F398744

General Info

Members Datasets Scaffolds Average Seq Length
306 164 306 277

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10086846|Ga0307516_100868462
Length 273
Sequence MTAFVKMHGLGNDFVVFDARDTAVSLDAAKAKAIADRHFGVGCDTVVLIQPGGAKADAGLLFYNADGSEAEACFNATRCVARLLLDERGLARVKLSTKADILTCSDAGGKMVTLDAGSPKLDWREIPLAKNVDTADFPLDIGGLSASAVSMGNPHCVLFVPDAQAAPVTQLGPKIETLPLFPNRTNVEFAQVLNRERIRMRVWERGVGVTLACGTGACATAVAAIRRGLVGRKVELVLDGGSLTIEWREEDGHILMTGPTAMPFRGRLELDKL

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
119 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
159 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 0.65
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000047 3300003214 Bacteria 254601
2 JGI25165J46597_1000066 3300003214 Bacteria 199459
3 Ga0070658_10125064 3300005327 Bacteria 2140
4 Ga0070658_10428992 3300005327 Bacteria 1138
5 Ga0070676_10190101 3300005328 Bacteria 1340
6 Ga0070683_100115103 3300005329 Bacteria 2538
7 Ga0070666_10005142 3300005335 Bacteria 8009
8 Ga0070666_10102907 3300005335 Bacteria 1970
9 Ga0070680_100018524 3300005336 Bacteria 5503
10 Ga0070680_100091385 3300005336 Bacteria 2520
11 Ga0068868_100060641 3300005338 Bacteria 2996
12 Ga0068868_100201206 3300005338 Bacteria 1661
13 Ga0070661_100137762 3300005344 Bacteria 1838
14 Ga0070661_100593519 3300005344 Bacteria 895
15 Ga0070673_100312338 3300005364 Bacteria 1387
16 Ga0070678_100172051 3300005456 Bacteria 1765
17 Ga0070681_10000001 3300005458 Bacteria 946857
18 Ga0070681_10185648 3300005458 Bacteria 2000
19 Ga0068867_100046788 3300005459 Bacteria 3179
20 Ga0070679_100004777 3300005530 Bacteria 12494
21 Ga0070679_100050876 3300005530 Bacteria 4127
22 Ga0070679_100555678 3300005530 Bacteria 1092
23 Ga0070672_100326417 3300005543 Bacteria 1305
24 Ga0070665_100000685 3300005548 Bacteria 45385
25 Ga0070665_100016071 3300005548 Bacteria 7510
26 Ga0070665_100035650 3300005548 Bacteria 5003
27 Ga0070665_100175870 3300005548 Bacteria 2141
28 Ga0070665_100314306 3300005548 Bacteria 1570
29 Ga0068855_100000034 3300005563 Bacteria 166436
30 Ga0068855_100019580 3300005563 Bacteria 8128
31 Ga0068855_100410599 3300005563 Bacteria 1482
32 Ga0068857_100048884 3300005577 Bacteria 3752
33 Ga0068856_100079853 3300005614 Bacteria 3244
34 Ga0068856_100203544 3300005614 Bacteria 1994
35 Ga0068852_100320993 3300005616 Bacteria 1504
36 Ga0068859_100491339 3300005617 Bacteria 1323
37 Ga0068866_10082935 3300005718 Bacteria 1726
38 Ga0068861_100168403 3300005719 Bacteria 1814
39 Ga0068863_100307403 3300005841 Bacteria 1538
40 Ga0068858_100191052 3300005842 Bacteria 1935
41 Ga0068860_100064722 3300005843 Bacteria 3473
42 Ga0068860_100160057 3300005843 Bacteria 2171
43 Ga0081455_10151428 3300005937 Bacteria 1788
44 Ga0097621_100000164 3300006237 Bacteria 41441
45 Ga0068871_100012735 3300006358 Bacteria 6218
46 Ga0068871_100033487 3300006358 Bacteria 4069
47 Ga0068871_100040423 3300006358 Bacteria 3735
48 Ga0068871_100203090 3300006358 Bacteria 1712
49 Ga0068871_100212394 3300006358 Bacteria 1674
50 Ga0068871_100558155 3300006358 Bacteria 1038
51 Ga0097620_100491322 3300006931 Bacteria 1323
52 Ga0105240_10000596 3300009093 Bacteria 67093
53 Ga0105240_10041751 3300009093 Bacteria 5850
54 Ga0105240_10100124 3300009093 Bacteria 3527
55 Ga0105240_10159393 3300009093 Bacteria 2682
56 Ga0105240_10203418 3300009093 Bacteria 2319
57 Ga0105240_10255968 3300009093 Bacteria 2022
58 Ga0105240_10815983 3300009093 Bacteria 1009
59 Ga0105245_10022725 3300009098 Bacteria 5504
60 Ga0105245_10072923 3300009098 Bacteria 3120
61 Ga0105247_10050900 3300009101 Bacteria 2549
62 Ga0105243_10001795 3300009148 Bacteria 18418
63 Ga0105241_10008211 3300009174 Bacteria 7685
64 Ga0105241_10344332 3300009174 Bacteria 1292
65 Ga0105242_10011760 3300009176 Bacteria 6733
66 Ga0105242_10448432 3300009176 Bacteria 1216
67 Ga0105248_10000001 3300009177 Bacteria 1881304
68 Ga0105248_10039580 3300009177 Bacteria 5282
69 Ga0105237_10395993 3300009545 Bacteria 1386
70 Ga0105238_10178659 3300009551 Bacteria 2099
71 Ga0105239_10210779 3300010375 Bacteria 2178
72 Ga0105239_10451551 3300010375 Bacteria 1458
73 Ga0105246_10025650 3300011119 Bacteria 3844
74 Ga0105246_10068176 3300011119 Bacteria 2494
75 Ga0157369_10284659 3300013105 Bacteria 1721
76 Ga0157369_10432775 3300013105 Bacteria 1363
77 Ga0157374_10101236 3300013296 Bacteria 2763
78 Ga0157374_10192494 3300013296 Bacteria 1995
79 Ga0157378_10135158 3300013297 Bacteria 2286
80 Ga0163162_10187426 3300013306 Bacteria 2196
81 Ga0157375_10041600 3300013308 Bacteria 4439
82 Ga0163163_10000252 3300014325 Bacteria 54262
83 Ga0163163_10092151 3300014325 Bacteria 3045
84 Ga0157379_10004078 3300014968 Bacteria 12458
85 Ga0157379_10008649 3300014968 Bacteria 8865
86 Ga0157379_10091631 3300014968 Bacteria 2726
87 Ga0157376_10061349 3300014969 Bacteria 3161
88 Ga0163161_10014965 3300017792 Bacteria 5404
89 Ga0213876_10009484 3300021384 Bacteria 5236
90 Ga0209233_1000045 3300025261 Bacteria 473379
91 Ga0209233_1018508 3300025261 Bacteria 1873
92 Ga0209758_1000008 3300025297 Bacteria 1215263
93 Ga0207688_10027705 3300025901 Bacteria 3116
94 Ga0207688_10297518 3300025901 Bacteria 986
95 Ga0207680_10260986 3300025903 Bacteria 1199
96 Ga0207647_10182365 3300025904 Bacteria 1219
97 Ga0207705_10005288 3300025909 Bacteria 9657
98 Ga0207654_10017805 3300025911 Bacteria 3721
99 Ga0207707_10000001 3300025912 Bacteria 1212482
100 Ga0207695_10000004 3300025913 Bacteria 1288665
101 Ga0207695_10059683 3300025913 Bacteria 3953
102 Ga0207695_10123192 3300025913 Bacteria 2558
103 Ga0207695_10207208 3300025913 Bacteria 1873
104 Ga0207695_10218895 3300025913 Bacteria 1812
105 Ga0207695_10415838 3300025913 Bacteria 1229
106 Ga0207671_10015696 3300025914 Bacteria 5920
107 Ga0207671_10121562 3300025914 Bacteria 1996
108 Ga0207671_10268185 3300025914 Bacteria 1345
109 Ga0207663_10144908 3300025916 Bacteria 1659
110 Ga0207660_10003699 3300025917 Bacteria 9964
111 Ga0207660_10073081 3300025917 Bacteria 2499
112 Ga0207660_10271429 3300025917 Bacteria 1344
113 Ga0207657_10052225 3300025919 Bacteria 3548
114 Ga0207652_10000506 3300025921 Bacteria 39607
115 Ga0207652_10069987 3300025921 Bacteria 3047
116 Ga0207652_10101581 3300025921 Bacteria 2540
117 Ga0207652_10171121 3300025921 Bacteria 1949
118 Ga0207694_10010519 3300025924 Bacteria 6979
119 Ga0207694_10118011 3300025924 Bacteria 2116
120 Ga0207694_10145562 3300025924 Bacteria 1907
121 Ga0207694_10351400 3300025924 Bacteria 1220
122 Ga0207650_10275034 3300025925 Bacteria 1370
123 Ga0207687_10005387 3300025927 Bacteria 8460
124 Ga0207687_10114230 3300025927 Bacteria 2009
125 Ga0207700_10445201 3300025928 Bacteria 1141
126 Ga0207706_10251906 3300025933 Bacteria 1542
127 Ga0207686_10141681 3300025934 Bacteria 1663
128 Ga0207709_10007529 3300025935 Bacteria 6052
129 Ga0207711_10000001 3300025941 Bacteria 1325674
130 Ga0207711_10064282 3300025941 Bacteria 3169
131 Ga0207689_10365420 3300025942 Bacteria 1200
132 Ga0207661_10005016 3300025944 Bacteria 9281
133 Ga0207661_10200998 3300025944 Bacteria 1752
134 Ga0207667_10000065 3300025949 Bacteria 186655
135 Ga0207667_10301803 3300025949 Bacteria 1636
136 Ga0207712_10173858 3300025961 Bacteria 1686
137 Ga0207640_10160393 3300025981 Bacteria 1663
138 Ga0207658_10068594 3300025986 Bacteria 2676
139 Ga0207677_10061793 3300026023 Bacteria 2596
140 Ga0207677_10195966 3300026023 Bacteria 1602
141 Ga0207703_10101454 3300026035 Bacteria 2440
142 Ga0207702_10052163 3300026078 Bacteria 3460
143 Ga0207641_10174814 3300026088 Bacteria 1963
144 Ga0207648_10063049 3300026089 Bacteria 3231
145 Ga0207648_10097468 3300026089 Bacteria 2573
146 Ga0207648_10167898 3300026089 Bacteria 1939
147 Ga0207674_10041437 3300026116 Bacteria 4763
148 Ga0207674_10097655 3300026116 Bacteria 2921
149 Ga0207674_10106788 3300026116 Bacteria 2777
150 Ga0207675_100076876 3300026118 Bacteria 3126
151 Ga0207683_10012407 3300026121 Bacteria 7271
152 Ga0207683_10207349 3300026121 Bacteria 1783
153 Ga0207683_10446221 3300026121 Bacteria 1192
154 Ga0207698_10005150 3300026142 Bacteria 8039
155 Ga0207698_10240437 3300026142 Bacteria 1650
156 Ga0268266_10000329 3300028379 Bacteria 74608
157 Ga0268266_10015934 3300028379 Bacteria 6431
158 Ga0268266_10016602 3300028379 Bacteria 6291
159 Ga0268266_10270070 3300028379 Bacteria 1578
160 Ga0268265_10314560 3300028380 Bacteria 1415
161 Ga0268264_10044600 3300028381 Bacteria 3679
162 Ga0268264_10191390 3300028381 Bacteria 1865
163 Ga0265334_10014788 3300028573 Bacteria 3249
164 Ga0265318_10004889 3300028577 Bacteria 6396
165 Ga0265338_10000006 3300028800 Bacteria 570804
166 Ga0265338_10007645 3300028800 Bacteria 13335
167 Ga0265338_10179904 3300028800 Bacteria 1613
168 Ga0265332_10010364 3300031238 Bacteria 4150
169 Ga0265332_10155088 3300031238 Bacteria 957
170 Ga0265328_10059753 3300031239 Bacteria 1399
171 Ga0265320_10000039 3300031240 Bacteria 134478
172 Ga0265325_10000007 3300031241 Bacteria 208874
173 Ga0265325_10001182 3300031241 Bacteria 18613
174 Ga0265325_10002832 3300031241 Bacteria 11567
175 Ga0265340_10006735 3300031247 Bacteria 6292
176 Ga0265340_10051667 3300031247 Bacteria 1990
177 Ga0265340_10069755 3300031247 Bacteria 1668
178 Ga0265340_10095343 3300031247 Bacteria 1387
179 Ga0265339_10005068 3300031249 Bacteria 8848
180 Ga0265339_10050408 3300031249 Bacteria 2277
181 Ga0265331_10004152 3300031250 Bacteria 9078
182 Ga0265331_10031678 3300031250 Bacteria 2626
183 Ga0265331_10117697 3300031250 Bacteria 1215
184 Ga0265316_10047545 3300031344 Bacteria 3394
185 Ga0265316_10131700 3300031344 Bacteria 1883
186 Ga0265316_10252479 3300031344 Bacteria 1294
187 Ga0265313_10001337 3300031595 Bacteria 23225
188 Ga0265313_10001744 3300031595 Bacteria 19971
189 Ga0265313_10004411 3300031595 Bacteria 10847
190 Ga0265313_10010027 3300031595 Bacteria 6063
191 Ga0265314_10000193 3300031711 Bacteria 90595
192 Ga0265314_10019097 3300031711 Bacteria 5319
193 Ga0265314_10019737 3300031711 Bacteria 5214
194 Ga0265314_10096173 3300031711 Bacteria 1916
195 Ga0265314_10131783 3300031711 Bacteria 1558
196 Ga0265314_10265352 3300031711 Bacteria 978
197 Ga0265342_10002997 3300031712 Bacteria 14168
198 Ga0265342_10022314 3300031712 Bacteria 4027
199 Ga0307516_10045601 3300031730 Bacteria 4329
200 Ga0307516_10047329 3300031730 Bacteria 4237
201 Ga0307516_10086846 3300031730 Bacteria 2963
202 Ga0373936_0103476 3300035113 Bacteria 1203
203 Ga0373943_0000736 3300035170 Bacteria 14273
204 Ga0373946_0095182 3300035171 Bacteria 1326
205 Ga0373935_0083053 3300035692 Bacteria 2085
206 Ga0373927_0067466 3300035695 Bacteria 2315
207 Ga0373937_0145411 3300036401 Bacteria 2219
208 Ga0373925_0012402 3300037068 Bacteria 6171
209 Ga0395899_0180426 3300037312 Bacteria 1483
210 Ga0395900_0034844 3300037418 Bacteria 5186
211 Ga0395898_0515982 3300037466 Bacteria 1136
212 Ga0395901_0670938 3300038443 Bacteria 1037
213 Ga0436365_0148064 3300039437 Bacteria 1804
214 Ga0436365_1376305 3300039437 Bacteria 6022
215 Ga0451789_1251644 3300041443 Bacteria 2118
216 Ga0451795_0608028 3300041456 Bacteria 1296
217 Ga0495580_0014039 3300046472 Bacteria 6092
218 Ga0495582_0110219 3300046473 Bacteria 1546
219 Ga0495606_0120525 3300046507 Bacteria 1571
220 Ga0495652_0246365 3300046529 Bacteria 1327
221 Ga0495587_0030113 3300046536 Bacteria 3292
222 Ga0495587_0098797 3300046536 Bacteria 1683
223 Ga0495621_0022149 3300046539 Bacteria 2103
224 Ga0495645_0027780 3300046543 Bacteria 4111
225 Ga0495622_0001870 3300046557 Bacteria 10378
226 Ga0495658_0004729 3300046683 Bacteria 6686
227 Ga0495613_0068020 3300046689 Bacteria 2599
228 Ga0495671_0162620 3300046692 Bacteria 1086
229 Ga0495589_0029508 3300046794 Bacteria 2765
230 Ga0495636_0044164 3300047318 Bacteria 1855
231 Ga0495674_0088171 3300047319 Bacteria 2654
232 Ga0496126_0148226 3300048929 Bacteria 2013
233 Ga0495682_0000512 3300049460 Bacteria 26836
234 Ga0501032_0104383 3300049569 Bacteria 1878
235 Ga0501033_0001777 3300049570 Bacteria 18831
236 Ga0501033_0014336 3300049570 Bacteria 6023
237 Ga0501033_0046829 3300049570 Bacteria 3215
238 Ga0501033_0070966 3300049570 Bacteria 2559
239 Ga0501033_0115405 3300049570 Bacteria 1951
240 Ga0501034_0025010 3300049571 Bacteria 6076
241 Ga0501034_0159076 3300049571 Bacteria 2231
242 Ga0501034_0355755 3300049571 Bacteria 1392
243 Ga0501036_0022180 3300049572 Bacteria 5341
244 Ga0501036_0402679 3300049572 Bacteria 1142
245 Ga0501037_0047064 3300049573 Bacteria 3162
246 Ga0501038_0174135 3300049574 Bacteria 1740
247 Ga0501038_0229731 3300049574 Bacteria 1477
248 Ga0501038_0289130 3300049574 Bacteria 1289
249 Ga0501043_0075794 3300049579 Bacteria 2642
250 Ga0501043_0108784 3300049579 Bacteria 2177
251 Ga0501043_0333071 3300049579 Bacteria 1156
252 Ga0501046_0188557 3300049580 Bacteria 1539
253 Ga0501047_0001999 3300049581 Bacteria 19548
254 Ga0501047_0010610 3300049581 Bacteria 8712
255 Ga0501047_0057984 3300049581 Bacteria 3742
256 Ga0501047_0097680 3300049581 Bacteria 2815
257 Ga0501047_0183202 3300049581 Bacteria 1960
258 Ga0501047_0192931 3300049581 Bacteria 1900
259 Ga0501047_0198571 3300049581 Bacteria 1867
260 Ga0501047_0211409 3300049581 Bacteria 1798
261 Ga0501047_0242073 3300049581 Bacteria 1654
262 Ga0501047_0396610 3300049581 Bacteria 1213
263 Ga0501047_0447006 3300049581 Bacteria 1122
264 Ga0501067_0007491 3300049583 Bacteria 6062
265 Ga0501067_0048067 3300049583 Bacteria 2366
266 Ga0501069_0001549 3300049585 Bacteria 11366
267 Ga0501070_0003820 3300049586 Bacteria 13000
268 Ga0501070_0033643 3300049586 Bacteria 4290
269 Ga0501070_0222268 3300049586 Bacteria 1548
270 Ga0501072_0030732 3300049588 Bacteria 4201
271 Ga0501073_0019392 3300049589 Bacteria 4910
272 Ga0501073_0026986 3300049589 Bacteria 4110
273 Ga0501073_0043797 3300049589 Bacteria 3156
274 Ga0501074_0140196 3300049590 Bacteria 1730
275 Ga0501074_0142432 3300049590 Bacteria 1714
276 Ga0501079_0020826 3300049741 Bacteria 5014
277 Ga0501079_0121400 3300049741 Bacteria 2032
278 Ga0501080_0015583 3300049742 Bacteria 7010
279 Ga0501080_0078808 3300049742 Bacteria 3063
280 Ga0501080_0243072 3300049742 Bacteria 1642
281 Ga0501080_0308271 3300049742 Bacteria 1435
282 Ga0501080_0351872 3300049742 Bacteria 1330
283 Ga0501080_0609252 3300049742 Bacteria 969
284 Ga0501080_0733565 3300049742 Bacteria 870
285 Ga0501083_0100978 3300049744 Bacteria 1902
286 Ga0501035_0008982 3300049822 Bacteria 9294
287 Ga0501035_0037701 3300049822 Bacteria 4376
288 Ga0501035_0041321 3300049822 Bacteria 4164
289 Ga0501044_0013241 3300049823 Bacteria 8929
290 Ga0501044_0044605 3300049823 Bacteria 4600
291 Ga0501044_0049305 3300049823 Bacteria 4347
292 Ga0501044_0089074 3300049823 Bacteria 3115
293 Ga0501044_0150893 3300049823 Bacteria 2306
294 Ga0501044_0220127 3300049823 Bacteria 1849
295 Ga0501044_0327467 3300049823 Bacteria 1455
296 Ga0500643_000006 3300053087 Bacteria 479605
297 Ga0500646_0011716 3300053090 Bacteria 2258
298 Ga0500595_001244 3300053119 Bacteria 14031
299 Ga0500595_005425 3300053119 Bacteria 5567
300 Ga0500655_000866 3300053133 Bacteria 5876
301 Ga0500655_013884 3300053133 Bacteria 1472
302 Ga0500559_0031449 3300053136 Bacteria 2277
303 Ga0500568_0023291 3300053139 Bacteria 2635
304 Ga0500573_0000520 3300053140 Bacteria 16721
305 Ga0501084_0058112 3300054114 Bacteria 3236
306 Ga0501082_0095886 3300060353 Bacteria 2564

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0289130 Ga0501038_0289130_70_939 260
2 3300049581 Ga0501047_0198571 Ga0501047_0198571_806_1675 260
3 3300049822 Ga0501035_0041321 Ga0501035_0041321_1070_1939 260
4 3300049823 Ga0501044_0150893 Ga0501044_0150893_1028_1897 260
5 3300005842 Ga0068858_100191052 Ga0068858_1001910522 261
6 3300028577 Ga0265318_10004889 Ga0265318_100048892 262
7 3300031250 Ga0265331_10117697 Ga0265331_101176972 262
8 3300031595 Ga0265313_10001744 Ga0265313_1000174413 262
9 3300031595 Ga0265313_10010027 Ga0265313_100100272 262
10 3300031711 Ga0265314_10019737 Ga0265314_100197371 262
11 3300049569 Ga0501032_0104383 Ga0501032_0104383_679_1509 265
12 3300049570 Ga0501033_0046829 Ga0501033_0046829_230_1096 265
13 3300049571 Ga0501034_0355755 Ga0501034_0355755_254_1120 265
14 3300049579 Ga0501043_0108784 Ga0501043_0108784_742_1608 265
15 3300049581 Ga0501047_0192931 Ga0501047_0192931_756_1622 265
16 3300049742 Ga0501080_0308271 Ga0501080_0308271_242_1108 265
17 3300049823 Ga0501044_0327467 Ga0501044_0327467_121_987 265
18 3300049570 Ga0501033_0001777 Ga0501033_0001777_14577_15404 266
19 3300049573 Ga0501037_0047064 Ga0501037_0047064_1803_2630 266
20 3300049574 Ga0501038_0174135 Ga0501038_0174135_524_1351 266
21 3300049581 Ga0501047_0010610 Ga0501047_0010610_4729_5556 266
22 3300049823 Ga0501044_0220127 Ga0501044_0220127_819_1646 266
23 3300049572 Ga0501036_0402679 Ga0501036_0402679_206_1036 267
24 3300049586 Ga0501070_0033643 Ga0501070_0033643_15_821 268
25 3300035695 Ga0373927_0067466 Ga0373927_0067466_650_1480 269
26 3300041443 Ga0451789_1251644 Ga0451789_1251644_1292_2101 269
27 3300046529 Ga0495652_0246365 Ga0495652_0246365_502_1317 269
28 3300046536 Ga0495587_0098797 Ga0495587_0098797_11_826 269
29 3300049581 Ga0501047_0447006 Ga0501047_0447006_297_1106 269
30 3300005937 Ga0081455_10151428 Ga0081455_101514282 271
31 3300031730 Ga0307516_10086846 Ga0307516_100868462 273
32 3300046794 Ga0495589_0029508 Ga0495589_0029508_1066_1887 273
33 3300005327 Ga0070658_10428992 Ga0070658_104289921 274
34 3300005328 Ga0070676_10190101 Ga0070676_101901012 274
35 3300005329 Ga0070683_100115103 Ga0070683_1001151032 274
36 3300005335 Ga0070666_10005142 Ga0070666_100051427 274
37 3300005338 Ga0068868_100201206 Ga0068868_1002012062 274
38 3300005617 Ga0068859_100491339 Ga0068859_1004913391 274
39 3300005843 Ga0068860_100064722 Ga0068860_1000647222 274
40 3300006358 Ga0068871_100012735 Ga0068871_1000127353 274
41 3300006358 Ga0068871_100040423 Ga0068871_1000404232 274
42 3300006931 Ga0097620_100491322 Ga0097620_1004913221 274
43 3300009174 Ga0105241_10008211 Ga0105241_100082114 274
44 3300010375 Ga0105239_10210779 Ga0105239_102107792 274
45 3300011119 Ga0105246_10068176 Ga0105246_100681762 274
46 3300013296 Ga0157374_10101236 Ga0157374_101012362 274
47 3300013297 Ga0157378_10135158 Ga0157378_101351582 274
48 3300013306 Ga0163162_10187426 Ga0163162_101874262 274
49 3300013308 Ga0157375_10041600 Ga0157375_100416004 274
50 3300014325 Ga0163163_10000252 Ga0163163_1000025222 274
51 3300014325 Ga0163163_10092151 Ga0163163_100921512 274
52 3300014968 Ga0157379_10004078 Ga0157379_100040785 274
53 3300014969 Ga0157376_10061349 Ga0157376_100613492 274
54 3300017792 Ga0163161_10014965 Ga0163161_100149654 274
55 3300025911 Ga0207654_10017805 Ga0207654_100178053 274
56 3300025914 Ga0207671_10121562 Ga0207671_101215622 274
57 3300025986 Ga0207658_10068594 Ga0207658_100685942 274
58 3300026035 Ga0207703_10101454 Ga0207703_101014542 274
59 3300026088 Ga0207641_10174814 Ga0207641_101748142 274
60 3300026089 Ga0207648_10097468 Ga0207648_100974682 274
61 3300026121 Ga0207683_10012407 Ga0207683_100124074 274
62 3300028381 Ga0268264_10044600 Ga0268264_100446003 274
63 3300028800 Ga0265338_10179904 Ga0265338_101799042 274
64 3300031241 Ga0265325_10002832 Ga0265325_100028322 274
65 3300031344 Ga0265316_10047545 Ga0265316_100475452 274
66 3300031595 Ga0265313_10001337 Ga0265313_100013376 274
67 3300031711 Ga0265314_10096173 Ga0265314_100961732 274
68 3300031712 Ga0265342_10022314 Ga0265342_100223144 274
69 3300049570 Ga0501033_0014336 Ga0501033_0014336_1485_2309 274
70 3300049570 Ga0501033_0070966 Ga0501033_0070966_1002_1826 274
71 3300049570 Ga0501033_0115405 Ga0501033_0115405_683_1507 274
72 3300049574 Ga0501038_0229731 Ga0501038_0229731_189_1013 274
73 3300049580 Ga0501046_0188557 Ga0501046_0188557_473_1297 274
74 3300049581 Ga0501047_0097680 Ga0501047_0097680_1117_1941 274
75 3300049581 Ga0501047_0183202 Ga0501047_0183202_762_1586 274
76 3300049589 Ga0501073_0043797 Ga0501073_0043797_2270_3094 274
77 3300049742 Ga0501080_0733565 Ga0501080_0733565_25_849 274
78 3300049822 Ga0501035_0008982 Ga0501035_0008982_3177_4001 274
79 3300049823 Ga0501044_0044605 Ga0501044_0044605_1196_2020 274
80 3300049823 Ga0501044_0049305 Ga0501044_0049305_2793_3617 274
81 3300053119 Ga0500595_001244 Ga0500595_001244_6005_6865 274
82 3300053136 Ga0500559_0031449 Ga0500559_0031449_424_1248 274
83 3300003214 JGI25165J46597_1000047 JGI25165J46597_1000047168 275
84 3300003214 JGI25165J46597_1000066 JGI25165J46597_1000066159 275
85 3300005327 Ga0070658_10125064 Ga0070658_101250642 275
86 3300005335 Ga0070666_10102907 Ga0070666_101029072 275
87 3300005336 Ga0070680_100018524 Ga0070680_1000185245 275
88 3300005336 Ga0070680_100091385 Ga0070680_1000913852 275
89 3300005338 Ga0068868_100060641 Ga0068868_1000606411 275
90 3300005344 Ga0070661_100137762 Ga0070661_1001377622 275
91 3300005344 Ga0070661_100593519 Ga0070661_1005935191 275
92 3300005364 Ga0070673_100312338 Ga0070673_1003123382 275
93 3300005456 Ga0070678_100172051 Ga0070678_1001720512 275
94 3300005458 Ga0070681_10000001 Ga0070681_10000001926 275
95 3300005458 Ga0070681_10185648 Ga0070681_101856482 275
96 3300005459 Ga0068867_100046788 Ga0068867_1000467883 275
97 3300005530 Ga0070679_100004777 Ga0070679_10000477714 275
98 3300005530 Ga0070679_100050876 Ga0070679_1000508763 275
99 3300005530 Ga0070679_100555678 Ga0070679_1005556781 275
100 3300005543 Ga0070672_100326417 Ga0070672_1003264172 275
101 3300005548 Ga0070665_100000685 Ga0070665_10000068533 275
102 3300005548 Ga0070665_100016071 Ga0070665_1000160714 275
103 3300005548 Ga0070665_100035650 Ga0070665_1000356502 275
104 3300005548 Ga0070665_100175870 Ga0070665_1001758702 275
105 3300005548 Ga0070665_100314306 Ga0070665_1003143061 275
106 3300005563 Ga0068855_100000034 Ga0068855_10000003455 275
107 3300005563 Ga0068855_100019580 Ga0068855_1000195807 275
108 3300005563 Ga0068855_100410599 Ga0068855_1004105991 275
109 3300005577 Ga0068857_100048884 Ga0068857_1000488842 275
110 3300005614 Ga0068856_100079853 Ga0068856_1000798532 275
111 3300005614 Ga0068856_100203544 Ga0068856_1002035442 275
112 3300005616 Ga0068852_100320993 Ga0068852_1003209932 275
113 3300005718 Ga0068866_10082935 Ga0068866_100829352 275
114 3300005719 Ga0068861_100168403 Ga0068861_1001684032 275
115 3300005841 Ga0068863_100307403 Ga0068863_1003074032 275
116 3300005843 Ga0068860_100160057 Ga0068860_1001600572 275
117 3300006237 Ga0097621_100000164 Ga0097621_10000016412 275
118 3300006358 Ga0068871_100033487 Ga0068871_1000334874 275
119 3300006358 Ga0068871_100203090 Ga0068871_1002030902 275
120 3300006358 Ga0068871_100212394 Ga0068871_1002123942 275
121 3300006358 Ga0068871_100558155 Ga0068871_1005581551 275
122 3300009093 Ga0105240_10000596 Ga0105240_1000059644 275
123 3300009093 Ga0105240_10041751 Ga0105240_100417514 275
124 3300009093 Ga0105240_10100124 Ga0105240_101001243 275
125 3300009093 Ga0105240_10159393 Ga0105240_101593932 275
126 3300009093 Ga0105240_10203418 Ga0105240_102034181 275
127 3300009093 Ga0105240_10255968 Ga0105240_102559682 275
128 3300009093 Ga0105240_10815983 Ga0105240_108159831 275
129 3300009098 Ga0105245_10022725 Ga0105245_100227252 275
130 3300009098 Ga0105245_10072923 Ga0105245_100729232 275
131 3300009101 Ga0105247_10050900 Ga0105247_100509002 275
132 3300009148 Ga0105243_10001795 Ga0105243_1000179516 275
133 3300009174 Ga0105241_10344332 Ga0105241_103443322 275
134 3300009176 Ga0105242_10011760 Ga0105242_100117602 275
135 3300009176 Ga0105242_10448432 Ga0105242_104484321 275
136 3300009177 Ga0105248_10000001 Ga0105248_10000001557 275
137 3300009177 Ga0105248_10039580 Ga0105248_100395804 275
138 3300009545 Ga0105237_10395993 Ga0105237_103959932 275
139 3300009551 Ga0105238_10178659 Ga0105238_101786592 275
140 3300010375 Ga0105239_10451551 Ga0105239_104515512 275
141 3300011119 Ga0105246_10025650 Ga0105246_100256502 275
142 3300013105 Ga0157369_10284659 Ga0157369_102846591 275
143 3300013105 Ga0157369_10432775 Ga0157369_104327752 275
144 3300013296 Ga0157374_10192494 Ga0157374_101924942 275
145 3300014968 Ga0157379_10008649 Ga0157379_100086498 275
146 3300014968 Ga0157379_10091631 Ga0157379_100916312 275
147 3300021384 Ga0213876_10009484 Ga0213876_100094844 275
148 3300025261 Ga0209233_1000045 Ga0209233_1000045275 275
149 3300025261 Ga0209233_1018508 Ga0209233_10185082 275
150 3300025297 Ga0209758_1000008 Ga0209758_10000081009 275
151 3300025901 Ga0207688_10027705 Ga0207688_100277052 275
152 3300025901 Ga0207688_10297518 Ga0207688_102975182 275
153 3300025903 Ga0207680_10260986 Ga0207680_102609862 275
154 3300025904 Ga0207647_10182365 Ga0207647_101823652 275
155 3300025909 Ga0207705_10005288 Ga0207705_1000528813 275
156 3300025912 Ga0207707_10000001 Ga0207707_10000001605 275
157 3300025913 Ga0207695_10000004 Ga0207695_100000041034 275
158 3300025913 Ga0207695_10059683 Ga0207695_100596832 275
159 3300025913 Ga0207695_10123192 Ga0207695_101231922 275
160 3300025913 Ga0207695_10207208 Ga0207695_102072082 275
161 3300025913 Ga0207695_10218895 Ga0207695_102188952 275
162 3300025913 Ga0207695_10415838 Ga0207695_104158381 275
163 3300025914 Ga0207671_10015696 Ga0207671_100156962 275
164 3300025914 Ga0207671_10268185 Ga0207671_102681852 275
165 3300025916 Ga0207663_10144908 Ga0207663_101449082 275
166 3300025917 Ga0207660_10003699 Ga0207660_100036993 275
167 3300025917 Ga0207660_10073081 Ga0207660_100730812 275
168 3300025917 Ga0207660_10271429 Ga0207660_102714291 275
169 3300025919 Ga0207657_10052225 Ga0207657_100522252 275
170 3300025921 Ga0207652_10000506 Ga0207652_1000050630 275
171 3300025921 Ga0207652_10069987 Ga0207652_100699872 275
172 3300025921 Ga0207652_10101581 Ga0207652_101015812 275
173 3300025921 Ga0207652_10171121 Ga0207652_101711212 275
174 3300025924 Ga0207694_10010519 Ga0207694_100105195 275
175 3300025924 Ga0207694_10118011 Ga0207694_101180112 275
176 3300025924 Ga0207694_10145562 Ga0207694_101455622 275
177 3300025924 Ga0207694_10351400 Ga0207694_103514002 275
178 3300025925 Ga0207650_10275034 Ga0207650_102750342 275
179 3300025927 Ga0207687_10005387 Ga0207687_100053875 275
180 3300025927 Ga0207687_10114230 Ga0207687_101142302 275
181 3300025928 Ga0207700_10445201 Ga0207700_104452011 275
182 3300025933 Ga0207706_10251906 Ga0207706_102519062 275
183 3300025934 Ga0207686_10141681 Ga0207686_101416812 275
184 3300025935 Ga0207709_10007529 Ga0207709_100075292 275
185 3300025941 Ga0207711_10000001 Ga0207711_100000011313 275
186 3300025941 Ga0207711_10064282 Ga0207711_100642821 275
187 3300025942 Ga0207689_10365420 Ga0207689_103654202 275
188 3300025944 Ga0207661_10005016 Ga0207661_100050162 275
189 3300025944 Ga0207661_10200998 Ga0207661_102009982 275
190 3300025949 Ga0207667_10000065 Ga0207667_10000065155 275
191 3300025949 Ga0207667_10301803 Ga0207667_103018032 275
192 3300025961 Ga0207712_10173858 Ga0207712_101738582 275
193 3300025981 Ga0207640_10160393 Ga0207640_101603932 275
194 3300026023 Ga0207677_10061793 Ga0207677_100617932 275
195 3300026023 Ga0207677_10195966 Ga0207677_101959662 275
196 3300026078 Ga0207702_10052163 Ga0207702_100521632 275
197 3300026089 Ga0207648_10063049 Ga0207648_100630492 275
198 3300026089 Ga0207648_10167898 Ga0207648_101678982 275
199 3300026116 Ga0207674_10041437 Ga0207674_100414374 275
200 3300026116 Ga0207674_10097655 Ga0207674_100976552 275
201 3300026116 Ga0207674_10106788 Ga0207674_101067883 275
202 3300026118 Ga0207675_100076876 Ga0207675_1000768762 275
203 3300026121 Ga0207683_10207349 Ga0207683_102073492 275
204 3300026121 Ga0207683_10446221 Ga0207683_104462212 275
205 3300026142 Ga0207698_10005150 Ga0207698_100051508 275
206 3300026142 Ga0207698_10240437 Ga0207698_102404372 275
207 3300028379 Ga0268266_10000329 Ga0268266_1000032937 275
208 3300028379 Ga0268266_10015934 Ga0268266_100159342 275
209 3300028379 Ga0268266_10016602 Ga0268266_100166022 275
210 3300028379 Ga0268266_10270070 Ga0268266_102700702 275
211 3300028380 Ga0268265_10314560 Ga0268265_103145602 275
212 3300028381 Ga0268264_10191390 Ga0268264_101913902 275
213 3300028573 Ga0265334_10014788 Ga0265334_100147883 275
214 3300028800 Ga0265338_10000006 Ga0265338_10000006155 275
215 3300028800 Ga0265338_10007645 Ga0265338_1000764511 275
216 3300031238 Ga0265332_10010364 Ga0265332_100103642 275
217 3300031238 Ga0265332_10155088 Ga0265332_101550881 275
218 3300031239 Ga0265328_10059753 Ga0265328_100597532 275
219 3300031240 Ga0265320_10000039 Ga0265320_1000003980 275
220 3300031241 Ga0265325_10000007 Ga0265325_10000007155 275
221 3300031241 Ga0265325_10001182 Ga0265325_1000118217 275
222 3300031247 Ga0265340_10006735 Ga0265340_100067358 275
223 3300031247 Ga0265340_10051667 Ga0265340_100516672 275
224 3300031247 Ga0265340_10069755 Ga0265340_100697552 275
225 3300031247 Ga0265340_10095343 Ga0265340_100953432 275
226 3300031249 Ga0265339_10005068 Ga0265339_100050682 275
227 3300031249 Ga0265339_10050408 Ga0265339_100504082 275
228 3300031250 Ga0265331_10004152 Ga0265331_100041525 275
229 3300031250 Ga0265331_10031678 Ga0265331_100316782 275
230 3300031344 Ga0265316_10131700 Ga0265316_101317002 275
231 3300031344 Ga0265316_10252479 Ga0265316_102524792 275
232 3300031595 Ga0265313_10004411 Ga0265313_100044112 275
233 3300031711 Ga0265314_10000193 Ga0265314_1000019356 275
234 3300031711 Ga0265314_10019097 Ga0265314_100190973 275
235 3300031711 Ga0265314_10131783 Ga0265314_101317832 275
236 3300031711 Ga0265314_10265352 Ga0265314_102653521 275
237 3300031712 Ga0265342_10002997 Ga0265342_100029976 275
238 3300031730 Ga0307516_10045601 Ga0307516_100456012 275
239 3300031730 Ga0307516_10047329 Ga0307516_100473292 275
240 3300035113 Ga0373936_0103476 Ga0373936_0103476_235_1071 275
241 3300035170 Ga0373943_0000736 Ga0373943_0000736_6087_6923 275
242 3300035171 Ga0373946_0095182 Ga0373946_0095182_462_1298 275
243 3300035692 Ga0373935_0083053 Ga0373935_0083053_609_1445 275
244 3300036401 Ga0373937_0145411 Ga0373937_0145411_788_1624 275
245 3300037068 Ga0373925_0012402 Ga0373925_0012402_2632_3468 275
246 3300037312 Ga0395899_0180426 Ga0395899_0180426_594_1424 275
247 3300037418 Ga0395900_0034844 Ga0395900_0034844_4248_5078 275
248 3300037466 Ga0395898_0515982 Ga0395898_0515982_109_939 275
249 3300038443 Ga0395901_0670938 Ga0395901_0670938_111_941 275
250 3300039437 Ga0436365_0148064 Ga0436365_0148064_861_1688 275
251 3300039437 Ga0436365_1376305 Ga0436365_1376305_3903_4733 275
252 3300041456 Ga0451795_0608028 Ga0451795_0608028_233_1060 275
253 3300046472 Ga0495580_0014039 Ga0495580_0014039_3359_4195 275
254 3300046473 Ga0495582_0110219 Ga0495582_0110219_545_1381 275
255 3300046507 Ga0495606_0120525 Ga0495606_0120525_732_1559 275
256 3300046536 Ga0495587_0030113 Ga0495587_0030113_270_1103 275
257 3300046539 Ga0495621_0022149 Ga0495621_0022149_1007_1834 275
258 3300046543 Ga0495645_0027780 Ga0495645_0027780_1151_1984 275
259 3300046557 Ga0495622_0001870 Ga0495622_0001870_7118_7945 275
260 3300046683 Ga0495658_0004729 Ga0495658_0004729_2544_3380 275
261 3300046689 Ga0495613_0068020 Ga0495613_0068020_661_1497 275
262 3300046692 Ga0495671_0162620 Ga0495671_0162620_42_869 275
263 3300047318 Ga0495636_0044164 Ga0495636_0044164_633_1460 275
264 3300047319 Ga0495674_0088171 Ga0495674_0088171_1679_2515 275
265 3300048929 Ga0496126_0148226 Ga0496126_0148226_573_1436 275
266 3300049460 Ga0495682_0000512 Ga0495682_0000512_14356_15189 275
267 3300049571 Ga0501034_0025010 Ga0501034_0025010_173_1006 275
268 3300049571 Ga0501034_0159076 Ga0501034_0159076_1346_2179 275
269 3300049572 Ga0501036_0022180 Ga0501036_0022180_1641_2474 275
270 3300049579 Ga0501043_0075794 Ga0501043_0075794_583_1416 275
271 3300049579 Ga0501043_0333071 Ga0501043_0333071_150_977 275
272 3300049581 Ga0501047_0001999 Ga0501047_0001999_2166_2999 275
273 3300049581 Ga0501047_0057984 Ga0501047_0057984_1707_2540 275
274 3300049581 Ga0501047_0211409 Ga0501047_0211409_245_1072 275
275 3300049581 Ga0501047_0242073 Ga0501047_0242073_684_1517 275
276 3300049581 Ga0501047_0396610 Ga0501047_0396610_115_942 275
277 3300049583 Ga0501067_0007491 Ga0501067_0007491_3356_4189 275
278 3300049583 Ga0501067_0048067 Ga0501067_0048067_930_1763 275
279 3300049585 Ga0501069_0001549 Ga0501069_0001549_8149_8982 275
280 3300049586 Ga0501070_0003820 Ga0501070_0003820_9752_10585 275
281 3300049586 Ga0501070_0222268 Ga0501070_0222268_569_1402 275
282 3300049588 Ga0501072_0030732 Ga0501072_0030732_1183_2016 275
283 3300049589 Ga0501073_0019392 Ga0501073_0019392_1888_2721 275
284 3300049589 Ga0501073_0026986 Ga0501073_0026986_1326_2159 275
285 3300049590 Ga0501074_0140196 Ga0501074_0140196_364_1197 275
286 3300049590 Ga0501074_0142432 Ga0501074_0142432_481_1314 275
287 3300049741 Ga0501079_0020826 Ga0501079_0020826_2871_3704 275
288 3300049741 Ga0501079_0121400 Ga0501079_0121400_390_1223 275
289 3300049742 Ga0501080_0015583 Ga0501080_0015583_2388_3221 275
290 3300049742 Ga0501080_0078808 Ga0501080_0078808_2090_2923 275
291 3300049742 Ga0501080_0243072 Ga0501080_0243072_265_1098 275
292 3300049742 Ga0501080_0351872 Ga0501080_0351872_135_968 275
293 3300049742 Ga0501080_0609252 Ga0501080_0609252_41_871 275
294 3300049744 Ga0501083_0100978 Ga0501083_0100978_818_1651 275
295 3300049822 Ga0501035_0037701 Ga0501035_0037701_2350_3183 275
296 3300049823 Ga0501044_0013241 Ga0501044_0013241_7959_8792 275
297 3300049823 Ga0501044_0089074 Ga0501044_0089074_368_1198 275
298 3300053087 Ga0500643_000006 Ga0500643_000006_12399_13262 275
299 3300053090 Ga0500646_0011716 Ga0500646_0011716_76_939 275
300 3300053119 Ga0500595_005425 Ga0500595_005425_2888_3715 275
301 3300053133 Ga0500655_000866 Ga0500655_000866_4973_5806 275
302 3300053133 Ga0500655_013884 Ga0500655_013884_93_926 275
303 3300053139 Ga0500568_0023291 Ga0500568_0023291_420_1283 275
304 3300053140 Ga0500573_0000520 Ga0500573_0000520_10591_11418 275
305 3300054114 Ga0501084_0058112 Ga0501084_0058112_1722_2555 275
306 3300060353 Ga0501082_0095886 Ga0501082_0095886_850_1683 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

147

263

0.96

PF01678

DAP_epimerase

Diaminopimelate epimerase

4

121

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9295 1 268
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.9236 2 267
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9037 1 268
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.8985 3 271
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8974 2 274
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9938 146 258 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9744 137 255 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.96 146 258 3.10.310.10
2gkjA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9518 116 260 3.10.310.10
af_I1NA10_49_204_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9252 1 127 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A6I5RI59-F1-model_v4 Diaminopimelate epimerase 0.9893 178 270 GO:0005829
GO:0008837
GO:0009089
AF-A0A4Q3Z9W9-F1-model_v4 Diaminopimelate epimerase 0.9889 156 264 GO:0005829
GO:0008837
GO:0009089
AF-A0A1V5LJV3-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9882 137 271 GO:0005829
GO:0008837
GO:0009089
AF-R6SI18-F1-model_v4 deleted 0.9833 149 271
AF-A0A382HQ33-F1-model_v4 Diaminopimelate epimerase 0.9833 148 271 GO:0005829
GO:0008837
GO:0009089

Feature Viewer

pLDDT pTM Quality
94.23 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map