_0020826 | Ga0501079_0020826_2871_3704 | 275 |
| 288 | 3300049741 | Ga0501079_0121400 | Ga0501079_0121400_390_1223 | 275 |
| 289 | 3300049742 | Ga0501080_0015583 | Ga0501080_0015583_2388_3221 | 275 |
| 290 | 3300049742 | Ga0501080_0078808 | Ga0501080_0078808_2090_2923 | 275 |
| 291 | 3300049742 | Ga0501080_0243072 | Ga0501080_0243072_265_1098 | 275 |
| 292 | 3300049742 | Ga0501080_0351872 | Ga0501080_0351872_135_968 | 275 |
| 293 | 3300049742 | Ga0501080_0609252 | Ga0501080_0609252_41_871 | 275 |
| 294 | 3300049744 | Ga0501083_0100978 | Ga0501083_0100978_818_1651 | 275 |
| 295 | 3300049822 | Ga0501035_0037701 | Ga0501035_0037701_2350_3183 | 275 |
| 296 | 3300049823 | Ga0501044_0013241 | Ga0501044_0013241_7959_8792 | 275 |
| 297 | 3300049823 | Ga0501044_0089074 | Ga0501044_0089074_368_1198 | 275 |
| 298 | 3300053087 | Ga0500643_000006 | Ga0500643_000006_12399_13262 | 275 |
| 299 | 3300053090 | Ga0500646_0011716 | Ga0500646_0011716_76_939 | 275 |
| 300 | 3300053119 | Ga0500595_005425 | Ga0500595_005425_2888_3715 | 275 |
| 301 | 3300053133 | Ga0500655_000866 | Ga0500655_000866_4973_5806 | 275 |
| 302 | 3300053133 | Ga0500655_013884 | Ga0500655_013884_93_926 | 275 |
| 303 | 3300053139 | Ga0500568_0023291 | Ga0500568_0023291_420_1283 | 275 |
| 304 | 3300053140 | Ga0500573_0000520 | Ga0500573_0000520_10591_11418 | 275 |
| 305 | 3300054114 | Ga0501084_0058112 | Ga0501084_0058112_1722_2555 | 275 |
| 306 | 3300060353 | Ga0501082_0095886 | Ga0501082_0095886_850_1683 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.9295 | 1 | 268 |
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.9236 | 2 | 267 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.9037 | 1 | 268 |
| 1gqz-assembly1.cif.gz_A | refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a | 0.8985 | 3 | 271 |
| 5ha4-assembly1.cif.gz_A | structure of a diaminopimelate epimerase from acinetobacter baumannii | 0.8974 | 2 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9938 | 146 | 258 | 3.10.310.10 |
| af_C6T990_209_343_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9744 | 137 | 255 | 3.10.310.10 |
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.96 | 146 | 258 | 3.10.310.10 |
| 2gkjA02 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9518 | 116 | 260 | 3.10.310.10 |
| af_I1NA10_49_204_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9252 | 1 | 127 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I5RI59-F1-model_v4 | Diaminopimelate epimerase | 0.9893 | 178 | 270 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A4Q3Z9W9-F1-model_v4 | Diaminopimelate epimerase | 0.9889 | 156 | 264 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A1V5LJV3-F1-model_v4 | Diaminopimelate epimerase (EC 5.1.1.7) | 0.9882 | 137 | 271 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-R6SI18-F1-model_v4 | deleted | 0.9833 | 149 | 271 |
|
| AF-A0A382HQ33-F1-model_v4 | Diaminopimelate epimerase | 0.9833 | 148 | 271 |
GO:0005829
GO:0008837 GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar