F398717

General Info

Members Datasets Scaffolds Average Seq Length
306 132 612 143

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10673577|Ga0207703_106735772
Length 168
Sequence MLVRRSAPDRALLNWSENLFSGFRRMSELPRRIVSQLRRFIGNRRHSKRVRTRLSFTLSLSDRRVGTNGSRRLPTLDGYTLDISVTGLALIVPAIRIGEHYLAGADRKLHVKLELPGGPVEMKVVTVRYENLEDGSGYLIGARILEISDADRKSFEKYVAKAMAHQQV

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.29
Rhizosphere 97.71
Stem 0
Stem Tuber 0
Unclassified 49.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10673577 3300026035 Unclassified 982
2 SwRhRL2b_contig_2675828 2162886007 Unclassified 1939
3 SwRhRL2b_contig_3244076 2162886007 Unclassified 1747
4 Ga0065704_10111468 3300005289 Unclassified 1956
5 Ga0065704_10714531 3300005289 Unclassified 556
6 Ga0065712_10005928 3300005290 Bacteria 2923
7 Ga0065712_10010045 3300005290 Unclassified 3451
8 Ga0065715_10097374 3300005293 Bacteria 3716
9 Ga0065715_10117909 3300005293 Bacteria 2332
10 Ga0065715_10157161 3300005293 Bacteria 1665
11 Ga0065715_10190947 3300005293 Bacteria 1415
12 Ga0065715_10582235 3300005293 Unclassified 719
13 Ga0065715_10593468 3300005293 Unclassified 712
14 Ga0065715_10975233 3300005293 Unclassified 552
15 Ga0065707_10013403 3300005295 Bacteria 1854
16 Ga0065707_10094399 3300005295 Unclassified 3503
17 Ga0070690_100076876 3300005330 Bacteria 2178
18 Ga0070690_101108852 3300005330 Unclassified 628
19 Ga0070670_100000288 3300005331 Bacteria 44423
20 Ga0070670_100230016 3300005331 Bacteria 1614
21 Ga0070670_100388670 3300005331 Bacteria 1230
22 Ga0070670_100863061 3300005331 Unclassified 819
23 Ga0068869_100232221 3300005334 Bacteria 1466
24 Ga0070680_101254579 3300005336 Bacteria 641
25 Ga0070660_100434397 3300005339 Unclassified 1088
26 Ga0070689_100000914 3300005340 Bacteria 18410
27 Ga0070689_100562472 3300005340 Unclassified 984
28 Ga0070689_102224629 3300005340 Bacteria 503
29 Ga0070687_100053489 3300005343 Bacteria 2100
30 Ga0070692_10049624 3300005345 Unclassified 2177
31 Ga0070692_10617165 3300005345 Unclassified 720
32 Ga0070675_100921860 3300005354 Bacteria 801
33 Ga0070671_100396636 3300005355 Unclassified 1180
34 Ga0070673_100237121 3300005364 Bacteria 1584
35 Ga0070673_100451214 3300005364 Unclassified 1157
36 Ga0070673_100904277 3300005364 Bacteria 819
37 Ga0070659_100725176 3300005366 Unclassified 861
38 Ga0070703_10013621 3300005406 Bacteria 2311
39 Ga0070703_10272641 3300005406 Unclassified 695
40 Ga0070701_10352355 3300005438 Unclassified 920
41 Ga0070700_100000107 3300005441 Bacteria 52892
42 Ga0070700_100059163 3300005441 Bacteria 2411
43 Ga0070700_100127729 3300005441 Bacteria 1711
44 Ga0070700_100205901 3300005441 Bacteria 1385
45 Ga0070700_100329135 3300005441 Unclassified 1125
46 Ga0070700_100351743 3300005441 Unclassified 1093
47 Ga0070700_100611991 3300005441 Unclassified 855
48 Ga0070694_100033240 3300005444 Bacteria 3393
49 Ga0070694_100199178 3300005444 Unclassified 1492
50 Ga0068867_100046568 3300005459 Unclassified 3186
51 Ga0068867_100957670 3300005459 Unclassified 773
52 Ga0070699_100032493 3300005518 Bacteria 4507
53 Ga0070699_101622397 3300005518 Unclassified 593
54 Ga0068853_100004644 3300005539 Bacteria 10650
55 Ga0068853_101045836 3300005539 Unclassified 787
56 Ga0070695_100461307 3300005545 Unclassified 975
57 Ga0070695_100835237 3300005545 Bacteria 740
58 Ga0070693_100037458 3300005547 Bacteria 2705
59 Ga0070693_100291963 3300005547 Bacteria 1096
60 Ga0070704_100288304 3300005549 Bacteria 1363
61 Ga0070704_100516330 3300005549 Unclassified 1039
62 Ga0070704_100793705 3300005549 Unclassified 845
63 Ga0070704_100998275 3300005549 Unclassified 757
64 Ga0070664_101692073 3300005564 Unclassified 600
65 Ga0068857_100164579 3300005577 Unclassified 2014
66 Ga0068857_100188980 3300005577 Unclassified 1876
67 Ga0068857_100421441 3300005577 Unclassified 1245
68 Ga0068857_100853309 3300005577 Unclassified 871
69 Ga0068857_101142521 3300005577 Bacteria 753
70 Ga0068857_101334148 3300005577 Unclassified 697
71 Ga0068857_102252217 3300005577 Bacteria 535
72 Ga0068854_100034396 3300005578 Bacteria 3540
73 Ga0068854_100437162 3300005578 Unclassified 1090
74 Ga0068854_101093350 3300005578 Unclassified 710
75 Ga0068854_101192665 3300005578 Unclassified 682
76 Ga0068854_101312107 3300005578 Unclassified 652
77 Ga0068856_100849317 3300005614 Unclassified 932
78 Ga0070702_100050018 3300005615 Bacteria 2386
79 Ga0070702_100052540 3300005615 Unclassified 2337
80 Ga0070702_100823916 3300005615 Unclassified 720
81 Ga0068852_100343790 3300005616 Bacteria 1455
82 Ga0068852_100497934 3300005616 Unclassified 1213
83 Ga0068859_100021007 3300005617 Bacteria 6553
84 Ga0068859_100029056 3300005617 Bacteria 5547
85 Ga0068859_100039754 3300005617 Bacteria 4719
86 Ga0068859_100046381 3300005617 Unclassified 4364
87 Ga0068859_100059970 3300005617 Bacteria 3834
88 Ga0068859_100084852 3300005617 Bacteria 3212
89 Ga0068859_100109968 3300005617 Bacteria 2818
90 Ga0068859_100642850 3300005617 Bacteria 1153
91 Ga0068864_100294175 3300005618 Bacteria 1518
92 Ga0068864_100309405 3300005618 Bacteria 1481
93 Ga0068864_100397809 3300005618 Bacteria 1308
94 Ga0068864_100469980 3300005618 Bacteria 1205
95 Ga0068864_100812279 3300005618 Unclassified 920
96 Ga0068864_101324495 3300005618 Unclassified 721
97 Ga0068864_101523794 3300005618 Unclassified 672
98 Ga0068864_102280889 3300005618 Unclassified 548
99 Ga0068861_100340304 3300005719 Bacteria 1313
100 Ga0068861_100844374 3300005719 Unclassified 863
101 Ga0068861_102140194 3300005719 Unclassified 560
102 Ga0068870_10031073 3300005840 Bacteria 2703
103 Ga0068870_10138121 3300005840 Unclassified 1423
104 Ga0068870_10221536 3300005840 Unclassified 1158
105 Ga0068870_10600247 3300005840 Bacteria 748
106 Ga0068863_100033284 3300005841 Bacteria 4910
107 Ga0068863_100084831 3300005841 Bacteria 3001
108 Ga0068863_100639273 3300005841 Bacteria 1055
109 Ga0068863_101129327 3300005841 Unclassified 789
110 Ga0068863_101998321 3300005841 Unclassified 590
111 Ga0068858_100130574 3300005842 Bacteria 2355
112 Ga0068858_100301941 3300005842 Bacteria 1527
113 Ga0068858_101079687 3300005842 Unclassified 788
114 Ga0068858_101703135 3300005842 Unclassified 623
115 Ga0068860_100072399 3300005843 Bacteria 3275
116 Ga0068860_100195913 3300005843 Bacteria 1956
117 Ga0068860_100442153 3300005843 Bacteria 1292
118 Ga0068862_100423405 3300005844 Bacteria 1250
119 Ga0068862_101753359 3300005844 Unclassified 630
120 Ga0081539_10017977 3300005985 Unclassified 4932
121 Ga0075432_10080773 3300006058 Unclassified 1179
122 Ga0097621_100019331 3300006237 Bacteria 5226
123 Ga0068871_100381769 3300006358 Unclassified 1252
124 Ga0068871_100754251 3300006358 Unclassified 895
125 Ga0075430_100056532 3300006846 Bacteria 3299
126 Ga0075430_100782879 3300006846 Unclassified 786
127 Ga0075431_100303849 3300006847 Unclassified 1611
128 Ga0075433_10099325 3300006852 Unclassified 2577
129 Ga0075433_10286935 3300006852 Bacteria 1458
130 Ga0075429_100021642 3300006880 Bacteria 5574
131 Ga0068865_100351710 3300006881 Bacteria 1194
132 Ga0097620_100021008 3300006931 Bacteria 6553
133 Ga0097620_100029056 3300006931 Bacteria 5547
134 Ga0097620_100039752 3300006931 Bacteria 4719
135 Ga0097620_100046378 3300006931 Unclassified 4364
136 Ga0097620_100059971 3300006931 Bacteria 3834
137 Ga0097620_100084851 3300006931 Bacteria 3212
138 Ga0097620_100109968 3300006931 Bacteria 2818
139 Ga0097620_100642914 3300006931 Bacteria 1153
140 Ga0105240_10448584 3300009093 Bacteria 1444
141 Ga0111539_10002825 3300009094 Bacteria 23090
142 Ga0105247_10000395 3300009101 Bacteria 37015
143 Ga0114129_10447825 3300009147 Bacteria 1694
144 Ga0105243_10437905 3300009148 Unclassified 1223
145 Ga0105243_10500727 3300009148 Unclassified 1151
146 Ga0105243_11531918 3300009148 Unclassified 691
147 Ga0105241_10163900 3300009174 Bacteria 1830
148 Ga0105241_10291695 3300009174 Bacteria 1397
149 Ga0105248_10019845 3300009177 Bacteria 7444
150 Ga0105248_10024525 3300009177 Bacteria 6706
151 Ga0105248_10407440 3300009177 Bacteria 1531
152 Ga0105237_10003303 3300009545 Bacteria 19241
153 Ga0105238_10497742 3300009551 Bacteria 1219
154 Ga0105249_10775371 3300009553 Unclassified 1022
155 Ga0105249_12195056 3300009553 Unclassified 625
156 Ga0105246_10179057 3300011119 Bacteria 1630
157 Ga0105246_10209929 3300011119 Unclassified 1519
158 Ga0157373_10032555 3300013100 Bacteria 3752
159 Ga0163162_13311179 3300013306 Unclassified 516
160 Ga0163163_10111180 3300014325 Bacteria 2769
161 Ga0163163_10471083 3300014325 Bacteria 1317
162 Ga0157380_10508393 3300014326 Bacteria 1172
163 Ga0157380_10989356 3300014326 Bacteria 874
164 Ga0157379_10617631 3300014968 Unclassified 1013
165 Ga0207656_10001221 3300025321 Bacteria 8472
166 Ga0207653_10002444 3300025885 Bacteria 5903
167 Ga0207710_10000462 3300025900 Bacteria 26063
168 Ga0207710_10025850 3300025900 Bacteria 2535
169 Ga0207647_10144711 3300025904 Bacteria 1392
170 Ga0207647_10329755 3300025904 Unclassified 866
171 Ga0207645_10351983 3300025907 Unclassified 986
172 Ga0207645_10765991 3300025907 Unclassified 656
173 Ga0207643_10005592 3300025908 Bacteria 6717
174 Ga0207643_10008381 3300025908 Bacteria 5543
175 Ga0207643_10455451 3300025908 Unclassified 814
176 Ga0207654_10279508 3300025911 Bacteria 1129
177 Ga0207654_10640690 3300025911 Unclassified 760
178 Ga0207654_11359310 3300025911 Bacteria 518
179 Ga0207695_10015762 3300025913 Bacteria 8882
180 Ga0207695_10582480 3300025913 Bacteria 1000
181 Ga0207695_11409249 3300025913 Unclassified 577
182 Ga0207662_10064277 3300025918 Bacteria 2208
183 Ga0207662_10274061 3300025918 Unclassified 1114
184 Ga0207657_10368757 3300025919 Unclassified 1131
185 Ga0207649_11205604 3300025920 Unclassified 598
186 Ga0207681_10058148 3300025923 Bacteria 2646
187 Ga0207694_10002935 3300025924 Bacteria 13700
188 Ga0207694_10005801 3300025924 Bacteria 9460
189 Ga0207694_10354839 3300025924 Bacteria 1214
190 Ga0207650_11079554 3300025925 Unclassified 683
191 Ga0207687_11935782 3300025927 Unclassified 504
192 Ga0207690_10030073 3300025932 Bacteria 3460
193 Ga0207686_10111830 3300025934 Bacteria 1843
194 Ga0207709_10014317 3300025935 Unclassified 4378
195 Ga0207709_10078406 3300025935 Unclassified 2121
196 Ga0207709_10591175 3300025935 Unclassified 878
197 Ga0207709_10808442 3300025935 Unclassified 757
198 Ga0207709_10898387 3300025935 Unclassified 720
199 Ga0207709_11070739 3300025935 Unclassified 661
200 Ga0207670_10000999 3300025936 Bacteria 14954
201 Ga0207670_10648760 3300025936 Unclassified 870
202 Ga0207670_10667404 3300025936 Unclassified 858
203 Ga0207704_10664920 3300025938 Unclassified 859
204 Ga0207704_11284634 3300025938 Unclassified 625
205 Ga0207691_10545931 3300025940 Viruses 983
206 Ga0207711_10010747 3300025941 Bacteria 7614
207 Ga0207711_10174683 3300025941 Bacteria 1951
208 Ga0207711_10296308 3300025941 Bacteria 1491
209 Ga0207711_10669252 3300025941 Bacteria 968
210 Ga0207689_10068990 3300025942 Unclassified 2905
211 Ga0207689_10682283 3300025942 Unclassified 866
212 Ga0207679_10194281 3300025945 Unclassified 1690
213 Ga0207679_11027106 3300025945 Unclassified 756
214 Ga0207679_11179328 3300025945 Bacteria 703
215 Ga0207651_10359827 3300025960 Unclassified 1228
216 Ga0207651_11149408 3300025960 Bacteria 696
217 Ga0207712_10001717 3300025961 Bacteria 14702
218 Ga0207712_10945451 3300025961 Unclassified 763
219 Ga0207640_10093106 3300025981 Bacteria 2093
220 Ga0207640_10120325 3300025981 Bacteria 1879
221 Ga0207640_10420383 3300025981 Unclassified 1094
222 Ga0207640_10445904 3300025981 Unclassified 1065
223 Ga0207640_10868047 3300025981 Unclassified 786
224 Ga0207703_10179323 3300026035 Bacteria 1869
225 Ga0207703_10341629 3300026035 Bacteria 1376
226 Ga0207703_10345895 3300026035 Bacteria 1368
227 Ga0207703_10440143 3300026035 Bacteria 1216
228 Ga0207703_11030666 3300026035 Unclassified 790
229 Ga0207703_11399923 3300026035 Bacteria 673
230 Ga0207639_10170545 3300026041 Unclassified 1842
231 Ga0207639_10744472 3300026041 Unclassified 911
232 Ga0207708_10000085 3300026075 Bacteria 73335
233 Ga0207708_10009030 3300026075 Bacteria 7374
234 Ga0207708_10043055 3300026075 Bacteria 3441
235 Ga0207708_10339677 3300026075 Unclassified 1230
236 Ga0207708_10351723 3300026075 Unclassified 1209
237 Ga0207708_10443863 3300026075 Unclassified 1079
238 Ga0207641_10229963 3300026088 Bacteria 1723
239 Ga0207641_11624694 3300026088 Unclassified 648
240 Ga0207648_10061496 3300026089 Unclassified 3274
241 Ga0207648_10346421 3300026089 Unclassified 1339
242 Ga0207648_10997757 3300026089 Unclassified 784
243 Ga0207676_10003439 3300026095 Bacteria 11200
244 Ga0207676_10258299 3300026095 Unclassified 1571
245 Ga0207676_10434851 3300026095 Unclassified 1234
246 Ga0207676_10493487 3300026095 Unclassified 1161
247 Ga0207676_10627166 3300026095 Bacteria 1035
248 Ga0207676_10632523 3300026095 Bacteria 1031
249 Ga0207676_11911151 3300026095 Unclassified 592
250 Ga0207676_11919116 3300026095 Unclassified 591
251 Ga0207676_12095644 3300026095 Unclassified 564
252 Ga0207674_10086589 3300026116 Bacteria 3127
253 Ga0207674_10211177 3300026116 Bacteria 1890
254 Ga0207674_10311475 3300026116 Bacteria 1523
255 Ga0207674_10431581 3300026116 Bacteria 1273
256 Ga0207674_10539821 3300026116 Bacteria 1126
257 Ga0207674_10799986 3300026116 Unclassified 910
258 Ga0207675_100067160 3300026118 Unclassified 3352
259 Ga0207675_101239219 3300026118 Unclassified 766
260 Ga0207675_101311313 3300026118 Unclassified 744
261 Ga0207698_10160171 3300026142 Bacteria 1967
262 Ga0207698_10881319 3300026142 Unclassified 901
263 Ga0207698_11656763 3300026142 Bacteria 655
264 Ga0207428_10003127 3300027907 Bacteria 16233
265 Ga0268265_10388454 3300028380 Unclassified 1286
266 Ga0268265_11957140 3300028380 Unclassified 593
267 Ga0268264_10140278 3300028381 Bacteria 2154
268 Ga0268264_10675454 3300028381 Bacteria 1024
269 Ga0268264_10819606 3300028381 Bacteria 931
270 Ga0268264_11641956 3300028381 Unclassified 653
271 Ga0307408_100232817 3300031548 Bacteria 1510
272 Ga0307408_100806438 3300031548 Unclassified 852
273 Ga0307405_10126052 3300031731 Unclassified 1761
274 Ga0307405_10295339 3300031731 Bacteria 1226
275 Ga0307413_10600252 3300031824 Unclassified 901
276 Ga0307406_10571403 3300031901 Unclassified 928
277 Ga0307406_10989811 3300031901 Unclassified 721
278 Ga0307407_10693585 3300031903 Unclassified 766
279 Ga0307412_10020706 3300031911 Bacteria 4006
280 Ga0307412_10234617 3300031911 Bacteria 1415
281 Ga0307409_100284635 3300031995 Bacteria 1530
282 Ga0307416_100114850 3300032002 Bacteria 2383
283 Ga0307416_100528127 3300032002 Unclassified 1249
284 Ga0307414_10197336 3300032004 Bacteria 1634
285 Ga0307414_10330930 3300032004 Unclassified 1300
286 Ga0307415_100402873 3300032126 Bacteria 1168
287 Ga0307415_100439331 3300032126 Unclassified 1125
288 Ga0373951_0002143 3300035091 Bacteria 5037
289 Ga0373941_0243981 3300035115 Unclassified 699
290 Ga0395898_0090710 3300037466 Bacteria 2941
291 Ga0395898_0144966 3300037466 Bacteria 2273
292 Ga0395905_1200567 3300037471 Unclassified 662
293 Ga0395901_1299638 3300038443 Unclassified 689
294 Ga0451576_0276881 3300045051 Bacteria 1754
295 Ga0496106_0132262 3300048909 Bacteria 1957
296 Ga0496108_0436729 3300048911 Unclassified 1143
297 Ga0496109_0514662 3300048912 Bacteria 1130
298 Ga0496110_1661797 3300048913 Unclassified 549
299 Ga0496112_0164743 3300048915 Bacteria 2183
300 Ga0496112_0898061 3300048915 Unclassified 808
301 Ga0496113_0957323 3300048916 Unclassified 675
302 nmdc:mga05p37_136133_c1 3300050507 Unclassified 3012
303 nmdc:mga0qj67_677466_c1 3300050509 Unclassified 821
304 nmdc:mga0n895_27592_c1 3300050512 Bacteria 5396
305 nmdc:mga0a205_410572_c1 3300050515 Unclassified 1217
306 nmdc:mga0a205_71471_c1 3300050515 Unclassified 3351
307 Ga0207703_10673577
308 SwRhRL2b_contig_2675828
309 SwRhRL2b_contig_3244076
310 Ga0065704_10111468
311 Ga0065704_10714531
312 Ga0065712_10005928
313 Ga0065712_10010045
314 Ga0065715_10097374
315 Ga0065715_10117909
316 Ga0065715_10157161
317 Ga0065715_10190947
318 Ga0065715_10582235
319 Ga0065715_10593468
320 Ga0065715_10975233
321 Ga0065707_10013403
322 Ga0065707_10094399
323 Ga0070690_100076876
324 Ga0070690_101108852
325 Ga0070670_100000288
326 Ga0070670_100230016
327 Ga0070670_100388670
328 Ga0070670_100863061
329 Ga0068869_100232221
330 Ga0070680_101254579
331 Ga0070660_100434397
332 Ga0070689_100000914
333 Ga0070689_100562472
334 Ga0070689_102224629
335 Ga0070687_100053489
336 Ga0070692_10049624
337 Ga0070692_10617165
338 Ga0070675_100921860
339 Ga0070671_100396636
340 Ga0070673_100237121
341 Ga0070673_100451214
342 Ga0070673_100904277
343 Ga0070659_100725176
344 Ga0070703_10013621
345 Ga0070703_10272641
346 Ga0070701_10352355
347 Ga0070700_100000107
348 Ga0070700_100059163
349 Ga0070700_100127729
350 Ga0070700_100205901
351 Ga0070700_100329135
352 Ga0070700_100351743
353 Ga0070700_100611991
354 Ga0070694_100033240
355 Ga0070694_100199178
356 Ga0068867_100046568
357 Ga0068867_100957670
358 Ga0070699_100032493
359 Ga0070699_101622397
360 Ga0068853_100004644
361 Ga0068853_101045836
362 Ga0070695_100461307
363 Ga0070695_100835237
364 Ga0070693_100037458
365 Ga0070693_100291963
366 Ga0070704_100288304
367 Ga0070704_100516330
368 Ga0070704_100793705
369 Ga0070704_100998275
370 Ga0070664_101692073
371 Ga0068857_100164579
372 Ga0068857_100188980
373 Ga0068857_100421441
374 Ga0068857_100853309
375 Ga0068857_101142521
376 Ga0068857_101334148
377 Ga0068857_102252217
378 Ga0068854_100034396
379 Ga0068854_100437162
380 Ga0068854_101093350
381 Ga0068854_101192665
382 Ga0068854_101312107
383 Ga0068856_100849317
384 Ga0070702_100050018
385 Ga0070702_100052540
386 Ga0070702_100823916
387 Ga0068852_100343790
388 Ga0068852_100497934
389 Ga0068859_100021007
390 Ga0068859_100029056
391 Ga0068859_100039754
392 Ga0068859_100046381
393 Ga0068859_100059970
394 Ga0068859_100084852
395 Ga0068859_100109968
396 Ga0068859_100642850
397 Ga0068864_100294175
398 Ga0068864_100309405
399 Ga0068864_100397809
400 Ga0068864_100469980
401 Ga0068864_100812279
402 Ga0068864_101324495
403 Ga0068864_101523794
404 Ga0068864_102280889
405 Ga0068861_100340304
406 Ga0068861_100844374
407 Ga0068861_102140194
408 Ga0068870_10031073
409 Ga0068870_10138121
410 Ga0068870_10221536
411 Ga0068870_10600247
412 Ga0068863_100033284
413 Ga0068863_100084831
414 Ga0068863_100639273
415 Ga0068863_101129327
416 Ga0068863_101998321
417 Ga0068858_100130574
418 Ga0068858_100301941
419 Ga0068858_101079687
420 Ga0068858_101703135
421 Ga0068860_100072399
422 Ga0068860_100195913
423 Ga0068860_100442153
424 Ga0068862_100423405
425 Ga0068862_101753359
426 Ga0081539_10017977
427 Ga0075432_10080773
428 Ga0097621_100019331
429 Ga0068871_100381769
430 Ga0068871_100754251
431 Ga0075430_100056532
432 Ga0075430_100782879
433 Ga0075431_100303849
434 Ga0075433_10099325
435 Ga0075433_10286935
436 Ga0075429_100021642
437 Ga0068865_100351710
438 Ga0097620_100021008
439 Ga0097620_100029056
440 Ga0097620_100039752
441 Ga0097620_100046378
442 Ga0097620_100059971
443 Ga0097620_100084851
444 Ga0097620_100109968
445 Ga0097620_100642914
446 Ga0105240_10448584
447 Ga0111539_10002825
448 Ga0105247_10000395
449 Ga0114129_10447825
450 Ga0105243_10437905
451 Ga0105243_10500727
452 Ga0105243_11531918
453 Ga0105241_10163900
454 Ga0105241_10291695
455 Ga0105248_10019845
456 Ga0105248_10024525
457 Ga0105248_10407440
458 Ga0105237_10003303
459 Ga0105238_10497742
460 Ga0105249_10775371
461 Ga0105249_12195056
462 Ga0105246_10179057
463 Ga0105246_10209929
464 Ga0157373_10032555
465 Ga0163162_13311179
466 Ga0163163_10111180
467 Ga0163163_10471083
468 Ga0157380_10508393
469 Ga0157380_10989356
470 Ga0157379_10617631
471 Ga0207656_10001221
472 Ga0207653_10002444
473 Ga0207710_10000462
474 Ga0207710_10025850
475 Ga0207647_10144711
476 Ga0207647_10329755
477 Ga0207645_10351983
478 Ga0207645_10765991
479 Ga0207643_10005592
480 Ga0207643_10008381
481 Ga0207643_10455451
482 Ga0207654_10279508
483 Ga0207654_10640690
484 Ga0207654_11359310
485 Ga0207695_10015762
486 Ga0207695_10582480
487 Ga0207695_11409249
488 Ga0207662_10064277
489 Ga0207662_10274061
490 Ga0207657_10368757
491 Ga0207649_11205604
492 Ga0207681_10058148
493 Ga0207694_10002935
494 Ga0207694_10005801
495 Ga0207694_10354839
496 Ga0207650_11079554
497 Ga0207687_11935782
498 Ga0207690_10030073
499 Ga0207686_10111830
500 Ga0207709_10014317
501 Ga0207709_10078406
502 Ga0207709_10591175
503 Ga0207709_10808442
504 Ga0207709_10898387
505 Ga0207709_11070739
506 Ga0207670_10000999
507 Ga0207670_10648760
508 Ga0207670_10667404
509 Ga0207704_10664920
510 Ga0207704_11284634
511 Ga0207691_10545931
512 Ga0207711_10010747
513 Ga0207711_10174683
514 Ga0207711_10296308
515 Ga0207711_10669252
516 Ga0207689_10068990
517 Ga0207689_10682283
518 Ga0207679_10194281
519 Ga0207679_11027106
520 Ga0207679_11179328
521 Ga0207651_10359827
522 Ga0207651_11149408
523 Ga0207712_10001717
524 Ga0207712_10945451
525 Ga0207640_10093106
526 Ga0207640_10120325
527 Ga0207640_10420383
528 Ga0207640_10445904
529 Ga0207640_10868047
530 Ga0207703_10179323
531 Ga0207703_10341629
532 Ga0207703_10345895
533 Ga0207703_10440143
534 Ga0207703_11030666
535 Ga0207703_11399923
536 Ga0207639_10170545
537 Ga0207639_10744472
538 Ga0207708_10000085
539 Ga0207708_10009030
540 Ga0207708_10043055
541 Ga0207708_10339677
542 Ga0207708_10351723
543 Ga0207708_10443863
544 Ga0207641_10229963
545 Ga0207641_11624694
546 Ga0207648_10061496
547 Ga0207648_10346421
548 Ga0207648_10997757
549 Ga0207676_10003439
550 Ga0207676_10258299
551 Ga0207676_10434851
552 Ga0207676_10493487
553 Ga0207676_10627166
554 Ga0207676_10632523
555 Ga0207676_11911151
556 Ga0207676_11919116
557 Ga0207676_12095644
558 Ga0207674_10086589
559 Ga0207674_10211177
560 Ga0207674_10311475
561 Ga0207674_10431581
562 Ga0207674_10539821
563 Ga0207674_10799986
564 Ga0207675_100067160
565 Ga0207675_101239219
566 Ga0207675_101311313
567 Ga0207698_10160171
568 Ga0207698_10881319
569 Ga0207698_11656763
570 Ga0207428_10003127
571 Ga0268265_10388454
572 Ga0268265_11957140
573 Ga0268264_10140278
574 Ga0268264_10675454
575 Ga0268264_10819606
576 Ga0268264_11641956
577 Ga0307408_100232817
578 Ga0307408_100806438
579 Ga0307405_10126052
580 Ga0307405_10295339
581 Ga0307413_10600252
582 Ga0307406_10571403
583 Ga0307406_10989811
584 Ga0307407_10693585
585 Ga0307412_10020706
586 Ga0307412_10234617
587 Ga0307409_100284635
588 Ga0307416_100114850
589 Ga0307416_100528127
590 Ga0307414_10197336
591 Ga0307414_10330930
592 Ga0307415_100402873
593 Ga0307415_100439331
594 Ga0373951_0002143
595 Ga0373941_0243981
596 Ga0395898_0090710
597 Ga0395898_0144966
598 Ga0395905_1200567
599 Ga0395901_1299638
600 Ga0451576_0276881
601 Ga0496106_0132262
602 Ga0496108_0436729
603 Ga0496109_0514662
604 Ga0496110_1661797
605 Ga0496112_0164743
606 Ga0496112_0898061
607 Ga0496113_0957323
608 nmdc:mga05p37_136133_c1
609 nmdc:mga0qj67_677466_c1
610 nmdc:mga0n895_27592_c1
611 nmdc:mga0a205_410572_c1
612 nmdc:mga0a205_71471_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

43

161

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vx6-assembly2.cif.gz_B structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.7191 19 136
2gjg-assembly1.cif.gz_A-2 crystal structure of a pilz-containing protein (pp4397) from pseudomonas putida kt2440 at 2.25 a resolution 0.7026 27 137
5vx6-assembly1.cif.gz_A structure of bacillus subtilis inhibitor of motility (moti/dgra) 0.7019 19 136
5y6f-assembly1.cif.gz_A crystal structure of ycgr in complex with c-di-gmp from escherichia coli 0.674 20 137
5kec-assembly3.cif.gz_D structure of k. pneumonia mrkh in its apo state. 0.6613 17 138
ID Description Score Start End Superfamily
5y4rC00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.7043 19 140 2.40.10.220
5kedC02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6634 20 138 2.40.10.220
3kyfA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6621 21 140 2.40.10.220
3kyfA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6573 21 140 2.40.10.220
af_P37653_690_796_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.6377 17 132 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A7W1QQZ0-F1-model_v4 PilZ domain-containing protein 0.8033 29 137 GO:0035438
AF-A0A1J5IQ19-F1-model_v4 PilZ domain-containing protein 0.8005 54 135
AF-A0A1G3PPC7-F1-model_v4 PilZ domain-containing protein 0.794 47 138 GO:0035438
AF-A0A7W1QQZ0-F1-model_v4 PilZ domain-containing protein 0.7898 29 137 GO:0035438
AF-A0A1G1NHA5-F1-model_v4 PilZ domain-containing protein 0.787 34 137 GO:0035438

Map