F398711

General Info

Members Datasets Scaffolds Average Seq Length
306 186 612 111

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10200267|Ga0207665_102002672
Length 129
Sequence MTDLATAGVRTLGPSDAIPDDLVVAYYVDDRKLRISIARVGDRLYAFDDLCRCGDAPCPLSGGLLTGTTLMCQCHGSRFDITTGAVLNGPALASLEGYEVREVNGAIQIRARCDHADDTRPIGQGHDNL

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
66 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
149 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 12.75
Rhizosphere 80.72
Stem 0
Stem Tuber 0
Unclassified 14.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10200267 3300025939 Bacteria 1454
2 JGI24737J22298_10052885 3300001990 Bacteria 1231
3 JGI24742J22300_10107611 3300002244 Bacteria 543
4 Ga0070683_100526247 3300005329 Bacteria 1130
5 Ga0070683_100688413 3300005329 Bacteria 979
6 Ga0070690_101633431 3300005330 Unclassified 523
7 Ga0070682_100071042 3300005337 Bacteria 2227
8 Ga0070682_100264673 3300005337 Bacteria 1246
9 Ga0068868_100019696 3300005338 Bacteria 5059
10 Ga0068868_100164568 3300005338 Bacteria 1834
11 Ga0068868_100383880 3300005338 Bacteria 1209
12 Ga0068868_101668621 3300005338 Bacteria 600
13 Ga0070660_101086804 3300005339 Bacteria 677
14 Ga0070689_100200287 3300005340 Bacteria 1630
15 Ga0070689_100283262 3300005340 Unclassified 1375
16 Ga0070687_100070516 3300005343 Bacteria 1875
17 Ga0070687_100673518 3300005343 Bacteria 719
18 Ga0070661_100307092 3300005344 Bacteria 1236
19 Ga0070668_100087388 3300005347 Bacteria 2453
20 Ga0070669_100277464 3300005353 Bacteria 1342
21 Ga0070688_100114990 3300005365 Bacteria 1795
22 Ga0070667_100684637 3300005367 Bacteria 948
23 Ga0070709_10232742 3300005434 Bacteria 1319
24 Ga0070714_100174874 3300005435 Unclassified 1950
25 Ga0070713_100142018 3300005436 Bacteria 2128
26 Ga0070713_100616259 3300005436 Bacteria 1032
27 Ga0070710_10123543 3300005437 Bacteria 1570
28 Ga0070701_10043774 3300005438 Bacteria 2292
29 Ga0070711_101125044 3300005439 Unclassified 677
30 Ga0070705_100685771 3300005440 Unclassified 803
31 Ga0070708_100060116 3300005445 Bacteria 3391
32 Ga0070662_100045813 3300005457 Bacteria 3140
33 Ga0068867_100297578 3300005459 Bacteria 1329
34 Ga0068867_101058565 3300005459 Bacteria 738
35 Ga0070685_10067867 3300005466 Bacteria 2105
36 Ga0070685_10474958 3300005466 Bacteria 880
37 Ga0070707_100042362 3300005468 Bacteria 4359
38 Ga0070707_100130765 3300005468 Bacteria 2441
39 Ga0070698_100183616 3300005471 Unclassified 2030
40 Ga0068853_100267609 3300005539 Bacteria 1573
41 Ga0070686_100082375 3300005544 Bacteria 2134
42 Ga0070686_100973713 3300005544 Unclassified 694
43 Ga0070696_100209885 3300005546 Unclassified 1457
44 Ga0070693_100449696 3300005547 Bacteria 904
45 Ga0070665_100920973 3300005548 Bacteria 887
46 Ga0070664_101179543 3300005564 Bacteria 722
47 Ga0068854_100553476 3300005578 Bacteria 976
48 Ga0068854_101575812 3300005578 Bacteria 598
49 Ga0068856_100697853 3300005614 Bacteria 1035
50 Ga0068856_100916718 3300005614 Bacteria 895
51 Ga0068856_101820568 3300005614 Bacteria 620
52 Ga0070702_100002101 3300005615 Bacteria 8456
53 Ga0070702_100142315 3300005615 Bacteria 1529
54 Ga0068852_100445416 3300005616 Bacteria 1281
55 Ga0068852_101502320 3300005616 Bacteria 696
56 Ga0068859_100129157 3300005617 Bacteria 2598
57 Ga0068866_10312584 3300005718 Bacteria 985
58 Ga0068861_100004792 3300005719 Bacteria 9092
59 Ga0068861_100504578 3300005719 Bacteria 1094
60 Ga0068858_100023781 3300005842 Bacteria 5709
61 Ga0081540_1025635 3300005983 Bacteria 3387
62 Ga0070717_10048622 3300006028 Bacteria 3480
63 Ga0070717_10171081 3300006028 Unclassified 1889
64 Ga0070717_10429689 3300006028 Unclassified 1188
65 Ga0070717_10575435 3300006028 Unclassified 1021
66 Ga0075363_100484944 3300006048 Bacteria 733
67 Ga0070716_101550607 3300006173 Bacteria 543
68 Ga0070716_101762679 3300006173 Unclassified 512
69 Ga0070712_100022409 3300006175 Bacteria 4162
70 Ga0068871_101754551 3300006358 Unclassified 589
71 Ga0075428_100494725 3300006844 Bacteria 1308
72 Ga0075428_102051036 3300006844 Unclassified 592
73 Ga0075430_100097654 3300006846 Bacteria 2454
74 Ga0075431_100471116 3300006847 Bacteria 1250
75 Ga0075429_100890731 3300006880 Bacteria 779
76 Ga0068865_100057817 3300006881 Bacteria 2707
77 Ga0097620_100129162 3300006931 Bacteria 2598
78 Ga0075435_100279031 3300007076 Bacteria 1426
79 Ga0075435_101471867 3300007076 Bacteria 597
80 Ga0111539_10062960 3300009094 Bacteria 4390
81 Ga0111539_10257617 3300009094 Bacteria 2031
82 Ga0111539_10765924 3300009094 Bacteria 1123
83 Ga0105245_10004422 3300009098 Bacteria 12434
84 Ga0105245_10005493 3300009098 Bacteria 11135
85 Ga0105245_10162313 3300009098 Bacteria 2121
86 Ga0105245_10444934 3300009098 Bacteria 1303
87 Ga0105245_11421096 3300009098 Unclassified 744
88 Ga0105247_10034488 3300009101 Bacteria 3082
89 Ga0105247_10173497 3300009101 Bacteria 1435
90 Ga0105247_11486973 3300009101 Unclassified 552
91 Ga0105247_11512959 3300009101 Bacteria 548
92 Ga0114129_10198912 3300009147 Bacteria 2715
93 Ga0105243_12542554 3300009148 Bacteria 551
94 Ga0105242_10074048 3300009176 Bacteria 2833
95 Ga0105242_10620428 3300009176 Bacteria 1047
96 Ga0105248_10223124 3300009177 Bacteria 2122
97 Ga0105248_12233217 3300009177 Bacteria 623
98 Ga0105249_10063251 3300009553 Bacteria 3399
99 Ga0105249_10174588 3300009553 Bacteria 2086
100 Ga0105249_10474943 3300009553 Bacteria 1292
101 Ga0105249_10676128 3300009553 Bacteria 1091
102 Ga0105249_11802361 3300009553 Bacteria 685
103 Ga0105239_10012820 3300010375 Bacteria 9326
104 Ga0105239_10452868 3300010375 Bacteria 1456
105 Ga0105239_10927266 3300010375 Bacteria 1000
106 Ga0105239_11085611 3300010375 Bacteria 921
107 Ga0105239_11506045 3300010375 Bacteria 777
108 Ga0157324_1056954 3300012506 Unclassified 524
109 Ga0157327_1027259 3300012512 Bacteria 689
110 Ga0157369_11222143 3300013105 Bacteria 767
111 Ga0157374_10123282 3300013296 Bacteria 2503
112 Ga0157378_10036531 3300013297 Bacteria 4347
113 Ga0157378_10809234 3300013297 Bacteria 963
114 Ga0163162_10025126 3300013306 Bacteria 5887
115 Ga0163162_10385896 3300013306 Bacteria 1534
116 Ga0163162_10632071 3300013306 Bacteria 1195
117 Ga0163162_11237622 3300013306 Bacteria 847
118 Ga0157375_10062994 3300013308 Bacteria 3687
119 Ga0163163_10678448 3300014325 Bacteria 1094
120 Ga0157380_10392255 3300014326 Bacteria 1314
121 Ga0182008_10590593 3300014497 Bacteria 622
122 Ga0157377_10076831 3300014745 Bacteria 1943
123 Ga0206349_1204384 3300020075 Unclassified 639
124 Ga0213874_10421434 3300021377 Unclassified 522
125 Ga0213876_10003849 3300021384 Bacteria 8497
126 Ga0213875_10164863 3300021388 Bacteria 1040
127 Ga0213875_10226205 3300021388 Bacteria 881
128 Ga0207656_10424112 3300025321 Bacteria 670
129 Ga0207653_10302785 3300025885 Bacteria 620
130 Ga0207692_10197367 3300025898 Unclassified 1181
131 Ga0207642_10189240 3300025899 Bacteria 1128
132 Ga0207642_10456825 3300025899 Bacteria 775
133 Ga0207710_10011883 3300025900 Bacteria 3663
134 Ga0207688_10142509 3300025901 Bacteria 1411
135 Ga0207688_10338553 3300025901 Bacteria 925
136 Ga0207647_10033413 3300025904 Bacteria 3294
137 Ga0207647_10410332 3300025904 Bacteria 762
138 Ga0207647_10529207 3300025904 Unclassified 655
139 Ga0207643_10307779 3300025908 Bacteria 987
140 Ga0207705_10224751 3300025909 Bacteria 1427
141 Ga0207671_10517927 3300025914 Unclassified 951
142 Ga0207693_10081188 3300025915 Bacteria 2538
143 Ga0207662_10016582 3300025918 Bacteria 4159
144 Ga0207662_11375764 3300025918 Bacteria 501
145 Ga0207657_10110888 3300025919 Bacteria 2266
146 Ga0207649_10423576 3300025920 Bacteria 1000
147 Ga0207646_10051733 3300025922 Bacteria 3675
148 Ga0207646_10107584 3300025922 Bacteria 2501
149 Ga0207646_10246970 3300025922 Bacteria 1612
150 Ga0207681_10371825 3300025923 Unclassified 1149
151 Ga0207681_10434165 3300025923 Bacteria 1066
152 Ga0207659_11267560 3300025926 Bacteria 633
153 Ga0207687_10112820 3300025927 Bacteria 2021
154 Ga0207687_10143715 3300025927 Bacteria 1813
155 Ga0207700_10089516 3300025928 Bacteria 2426
156 Ga0207664_10152134 3300025929 Unclassified 1966
157 Ga0207664_11825199 3300025929 Unclassified 530
158 Ga0207706_10000575 3300025933 Bacteria 39106
159 Ga0207686_10079814 3300025934 Bacteria 2132
160 Ga0207686_10644604 3300025934 Bacteria 838
161 Ga0207686_11351513 3300025934 Bacteria 586
162 Ga0207709_10003020 3300025935 Bacteria 10230
163 Ga0207670_10088218 3300025936 Bacteria 2187
164 Ga0207669_11283774 3300025937 Bacteria 622
165 Ga0207704_10175595 3300025938 Bacteria 1542
166 Ga0207711_10138606 3300025941 Bacteria 2187
167 Ga0207661_10524440 3300025944 Bacteria 1084
168 Ga0207661_10535617 3300025944 Bacteria 1072
169 Ga0207679_10354848 3300025945 Bacteria 1279
170 Ga0207712_10033691 3300025961 Bacteria 3465
171 Ga0207712_10581550 3300025961 Bacteria 967
172 Ga0207712_10594628 3300025961 Bacteria 956
173 Ga0207712_10820770 3300025961 Bacteria 818
174 Ga0207668_10019597 3300025972 Bacteria 4279
175 Ga0207640_10075781 3300025981 Bacteria 2281
176 Ga0207640_11192570 3300025981 Bacteria 677
177 Ga0207658_11308423 3300025986 Unclassified 663
178 Ga0207677_10051918 3300026023 Bacteria 2782
179 Ga0207677_10817058 3300026023 Bacteria 835
180 Ga0207677_11299006 3300026023 Bacteria 668
181 Ga0207703_10266271 3300026035 Bacteria 1551
182 Ga0207639_10231193 3300026041 Bacteria 1603
183 Ga0207708_10008515 3300026075 Bacteria 7594
184 Ga0207708_10085722 3300026075 Bacteria 2423
185 Ga0207708_10259742 3300026075 Bacteria 1402
186 Ga0207702_12185548 3300026078 Unclassified 542
187 Ga0207648_10140157 3300026089 Bacteria 2131
188 Ga0207648_11925088 3300026089 Bacteria 553
189 Ga0207676_10154916 3300026095 Bacteria 1978
190 Ga0207676_10700196 3300026095 Bacteria 981
191 Ga0207674_12089299 3300026116 Bacteria 531
192 Ga0207675_100008806 3300026118 Bacteria 9472
193 Ga0207698_10669610 3300026142 Bacteria 1030
194 Ga0207428_10253793 3300027907 Bacteria 1311
195 Ga0207428_10645406 3300027907 Bacteria 760
196 Ga0268266_10222702 3300028379 Bacteria 1735
197 Ga0268265_11972225 3300028380 Unclassified 591
198 Ga0268264_10758428 3300028381 Bacteria 967
199 Ga0373938_0210325 3300034957 Bacteria 542
200 Ga0373944_0370093 3300035089 Unclassified 548
201 Ga0373932_0105326 3300035112 Bacteria 923
202 Ga0373939_0234580 3300035114 Bacteria 708
203 Ga0373942_0230442 3300035207 Bacteria 624
204 Ga0373962_0021471 3300035242 Bacteria 1704
205 Ga0373931_0433645 3300035691 Bacteria 838
206 Ga0395899_0438982 3300037312 Bacteria 857
207 Ga0395900_0006308 3300037418 Bacteria 12368
208 Ga0395900_0511657 3300037418 Bacteria 1150
209 Ga0395898_0007368 3300037466 Bacteria 11677
210 Ga0395898_0156316 3300037466 Unclassified 2181
211 Ga0395898_0563322 3300037466 Bacteria 1082
212 Ga0395898_1261550 3300037466 Bacteria 669
213 Ga0395898_1373163 3300037466 Unclassified 635
214 Ga0395905_0007843 3300037471 Bacteria 10576
215 Ga0395905_0675328 3300037471 Bacteria 935
216 Ga0395905_1547068 3300037471 Unclassified 568
217 Ga0436364_0021564 3300037853 Bacteria 1076
218 Ga0436364_0431017 3300037853 Bacteria 22054
219 Ga0436364_0861689 3300037853 Bacteria 1460
220 Ga0436364_1138185 3300037853 Bacteria 1281
221 Ga0395901_0002956 3300038443 Bacteria 17152
222 Ga0395901_0336211 3300038443 Bacteria 1561
223 Ga0395901_0419176 3300038443 Bacteria 1373
224 Ga0395901_0465592 3300038443 Bacteria 1291
225 Ga0395901_0617105 3300038443 Bacteria 1092
226 Ga0436365_0240871 3300039437 Bacteria 1409
227 Ga0436365_0846492 3300039437 Bacteria 2743
228 Ga0436365_0946849 3300039437 Bacteria 13502
229 Ga0436365_0986683 3300039437 Bacteria 32616
230 Ga0436365_1599748 3300039437 Bacteria 1674
231 Ga0436365_1646868 3300039437 Bacteria 946
232 Ga0436360_1356190 3300039438 Bacteria 1088
233 Ga0436363_0053179 3300039450 Bacteria 1233
234 Ga0436363_0348208 3300039450 Unclassified 519
235 Ga0436363_0387148 3300039450 Bacteria 1018
236 Ga0436362_0565652 3300039453 Unclassified 512
237 Ga0436362_1273927 3300039453 Bacteria 1538
238 Ga0451793_1821137 3300041452 Unclassified 750
239 Ga0451855_1247367 3300041511 Unclassified 558
240 Ga0451853_1962303 3300041512 Bacteria 663
241 Ga0439448_0218390 3300042005 Bacteria 670
242 Ga0439463_049539 3300042016 Bacteria 1071
243 Ga0450888_015618 3300042126 Unclassified 929
244 Ga0466963_0025199 3300044694 Bacteria 3791
245 Ga0466967_0188106 3300045976 Unclassified 1950
246 Ga0466967_0980636 3300045976 Bacteria 841
247 Ga0466967_1051891 3300045976 Bacteria 811
248 Ga0495652_0580607 3300046529 Unclassified 767
249 Ga0495674_0678437 3300047319 Bacteria 810
250 Ga0495602_0598031 3300048088 Unclassified 759
251 Ga0496100_0000884 3300048903 Bacteria 14292
252 Ga0496101_0003611 3300048904 Bacteria 9652
253 Ga0496101_0044416 3300048904 Bacteria 3180
254 Ga0496101_0663100 3300048904 Bacteria 824
255 Ga0496102_0009798 3300048905 Bacteria 8237
256 Ga0496102_0010859 3300048905 Bacteria 7839
257 Ga0496102_1140161 3300048905 Bacteria 699
258 Ga0496103_0022098 3300048906 Bacteria 3830
259 Ga0496104_0176088 3300048907 Bacteria 2049
260 Ga0496105_0770454 3300048908 Unclassified 734
261 Ga0496106_0006559 3300048909 Bacteria 8620
262 Ga0496106_0025283 3300048909 Bacteria 4418
263 Ga0496107_0000185 3300048910 Bacteria 32424
264 Ga0496107_0043522 3300048910 Bacteria 3226
265 Ga0496108_0026804 3300048911 Bacteria 4756
266 Ga0496108_0050371 3300048911 Bacteria 3486
267 Ga0496108_0107035 3300048911 Bacteria 2387
268 Ga0496108_0316069 3300048911 Bacteria 1361
269 Ga0496109_0048233 3300048912 Bacteria 3875
270 Ga0496109_0313809 3300048912 Bacteria 1479
271 Ga0496109_0901647 3300048912 Bacteria 822
272 Ga0496110_0042485 3300048913 Bacteria 3968
273 Ga0496110_0056874 3300048913 Bacteria 3442
274 Ga0496110_1628561 3300048913 Bacteria 555
275 Ga0496111_0286765 3300048914 Bacteria 1221
276 Ga0496111_0290111 3300048914 Bacteria 1213
277 Ga0496111_0695771 3300048914 Bacteria 740
278 Ga0496112_0188342 3300048915 Bacteria 2026
279 Ga0496112_0225075 3300048915 Bacteria 1831
280 Ga0496112_0434795 3300048915 Bacteria 1250
281 Ga0496112_0702830 3300048915 Bacteria 939
282 Ga0496113_0038676 3300048916 Bacteria 3508
283 Ga0496113_0281747 3300048916 Bacteria 1329
284 Ga0496113_0490863 3300048916 Bacteria 986
285 Ga0496114_0144281 3300048917 Bacteria 2063
286 Ga0496114_0394619 3300048917 Bacteria 1225
287 Ga0496114_1261807 3300048917 Unclassified 625
288 Ga0496115_0188603 3300048918 Bacteria 1704
289 Ga0501041_0169079 3300049577 Bacteria 1368
290 Ga0501046_0762067 3300049580 Unclassified 680
291 Ga0501072_0865788 3300049588 Bacteria 706
292 Ga0501075_0647293 3300049591 Bacteria 806
293 Ga0501076_0284377 3300049592 Bacteria 1355
294 Ga0501077_0061654 3300049593 Bacteria 2380
295 Ga0501081_0167217 3300049743 Bacteria 1587
296 nmdc:mga05p37_1044674_c1 3300050507 Bacteria 862
297 nmdc:mga09592_350565_c1 3300050508 Bacteria 1277
298 nmdc:mga0qj67_301504_c1 3300050509 Bacteria 1298
299 nmdc:mga08y16_1084235_c1 3300050511 Bacteria 777
300 nmdc:mga08y16_317965_c1 3300050511 Bacteria 1603
301 nmdc:mga08y16_456264_c1 3300050511 Bacteria 1303
302 nmdc:mga0rr50_265731_c1 3300050513 Bacteria 1428
303 nmdc:mga0a205_758876_c1 3300050515 Bacteria 818
304 Ga0587079_180706 3300059647 Unclassified 564
305 Ga0501082_0348356 3300060353 Bacteria 1291
306 Ga0530510_0044993 3300061734 Bacteria 3190
307 Ga0207665_10200267
308 JGI24737J22298_10052885
309 JGI24742J22300_10107611
310 Ga0070683_100526247
311 Ga0070683_100688413
312 Ga0070690_101633431
313 Ga0070682_100071042
314 Ga0070682_100264673
315 Ga0068868_100019696
316 Ga0068868_100164568
317 Ga0068868_100383880
318 Ga0068868_101668621
319 Ga0070660_101086804
320 Ga0070689_100200287
321 Ga0070689_100283262
322 Ga0070687_100070516
323 Ga0070687_100673518
324 Ga0070661_100307092
325 Ga0070668_100087388
326 Ga0070669_100277464
327 Ga0070688_100114990
328 Ga0070667_100684637
329 Ga0070709_10232742
330 Ga0070714_100174874
331 Ga0070713_100142018
332 Ga0070713_100616259
333 Ga0070710_10123543
334 Ga0070701_10043774
335 Ga0070711_101125044
336 Ga0070705_100685771
337 Ga0070708_100060116
338 Ga0070662_100045813
339 Ga0068867_100297578
340 Ga0068867_101058565
341 Ga0070685_10067867
342 Ga0070685_10474958
343 Ga0070707_100042362
344 Ga0070707_100130765
345 Ga0070698_100183616
346 Ga0068853_100267609
347 Ga0070686_100082375
348 Ga0070686_100973713
349 Ga0070696_100209885
350 Ga0070693_100449696
351 Ga0070665_100920973
352 Ga0070664_101179543
353 Ga0068854_100553476
354 Ga0068854_101575812
355 Ga0068856_100697853
356 Ga0068856_100916718
357 Ga0068856_101820568
358 Ga0070702_100002101
359 Ga0070702_100142315
360 Ga0068852_100445416
361 Ga0068852_101502320
362 Ga0068859_100129157
363 Ga0068866_10312584
364 Ga0068861_100004792
365 Ga0068861_100504578
366 Ga0068858_100023781
367 Ga0081540_1025635
368 Ga0070717_10048622
369 Ga0070717_10171081
370 Ga0070717_10429689
371 Ga0070717_10575435
372 Ga0075363_100484944
373 Ga0070716_101550607
374 Ga0070716_101762679
375 Ga0070712_100022409
376 Ga0068871_101754551
377 Ga0075428_100494725
378 Ga0075428_102051036
379 Ga0075430_100097654
380 Ga0075431_100471116
381 Ga0075429_100890731
382 Ga0068865_100057817
383 Ga0097620_100129162
384 Ga0075435_100279031
385 Ga0075435_101471867
386 Ga0111539_10062960
387 Ga0111539_10257617
388 Ga0111539_10765924
389 Ga0105245_10004422
390 Ga0105245_10005493
391 Ga0105245_10162313
392 Ga0105245_10444934
393 Ga0105245_11421096
394 Ga0105247_10034488
395 Ga0105247_10173497
396 Ga0105247_11486973
397 Ga0105247_11512959
398 Ga0114129_10198912
399 Ga0105243_12542554
400 Ga0105242_10074048
401 Ga0105242_10620428
402 Ga0105248_10223124
403 Ga0105248_12233217
404 Ga0105249_10063251
405 Ga0105249_10174588
406 Ga0105249_10474943
407 Ga0105249_10676128
408 Ga0105249_11802361
409 Ga0105239_10012820
410 Ga0105239_10452868
411 Ga0105239_10927266
412 Ga0105239_11085611
413 Ga0105239_11506045
414 Ga0157324_1056954
415 Ga0157327_1027259
416 Ga0157369_11222143
417 Ga0157374_10123282
418 Ga0157378_10036531
419 Ga0157378_10809234
420 Ga0163162_10025126
421 Ga0163162_10385896
422 Ga0163162_10632071
423 Ga0163162_11237622
424 Ga0157375_10062994
425 Ga0163163_10678448
426 Ga0157380_10392255
427 Ga0182008_10590593
428 Ga0157377_10076831
429 Ga0206349_1204384
430 Ga0213874_10421434
431 Ga0213876_10003849
432 Ga0213875_10164863
433 Ga0213875_10226205
434 Ga0207656_10424112
435 Ga0207653_10302785
436 Ga0207692_10197367
437 Ga0207642_10189240
438 Ga0207642_10456825
439 Ga0207710_10011883
440 Ga0207688_10142509
441 Ga0207688_10338553
442 Ga0207647_10033413
443 Ga0207647_10410332
444 Ga0207647_10529207
445 Ga0207643_10307779
446 Ga0207705_10224751
447 Ga0207671_10517927
448 Ga0207693_10081188
449 Ga0207662_10016582
450 Ga0207662_11375764
451 Ga0207657_10110888
452 Ga0207649_10423576
453 Ga0207646_10051733
454 Ga0207646_10107584
455 Ga0207646_10246970
456 Ga0207681_10371825
457 Ga0207681_10434165
458 Ga0207659_11267560
459 Ga0207687_10112820
460 Ga0207687_10143715
461 Ga0207700_10089516
462 Ga0207664_10152134
463 Ga0207664_11825199
464 Ga0207706_10000575
465 Ga0207686_10079814
466 Ga0207686_10644604
467 Ga0207686_11351513
468 Ga0207709_10003020
469 Ga0207670_10088218
470 Ga0207669_11283774
471 Ga0207704_10175595
472 Ga0207711_10138606
473 Ga0207661_10524440
474 Ga0207661_10535617
475 Ga0207679_10354848
476 Ga0207712_10033691
477 Ga0207712_10581550
478 Ga0207712_10594628
479 Ga0207712_10820770
480 Ga0207668_10019597
481 Ga0207640_10075781
482 Ga0207640_11192570
483 Ga0207658_11308423
484 Ga0207677_10051918
485 Ga0207677_10817058
486 Ga0207677_11299006
487 Ga0207703_10266271
488 Ga0207639_10231193
489 Ga0207708_10008515
490 Ga0207708_10085722
491 Ga0207708_10259742
492 Ga0207702_12185548
493 Ga0207648_10140157
494 Ga0207648_11925088
495 Ga0207676_10154916
496 Ga0207676_10700196
497 Ga0207674_12089299
498 Ga0207675_100008806
499 Ga0207698_10669610
500 Ga0207428_10253793
501 Ga0207428_10645406
502 Ga0268266_10222702
503 Ga0268265_11972225
504 Ga0268264_10758428
505 Ga0373938_0210325
506 Ga0373944_0370093
507 Ga0373932_0105326
508 Ga0373939_0234580
509 Ga0373942_0230442
510 Ga0373962_0021471
511 Ga0373931_0433645
512 Ga0395899_0438982
513 Ga0395900_0006308
514 Ga0395900_0511657
515 Ga0395898_0007368
516 Ga0395898_0156316
517 Ga0395898_0563322
518 Ga0395898_1261550
519 Ga0395898_1373163
520 Ga0395905_0007843
521 Ga0395905_0675328
522 Ga0395905_1547068
523 Ga0436364_0021564
524 Ga0436364_0431017
525 Ga0436364_0861689
526 Ga0436364_1138185
527 Ga0395901_0002956
528 Ga0395901_0336211
529 Ga0395901_0419176
530 Ga0395901_0465592
531 Ga0395901_0617105
532 Ga0436365_0240871
533 Ga0436365_0846492
534 Ga0436365_0946849
535 Ga0436365_0986683
536 Ga0436365_1599748
537 Ga0436365_1646868
538 Ga0436360_1356190
539 Ga0436363_0053179
540 Ga0436363_0348208
541 Ga0436363_0387148
542 Ga0436362_0565652
543 Ga0436362_1273927
544 Ga0451793_1821137
545 Ga0451855_1247367
546 Ga0451853_1962303
547 Ga0439448_0218390
548 Ga0439463_049539
549 Ga0450888_015618
550 Ga0466963_0025199
551 Ga0466967_0188106
552 Ga0466967_0980636
553 Ga0466967_1051891
554 Ga0495652_0580607
555 Ga0495674_0678437
556 Ga0495602_0598031
557 Ga0496100_0000884
558 Ga0496101_0003611
559 Ga0496101_0044416
560 Ga0496101_0663100
561 Ga0496102_0009798
562 Ga0496102_0010859
563 Ga0496102_1140161
564 Ga0496103_0022098
565 Ga0496104_0176088
566 Ga0496105_0770454
567 Ga0496106_0006559
568 Ga0496106_0025283
569 Ga0496107_0000185
570 Ga0496107_0043522
571 Ga0496108_0026804
572 Ga0496108_0050371
573 Ga0496108_0107035
574 Ga0496108_0316069
575 Ga0496109_0048233
576 Ga0496109_0313809
577 Ga0496109_0901647
578 Ga0496110_0042485
579 Ga0496110_0056874
580 Ga0496110_1628561
581 Ga0496111_0286765
582 Ga0496111_0290111
583 Ga0496111_0695771
584 Ga0496112_0188342
585 Ga0496112_0225075
586 Ga0496112_0434795
587 Ga0496112_0702830
588 Ga0496113_0038676
589 Ga0496113_0281747
590 Ga0496113_0490863
591 Ga0496114_0144281
592 Ga0496114_0394619
593 Ga0496114_1261807
594 Ga0496115_0188603
595 Ga0501041_0169079
596 Ga0501046_0762067
597 Ga0501072_0865788
598 Ga0501075_0647293
599 Ga0501076_0284377
600 Ga0501077_0061654
601 Ga0501081_0167217
602 nmdc:mga05p37_1044674_c1
603 nmdc:mga09592_350565_c1
604 nmdc:mga0qj67_301504_c1
605 nmdc:mga08y16_1084235_c1
606 nmdc:mga08y16_317965_c1
607 nmdc:mga08y16_456264_c1
608 nmdc:mga0rr50_265731_c1
609 nmdc:mga0a205_758876_c1
610 Ga0587079_180706
611 Ga0501082_0348356
612 Ga0530510_0044993

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

9

99

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.913 7 110
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8963 9 110
1fqt-assembly1.cif.gz_B crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase 0.894 9 109
2yvj-assembly1.cif.gz_B crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex 0.8906 9 109
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.888 9 109
ID Description Score Start End Superfamily
3gkqC02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9145 7 111 2.20.25.680
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9131 7 110 2.102.10.10
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9052 7 111 2.102.10.10
1z01A02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9033 7 111 2.20.25.680
af_Q19655_23_127_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8944 10 111 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A1I5M0K1-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin subunit/anthranilate 1,2-dioxygenase large subunit/anthranilate 1,2-dioxygenase ferredoxin subunit 0.9342 8 111 GO:0046872
GO:0051213
GO:0051537
AF-A0A2H5Y727-F1-model_v4 Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component 0.93 9 109 GO:0046872
GO:0051213
GO:0051537
AF-A0A6P9CKI8-F1-model_v4 L-amino-acid oxidase (EC 1.4.3.2) 0.9263 9 111 GO:0001716
GO:0005737
GO:0016651
GO:0046872
GO:0051537
AF-A0A1G1Q7I4-F1-model_v4 Rieske domain-containing protein 0.9255 9 111 GO:0046872
GO:0051537
AF-A0A7X1PBT3-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9248 9 110 GO:0046872
GO:0051537

Map