F398722

General Info

Members Datasets Scaffolds Average Seq Length
306 196 612 144

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100417333|Ga0207675_1004173332
Length 167
Sequence MGAFEKMVDASRIRGKVSRFLGSSASQLSFALAAIAALPAAAEFKALGERPAILYDAPSARADRLFVASRLYPFEVLVKLDQWTKVRDANGEVAWVENAAFGTRATVLVTVPLADVRAAPNVQSALVFEAYKQVILEVVEPAQGEWIKVRHRDGQQGYIRVAHVWGA

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 0
Rhizoplane 1.31
Rhizosphere 92.81
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100417333 3300026118 Bacteria 1325
2 Ga0070658_10163420 3300005327 Bacteria 1868
3 Ga0070658_10428601 3300005327 Bacteria 1138
4 Ga0070690_100068509 3300005330 Bacteria 2302
5 Ga0070670_100815696 3300005331 Bacteria 843
6 Ga0068869_100169280 3300005334 Bacteria 1706
7 Ga0070680_100031950 3300005336 Bacteria 4234
8 Ga0068868_100017934 3300005338 Bacteria 5281
9 Ga0068868_100093391 3300005338 Bacteria 2426
10 Ga0068868_100294774 3300005338 Bacteria 1376
11 Ga0070660_100262664 3300005339 Bacteria 1410
12 Ga0070689_100026674 3300005340 Bacteria 4352
13 Ga0070691_10597179 3300005341 Bacteria 651
14 Ga0070661_100061413 3300005344 Bacteria 2758
15 Ga0070692_10338165 3300005345 Bacteria 931
16 Ga0070675_100008671 3300005354 Bacteria 7897
17 Ga0070674_100014353 3300005356 Bacteria 4925
18 Ga0070674_100874444 3300005356 Bacteria 781
19 Ga0070673_100180261 3300005364 Bacteria 1808
20 Ga0070673_100216200 3300005364 Bacteria 1657
21 Ga0070673_100348300 3300005364 Bacteria 1314
22 Ga0070688_100018453 3300005365 Bacteria 4025
23 Ga0070709_10042047 3300005434 Bacteria 2820
24 Ga0070714_100535369 3300005435 Bacteria 1120
25 Ga0070714_100969020 3300005435 Bacteria 827
26 Ga0070713_100042918 3300005436 Bacteria 3694
27 Ga0070713_100930478 3300005436 Bacteria 837
28 Ga0070701_10008256 3300005438 Bacteria 4494
29 Ga0070711_100087612 3300005439 Bacteria 2236
30 Ga0070700_100335262 3300005441 Bacteria 1116
31 Ga0070700_100837813 3300005441 Bacteria 744
32 Ga0070662_101850948 3300005457 Unclassified 521
33 Ga0070681_10025417 3300005458 Bacteria 5957
34 Ga0070681_10176902 3300005458 Bacteria 2056
35 Ga0068867_100125123 3300005459 Bacteria 1991
36 Ga0068867_100140568 3300005459 Bacteria 1887
37 Ga0070698_100687035 3300005471 Bacteria 965
38 Ga0070679_100017639 3300005530 Bacteria 6910
39 Ga0070679_100224027 3300005530 Bacteria 1841
40 Ga0070684_100718378 3300005535 Bacteria 932
41 Ga0068853_100017264 3300005539 Bacteria 5956
42 Ga0068853_100383326 3300005539 Bacteria 1313
43 Ga0070672_100144333 3300005543 Bacteria 1966
44 Ga0070686_100380957 3300005544 Bacteria 1068
45 Ga0070686_100523428 3300005544 Bacteria 924
46 Ga0070696_100221137 3300005546 Bacteria 1421
47 Ga0070693_100012736 3300005547 Bacteria 4264
48 Ga0070665_100054234 3300005548 Bacteria 4021
49 Ga0070665_100075331 3300005548 Bacteria 3381
50 Ga0070665_101370392 3300005548 Unclassified 716
51 Ga0068855_100018124 3300005563 Bacteria 8461
52 Ga0068855_100033076 3300005563 Bacteria 6174
53 Ga0068857_100462685 3300005577 Bacteria 1187
54 Ga0068857_101105045 3300005577 Bacteria 766
55 Ga0068856_100060367 3300005614 Bacteria 3746
56 Ga0070702_100553179 3300005615 Bacteria 855
57 Ga0068852_100000823 3300005616 Bacteria 20478
58 Ga0068852_100005931 3300005616 Bacteria 8784
59 Ga0068852_100221260 3300005616 Bacteria 1800
60 Ga0068859_100013054 3300005617 Bacteria 8347
61 Ga0068859_100745408 3300005617 Bacteria 1068
62 Ga0068859_100781795 3300005617 Bacteria 1043
63 Ga0068864_100231245 3300005618 Bacteria 1710
64 Ga0068866_10232808 3300005718 Bacteria 1118
65 Ga0068861_100663797 3300005719 Bacteria 965
66 Ga0068861_101648472 3300005719 Bacteria 633
67 Ga0068851_10003721 3300005834 Bacteria 6810
68 Ga0068870_10339855 3300005840 Bacteria 960
69 Ga0068858_100025891 3300005842 Bacteria 5456
70 Ga0068858_100112030 3300005842 Bacteria 2548
71 Ga0068858_100186600 3300005842 Bacteria 1959
72 Ga0068858_101194043 3300005842 Bacteria 748
73 Ga0068860_100373418 3300005843 Bacteria 1407
74 Ga0068860_100830985 3300005843 Bacteria 938
75 Ga0075364_10014535 3300006051 Bacteria 4866
76 Ga0075364_10181082 3300006051 Bacteria 1426
77 Ga0070712_100392759 3300006175 Bacteria 1144
78 Ga0070712_101076694 3300006175 Bacteria 697
79 Ga0075367_10289625 3300006178 Bacteria 1030
80 Ga0075366_10000908 3300006195 Bacteria 14344
81 Ga0075366_10009233 3300006195 Bacteria 5504
82 Ga0097621_100052522 3300006237 Bacteria 3321
83 Ga0097621_100073114 3300006237 Bacteria 2838
84 Ga0075370_10458808 3300006353 Bacteria 767
85 Ga0075370_10483895 3300006353 Bacteria 746
86 Ga0068871_100009669 3300006358 Bacteria 7001
87 Ga0068871_100016657 3300006358 Bacteria 5544
88 Ga0068871_100105005 3300006358 Bacteria 2370
89 Ga0075428_100009589 3300006844 Bacteria 10750
90 Ga0075429_100112032 3300006880 Bacteria 2384
91 Ga0068865_100047438 3300006881 Bacteria 2952
92 Ga0068865_101286617 3300006881 Bacteria 650
93 Ga0097620_100013054 3300006931 Bacteria 8347
94 Ga0097620_100745385 3300006931 Bacteria 1068
95 Ga0097620_100781766 3300006931 Bacteria 1043
96 Ga0105240_10026838 3300009093 Bacteria 7553
97 Ga0105240_10041414 3300009093 Bacteria 5878
98 Ga0105240_10688799 3300009093 Bacteria 1117
99 Ga0111539_10093528 3300009094 Bacteria 3531
100 Ga0111539_11942954 3300009094 Unclassified 682
101 Ga0105245_10174784 3300009098 Bacteria 2048
102 Ga0105245_10468202 3300009098 Bacteria 1271
103 Ga0105245_10678101 3300009098 Bacteria 1063
104 Ga0105245_10749207 3300009098 Bacteria 1012
105 Ga0105243_10230655 3300009148 Bacteria 1642
106 Ga0105243_10615185 3300009148 Bacteria 1048
107 Ga0105243_11063903 3300009148 Bacteria 815
108 Ga0105241_10050586 3300009174 Bacteria 3168
109 Ga0105242_10004836 3300009176 Bacteria 10430
110 Ga0105242_10243121 3300009176 Bacteria 1619
111 Ga0105242_10276790 3300009176 Bacteria 1522
112 Ga0105242_10419989 3300009176 Bacteria 1253
113 Ga0105248_10101263 3300009177 Bacteria 3247
114 Ga0105248_10234563 3300009177 Bacteria 2065
115 Ga0105248_10375668 3300009177 Bacteria 1600
116 Ga0105248_10798348 3300009177 Bacteria 1065
117 Ga0105238_10014725 3300009551 Bacteria 7908
118 Ga0105238_10038040 3300009551 Bacteria 4889
119 Ga0105238_10095011 3300009551 Bacteria 2968
120 Ga0105238_10592272 3300009551 Bacteria 1116
121 Ga0105249_10892221 3300009553 Bacteria 956
122 Ga0105246_11356492 3300011119 Bacteria 661
123 Ga0157316_1034778 3300012510 Bacteria 629
124 Ga0157370_10009369 3300013104 Bacteria 10474
125 Ga0157369_10007904 3300013105 Bacteria 12229
126 Ga0157369_10152802 3300013105 Bacteria 2440
127 Ga0157374_10314050 3300013296 Bacteria 1552
128 Ga0157378_12002297 3300013297 Bacteria 629
129 Ga0163162_10238850 3300013306 Bacteria 1948
130 Ga0163162_10388899 3300013306 Bacteria 1528
131 Ga0163162_10809931 3300013306 Bacteria 1054
132 Ga0157372_10001692 3300013307 Bacteria 23859
133 Ga0157372_10062670 3300013307 Bacteria 4167
134 Ga0157372_10090069 3300013307 Bacteria 3486
135 Ga0157372_11016813 3300013307 Bacteria 960
136 Ga0157375_10049908 3300013308 Bacteria 4102
137 Ga0157380_10541339 3300014326 Bacteria 1140
138 Ga0157380_10740036 3300014326 Bacteria 993
139 Ga0157377_10461827 3300014745 Bacteria 879
140 Ga0157376_10049853 3300014969 Bacteria 3470
141 Ga0207656_10073997 3300025321 Bacteria 1519
142 Ga0207692_10982146 3300025898 Bacteria 557
143 Ga0207642_10728738 3300025899 Bacteria 626
144 Ga0207699_10110672 3300025906 Bacteria 1759
145 Ga0207705_10041679 3300025909 Bacteria 3294
146 Ga0207705_10056966 3300025909 Bacteria 2819
147 Ga0207705_10289666 3300025909 Bacteria 1254
148 Ga0207654_10096030 3300025911 Bacteria 1817
149 Ga0207707_10221518 3300025912 Bacteria 1647
150 Ga0207695_10032788 3300025913 Bacteria 5678
151 Ga0207695_10204277 3300025913 Bacteria 1889
152 Ga0207663_10183591 3300025916 Bacteria 1496
153 Ga0207660_10138936 3300025917 Bacteria 1856
154 Ga0207660_10359408 3300025917 Bacteria 1168
155 Ga0207662_10204024 3300025918 Bacteria 1281
156 Ga0207657_10168042 3300025919 Bacteria 1778
157 Ga0207652_10012257 3300025921 Bacteria 6925
158 Ga0207652_10217468 3300025921 Bacteria 1721
159 Ga0207652_10291591 3300025921 Bacteria 1472
160 Ga0207681_10116838 3300025923 Bacteria 1950
161 Ga0207694_10070472 3300025924 Bacteria 2731
162 Ga0207694_10288352 3300025924 Bacteria 1350
163 Ga0207694_10792587 3300025924 Bacteria 800
164 Ga0207659_10172724 3300025926 Bacteria 1706
165 Ga0207687_10397012 3300025927 Bacteria 1133
166 Ga0207687_10917728 3300025927 Bacteria 750
167 Ga0207700_10487179 3300025928 Bacteria 1090
168 Ga0207706_10349381 3300025933 Bacteria 1286
169 Ga0207706_11561314 3300025933 Bacteria 536
170 Ga0207686_10002502 3300025934 Bacteria 9980
171 Ga0207670_10023767 3300025936 Bacteria 3820
172 Ga0207670_10150096 3300025936 Bacteria 1728
173 Ga0207669_10258098 3300025937 Bacteria 1302
174 Ga0207704_10497090 3300025938 Bacteria 982
175 Ga0207704_10638375 3300025938 Bacteria 876
176 Ga0207691_10011455 3300025940 Bacteria 8510
177 Ga0207711_10328335 3300025941 Bacteria 1414
178 Ga0207711_10403468 3300025941 Bacteria 1270
179 Ga0207711_10769454 3300025941 Bacteria 897
180 Ga0207711_11086727 3300025941 Bacteria 741
181 Ga0207689_10067127 3300025942 Bacteria 2948
182 Ga0207689_11132669 3300025942 Bacteria 659
183 Ga0207667_10006733 3300025949 Bacteria 13876
184 Ga0207667_10020766 3300025949 Bacteria 7295
185 Ga0207667_10080931 3300025949 Bacteria 3365
186 Ga0207667_10723497 3300025949 Bacteria 996
187 Ga0207651_10110975 3300025960 Bacteria 2059
188 Ga0207640_10740110 3300025981 Bacteria 847
189 Ga0207677_10013698 3300026023 Bacteria 4707
190 Ga0207677_10315265 3300026023 Bacteria 1297
191 Ga0207703_10009289 3300026035 Bacteria 7728
192 Ga0207703_10103591 3300026035 Bacteria 2416
193 Ga0207703_10117604 3300026035 Bacteria 2278
194 Ga0207703_10622404 3300026035 Bacteria 1022
195 Ga0207639_10068395 3300026041 Bacteria 2768
196 Ga0207639_10342219 3300026041 Bacteria 1334
197 Ga0207708_10362334 3300026075 Bacteria 1192
198 Ga0207708_10692374 3300026075 Unclassified 871
199 Ga0207641_10095488 3300026088 Bacteria 2610
200 Ga0207641_10988958 3300026088 Bacteria 838
201 Ga0207648_10039688 3300026089 Bacteria 4138
202 Ga0207648_10313457 3300026089 Bacteria 1408
203 Ga0207648_10663094 3300026089 Bacteria 965
204 Ga0207676_10381610 3300026095 Bacteria 1312
205 Ga0207676_10727402 3300026095 Bacteria 964
206 Ga0207674_10375183 3300026116 Bacteria 1375
207 Ga0207675_100281273 3300026118 Bacteria 1617
208 Ga0207683_10058403 3300026121 Bacteria 3387
209 Ga0207683_10673022 3300026121 Bacteria 959
210 Ga0207698_10015160 3300026142 Bacteria 5153
211 Ga0207698_10220207 3300026142 Bacteria 1714
212 Ga0207698_10366198 3300026142 Bacteria 1367
213 Ga0207698_10645366 3300026142 Bacteria 1048
214 Ga0207698_10930742 3300026142 Unclassified 877
215 Ga0207428_10001508 3300027907 Bacteria 24337
216 Ga0268266_10050067 3300028379 Bacteria 3584
217 Ga0268265_10231359 3300028380 Bacteria 1625
218 Ga0268264_10028474 3300028381 Bacteria 4571
219 Ga0265316_10327418 3300031344 Bacteria 1112
220 Ga0307408_100424878 3300031548 Bacteria 1147
221 Ga0307408_100562624 3300031548 Bacteria 1008
222 Ga0265314_10069725 3300031711 Bacteria 2358
223 Ga0307405_10244218 3300031731 Bacteria 1332
224 Ga0307405_10278432 3300031731 Bacteria 1258
225 Ga0307413_10333879 3300031824 Bacteria 1163
226 Ga0307412_11124452 3300031911 Bacteria 700
227 Ga0307409_100131354 3300031995 Bacteria 2141
228 Ga0307409_101942101 3300031995 Bacteria 618
229 Ga0307416_100032325 3300032002 Bacteria 3952
230 Ga0307416_100385804 3300032002 Bacteria 1433
231 Ga0307416_100715841 3300032002 Bacteria 1091
232 Ga0373958_0021577 3300034819 Bacteria 1196
233 Ga0373929_0003447 3300035085 Bacteria 2849
234 Ga0373956_0067931 3300035119 Bacteria 1623
235 Ga0373943_0710446 3300035170 Bacteria 596
236 Ga0373946_0760599 3300035171 Bacteria 509
237 Ga0373955_0009860 3300035172 Bacteria 4493
238 Ga0373924_0243782 3300035410 Bacteria 795
239 Ga0373931_0057149 3300035691 Bacteria 2092
240 Ga0373935_0957269 3300035692 Bacteria 635
241 Ga0373933_0284114 3300035724 Bacteria 1069
242 Ga0373937_0044192 3300036401 Bacteria 4068
243 Ga0373925_0040783 3300037068 Bacteria 3438
244 Ga0373925_1053819 3300037068 Bacteria 669
245 Ga0395899_0593707 3300037312 Bacteria 706
246 Ga0395900_0112624 3300037418 Bacteria 2794
247 Ga0395905_0051332 3300037471 Bacteria 3863
248 Ga0395901_0094872 3300038443 Bacteria 3126
249 Ga0436365_0383882 3300039437 Bacteria 982
250 Ga0436365_1695396 3300039437 Bacteria 1757
251 Ga0439452_049213 3300042010 Bacteria 970
252 Ga0439435_0192204 3300042436 Bacteria 670
253 Ga0439444_0134445 3300042437 Bacteria 587
254 Ga0451577_1014942 3300042876 Bacteria 745
255 Ga0466963_0542155 3300044694 Bacteria 822
256 Ga0495592_0033331 3300046454 Bacteria 3885
257 Ga0495653_0169284 3300046463 Bacteria 1509
258 Ga0495608_0005328 3300046511 Bacteria 9189
259 Ga0495652_0065732 3300046529 Bacteria 3046
260 Ga0495587_0010361 3300046536 Bacteria 5938
261 Ga0495598_0114030 3300046537 Bacteria 909
262 Ga0495621_0016753 3300046539 Bacteria 2358
263 Ga0495645_0000490 3300046543 Bacteria 27455
264 Ga0495667_0003624 3300046559 Bacteria 10384
265 Ga0495634_0531215 3300046642 Bacteria 687
266 Ga0495657_0152987 3300046675 Bacteria 1431
267 Ga0495599_0030882 3300046678 Bacteria 3363
268 Ga0495623_0393836 3300046679 Bacteria 746
269 Ga0495600_0068167 3300046809 Bacteria 2325
270 Ga0495684_0033460 3300047471 Bacteria 3942
271 Ga0495602_0300039 3300048088 Bacteria 1176
272 Ga0496104_0027083 3300048907 Bacteria 5301
273 Ga0496105_0095420 3300048908 Bacteria 2456
274 Ga0496110_0122284 3300048913 Bacteria 2346
275 Ga0496111_0736217 3300048914 Bacteria 716
276 Ga0501042_0181458 3300049578 Bacteria 1519
277 Ga0501047_0003648 3300049581 Bacteria 14509
278 Ga0501047_0138467 3300049581 Bacteria 2313
279 Ga0501067_0084936 3300049583 Bacteria 1756
280 Ga0501069_0001230 3300049585 Bacteria 12515
281 Ga0501070_0001632 3300049586 Bacteria 19881
282 Ga0501073_0004853 3300049589 Bacteria 10093
283 Ga0501074_0054948 3300049590 Bacteria 2870
284 Ga0501079_0010664 3300049741 Bacteria 6996
285 Ga0501080_0046912 3300049742 Bacteria 4021
286 Ga0501080_0126484 3300049742 Bacteria 2367
287 Ga0501083_0001539 3300049744 Bacteria 15778
288 Ga0501044_0212697 3300049823 Bacteria 1887
289 Ga0501044_0633669 3300049823 Bacteria 959
290 nmdc:mga00v17_147507_c1 3300050491 Bacteria 1510
291 nmdc:mga00v17_252878_c1 3300050491 Bacteria 1142
292 nmdc:mga00v17_39455_c1 3300050491 Bacteria 2828
293 nmdc:mga00v17_536246_c1 3300050491 Bacteria 757
294 nmdc:mga0k408_245118_c1 3300050493 Bacteria 1070
295 nmdc:mga0k408_297839_c1 3300050493 Bacteria 963
296 nmdc:mga09592_33285_c2 3300050508 Bacteria 3745
297 nmdc:mga08y16_1378_c1 3300050511 Bacteria 24279
298 nmdc:mga0n895_148367_c1 3300050512 Bacteria 2374
299 nmdc:mga08x19_164732_c1 3300050514 Bacteria 1507
300 nmdc:mga0sz30_135120_c1 3300050516 Bacteria 1088
301 Ga0495601_0003644 3300053077 Bacteria 8857
302 Ga0495595_0123687 3300053084 Bacteria 1261
303 Ga0500641_0044128 3300053096 Bacteria 1812
304 Ga0500628_035688 3300053129 Bacteria 1107
305 Ga0501084_0029207 3300054114 Bacteria 4612
306 Ga0501082_0056080 3300060353 Bacteria 3393
307 Ga0207675_100417333
308 Ga0070658_10163420
309 Ga0070658_10428601
310 Ga0070690_100068509
311 Ga0070670_100815696
312 Ga0068869_100169280
313 Ga0070680_100031950
314 Ga0068868_100017934
315 Ga0068868_100093391
316 Ga0068868_100294774
317 Ga0070660_100262664
318 Ga0070689_100026674
319 Ga0070691_10597179
320 Ga0070661_100061413
321 Ga0070692_10338165
322 Ga0070675_100008671
323 Ga0070674_100014353
324 Ga0070674_100874444
325 Ga0070673_100180261
326 Ga0070673_100216200
327 Ga0070673_100348300
328 Ga0070688_100018453
329 Ga0070709_10042047
330 Ga0070714_100535369
331 Ga0070714_100969020
332 Ga0070713_100042918
333 Ga0070713_100930478
334 Ga0070701_10008256
335 Ga0070711_100087612
336 Ga0070700_100335262
337 Ga0070700_100837813
338 Ga0070662_101850948
339 Ga0070681_10025417
340 Ga0070681_10176902
341 Ga0068867_100125123
342 Ga0068867_100140568
343 Ga0070698_100687035
344 Ga0070679_100017639
345 Ga0070679_100224027
346 Ga0070684_100718378
347 Ga0068853_100017264
348 Ga0068853_100383326
349 Ga0070672_100144333
350 Ga0070686_100380957
351 Ga0070686_100523428
352 Ga0070696_100221137
353 Ga0070693_100012736
354 Ga0070665_100054234
355 Ga0070665_100075331
356 Ga0070665_101370392
357 Ga0068855_100018124
358 Ga0068855_100033076
359 Ga0068857_100462685
360 Ga0068857_101105045
361 Ga0068856_100060367
362 Ga0070702_100553179
363 Ga0068852_100000823
364 Ga0068852_100005931
365 Ga0068852_100221260
366 Ga0068859_100013054
367 Ga0068859_100745408
368 Ga0068859_100781795
369 Ga0068864_100231245
370 Ga0068866_10232808
371 Ga0068861_100663797
372 Ga0068861_101648472
373 Ga0068851_10003721
374 Ga0068870_10339855
375 Ga0068858_100025891
376 Ga0068858_100112030
377 Ga0068858_100186600
378 Ga0068858_101194043
379 Ga0068860_100373418
380 Ga0068860_100830985
381 Ga0075364_10014535
382 Ga0075364_10181082
383 Ga0070712_100392759
384 Ga0070712_101076694
385 Ga0075367_10289625
386 Ga0075366_10000908
387 Ga0075366_10009233
388 Ga0097621_100052522
389 Ga0097621_100073114
390 Ga0075370_10458808
391 Ga0075370_10483895
392 Ga0068871_100009669
393 Ga0068871_100016657
394 Ga0068871_100105005
395 Ga0075428_100009589
396 Ga0075429_100112032
397 Ga0068865_100047438
398 Ga0068865_101286617
399 Ga0097620_100013054
400 Ga0097620_100745385
401 Ga0097620_100781766
402 Ga0105240_10026838
403 Ga0105240_10041414
404 Ga0105240_10688799
405 Ga0111539_10093528
406 Ga0111539_11942954
407 Ga0105245_10174784
408 Ga0105245_10468202
409 Ga0105245_10678101
410 Ga0105245_10749207
411 Ga0105243_10230655
412 Ga0105243_10615185
413 Ga0105243_11063903
414 Ga0105241_10050586
415 Ga0105242_10004836
416 Ga0105242_10243121
417 Ga0105242_10276790
418 Ga0105242_10419989
419 Ga0105248_10101263
420 Ga0105248_10234563
421 Ga0105248_10375668
422 Ga0105248_10798348
423 Ga0105238_10014725
424 Ga0105238_10038040
425 Ga0105238_10095011
426 Ga0105238_10592272
427 Ga0105249_10892221
428 Ga0105246_11356492
429 Ga0157316_1034778
430 Ga0157370_10009369
431 Ga0157369_10007904
432 Ga0157369_10152802
433 Ga0157374_10314050
434 Ga0157378_12002297
435 Ga0163162_10238850
436 Ga0163162_10388899
437 Ga0163162_10809931
438 Ga0157372_10001692
439 Ga0157372_10062670
440 Ga0157372_10090069
441 Ga0157372_11016813
442 Ga0157375_10049908
443 Ga0157380_10541339
444 Ga0157380_10740036
445 Ga0157377_10461827
446 Ga0157376_10049853
447 Ga0207656_10073997
448 Ga0207692_10982146
449 Ga0207642_10728738
450 Ga0207699_10110672
451 Ga0207705_10041679
452 Ga0207705_10056966
453 Ga0207705_10289666
454 Ga0207654_10096030
455 Ga0207707_10221518
456 Ga0207695_10032788
457 Ga0207695_10204277
458 Ga0207663_10183591
459 Ga0207660_10138936
460 Ga0207660_10359408
461 Ga0207662_10204024
462 Ga0207657_10168042
463 Ga0207652_10012257
464 Ga0207652_10217468
465 Ga0207652_10291591
466 Ga0207681_10116838
467 Ga0207694_10070472
468 Ga0207694_10288352
469 Ga0207694_10792587
470 Ga0207659_10172724
471 Ga0207687_10397012
472 Ga0207687_10917728
473 Ga0207700_10487179
474 Ga0207706_10349381
475 Ga0207706_11561314
476 Ga0207686_10002502
477 Ga0207670_10023767
478 Ga0207670_10150096
479 Ga0207669_10258098
480 Ga0207704_10497090
481 Ga0207704_10638375
482 Ga0207691_10011455
483 Ga0207711_10328335
484 Ga0207711_10403468
485 Ga0207711_10769454
486 Ga0207711_11086727
487 Ga0207689_10067127
488 Ga0207689_11132669
489 Ga0207667_10006733
490 Ga0207667_10020766
491 Ga0207667_10080931
492 Ga0207667_10723497
493 Ga0207651_10110975
494 Ga0207640_10740110
495 Ga0207677_10013698
496 Ga0207677_10315265
497 Ga0207703_10009289
498 Ga0207703_10103591
499 Ga0207703_10117604
500 Ga0207703_10622404
501 Ga0207639_10068395
502 Ga0207639_10342219
503 Ga0207708_10362334
504 Ga0207708_10692374
505 Ga0207641_10095488
506 Ga0207641_10988958
507 Ga0207648_10039688
508 Ga0207648_10313457
509 Ga0207648_10663094
510 Ga0207676_10381610
511 Ga0207676_10727402
512 Ga0207674_10375183
513 Ga0207675_100281273
514 Ga0207683_10058403
515 Ga0207683_10673022
516 Ga0207698_10015160
517 Ga0207698_10220207
518 Ga0207698_10366198
519 Ga0207698_10645366
520 Ga0207698_10930742
521 Ga0207428_10001508
522 Ga0268266_10050067
523 Ga0268265_10231359
524 Ga0268264_10028474
525 Ga0265316_10327418
526 Ga0307408_100424878
527 Ga0307408_100562624
528 Ga0265314_10069725
529 Ga0307405_10244218
530 Ga0307405_10278432
531 Ga0307413_10333879
532 Ga0307412_11124452
533 Ga0307409_100131354
534 Ga0307409_101942101
535 Ga0307416_100032325
536 Ga0307416_100385804
537 Ga0307416_100715841
538 Ga0373958_0021577
539 Ga0373929_0003447
540 Ga0373956_0067931
541 Ga0373943_0710446
542 Ga0373946_0760599
543 Ga0373955_0009860
544 Ga0373924_0243782
545 Ga0373931_0057149
546 Ga0373935_0957269
547 Ga0373933_0284114
548 Ga0373937_0044192
549 Ga0373925_0040783
550 Ga0373925_1053819
551 Ga0395899_0593707
552 Ga0395900_0112624
553 Ga0395905_0051332
554 Ga0395901_0094872
555 Ga0436365_0383882
556 Ga0436365_1695396
557 Ga0439452_049213
558 Ga0439435_0192204
559 Ga0439444_0134445
560 Ga0451577_1014942
561 Ga0466963_0542155
562 Ga0495592_0033331
563 Ga0495653_0169284
564 Ga0495608_0005328
565 Ga0495652_0065732
566 Ga0495587_0010361
567 Ga0495598_0114030
568 Ga0495621_0016753
569 Ga0495645_0000490
570 Ga0495667_0003624
571 Ga0495634_0531215
572 Ga0495657_0152987
573 Ga0495599_0030882
574 Ga0495623_0393836
575 Ga0495600_0068167
576 Ga0495684_0033460
577 Ga0495602_0300039
578 Ga0496104_0027083
579 Ga0496105_0095420
580 Ga0496110_0122284
581 Ga0496111_0736217
582 Ga0501042_0181458
583 Ga0501047_0003648
584 Ga0501047_0138467
585 Ga0501067_0084936
586 Ga0501069_0001230
587 Ga0501070_0001632
588 Ga0501073_0004853
589 Ga0501074_0054948
590 Ga0501079_0010664
591 Ga0501080_0046912
592 Ga0501080_0126484
593 Ga0501083_0001539
594 Ga0501044_0212697
595 Ga0501044_0633669
596 nmdc:mga00v17_147507_c1
597 nmdc:mga00v17_252878_c1
598 nmdc:mga00v17_39455_c1
599 nmdc:mga00v17_536246_c1
600 nmdc:mga0k408_245118_c1
601 nmdc:mga0k408_297839_c1
602 nmdc:mga09592_33285_c2
603 nmdc:mga08y16_1378_c1
604 nmdc:mga0n895_148367_c1
605 nmdc:mga08x19_164732_c1
606 nmdc:mga0sz30_135120_c1
607 Ga0495601_0003644
608 Ga0495595_0123687
609 Ga0500641_0044128
610 Ga0500628_035688
611 Ga0501084_0029207
612 Ga0501082_0056080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06347

SH3_4

Bacterial SH3 domain

48

101

0.94

PF06347

SH3_4

Bacterial SH3 domain

110

166

0.92

PF08239

SH3_3

Bacterial SH3 domain

112

164

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2krs-assembly1.cif.gz_A solution nmr structure of sh3 domain from cpf_0587 (fragment 415-479) from clostridium perfringens. northeast structural genomics consortium (nesg) target cpr74a. 0.8934 84 143
7pod-assembly1.cif.gz_A crystal structure of catalytic domain of lytb (e585q) from streptococcus pneumoniae in complex with nag-nam-nag-nam tetrasaccharide 0.8471 83 145
4q2w-assembly1.cif.gz_A crystal structure of pneumococcal peptidoglycan hydrolase lytb 0.8281 81 145
2kt8-assembly1.cif.gz_A solution nmr structure of the cpe1231(468-535) protein from clostridium perfringens, northeast structural genomics consortium target cpr82b 0.8218 84 143
2kyb-assembly1.cif.gz_A solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g 0.7937 85 140
ID Description Score Start End Superfamily
af_P0ADT8_18_85_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9232 19 78 2.30.30.40
4r0kB02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8991 84 145 2.30.30.40
4krtB03 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.898 84 145 2.30.30.40
4r0kB01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8903 81 145 2.30.30.40
2krsA01 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.8898 86 143 2.30.30.40
ID Description Score Start End GO Terms
AF-A0A8A8VHN2-F1-model_v4 deleted 0.986 19 145
AF-A0A850QAR4-F1-model_v4 SH3b domain-containing protein 0.984 19 145
AF-A0A3A6P671-F1-model_v4 SH3b domain-containing protein 0.982 19 145
AF-A0A2N4XL50-F1-model_v4 SH3b domain-containing protein 0.9814 19 145
AF-A0A7X8JJS1-F1-model_v4 SH3 domain-containing protein 0.98 83 143 GO:0016020

Map