F398679

General Info

Members Datasets Scaffolds Average Seq Length
306 238 216 338

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10005316|Ga0182008_100053166
Length 369
Sequence MFRIVPERGSVCSFWQSANPVTSHVMRRYTMQYRTLGRTGVQVSTLALGAMNFGGIGRTTQAEATALVDAALDAGINLIDTADMYSVGESEEMVGKALAGRRDDIVLATKAAMPMGEERNHQGGSRRWLVTALEDSLRRLGVDHVDLYQIHRWDPNTGDEETLSALTDLQRAGKIRYFGSSTFPAHRIVQAQWAARRHQLRRYVTEQPSYSVLQRGVEAHVLPVAEEYGLGVLVWSPLSSGWLSGAVRRGREVTTSRSTFLPDRFDLTLPYNRARLDAVERLAEVADEAGLTLIQLALGFVTAHPAVTSALIGPRTLDHLDSQLAAADTVLSADVLDAIDEIVAPGTDLAAHEKFDTPPALLDPSLRRR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
9 2643221647 Streptomyces sp. Root369 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2643221692 Nocardia sp. Root136 Isolate Unclassified
13 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
14 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
15 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
16 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
17 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
22 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
23 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
24 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
27 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
28 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
29 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
30 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
31 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
32 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
33 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
34 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
35 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
36 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
37 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
38 2858882152 Micromonospora noduli MED15 Isolate Nodule
39 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
40 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
41 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
42 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
43 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
44 2867428634 Streptomyces sp. RP5T Isolate Unclassified
45 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
46 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
47 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
48 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
49 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
50 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
51 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
52 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
53 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
54 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
55 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
56 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
57 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
58 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
59 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
60 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
61 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
62 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
63 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
64 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
65 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
66 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
67 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
68 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
69 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
70 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
71 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
72 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
73 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
74 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
100 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
192 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 649633069 Micromonospora sp. L5 Isolate Unclassified
222 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
223 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
224 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
225 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
226 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
227 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
228 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
229 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
230 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
231 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
232 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
233 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
234 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
235 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
236 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
237 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
238 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.61
Metatranscriptomes 0.98
Isolates 29.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 1.63
Rhizoplane 2.94
Rhizosphere 60.13
Stem 0
Stem Tuber 0.33
Unclassified 29.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10001112 3300002067 Bacteria 9640
2 JGI25406J46586_10003922 3300003203 Bacteria 6952
3 rootH1_10086152 3300003316 Bacteria 3767
4 Ga0006562J51391_1074314 3300003578 Bacteria 3840
5 Ga0006562J51391_1074318 3300003578 Bacteria 2300
6 Ga0006562J51391_1090052 3300003578 Bacteria 3530
7 Ga0070668_100004531 3300005347 Bacteria 10309
8 Ga0070668_100012200 3300005347 Bacteria 6401
9 Ga0070714_100080489 3300005435 Bacteria 2835
10 Ga0070714_100110848 3300005435 Bacteria 2430
11 Ga0070663_100031676 3300005455 Bacteria 3636
12 Ga0070702_100081188 3300005615 Bacteria 1942
13 Ga0068858_100040492 3300005842 Bacteria 4321
14 Ga0081539_10000301 3300005985 Bacteria 111476
15 Ga0075368_10014408 3300006042 Bacteria 2920
16 Ga0075367_10002600 3300006178 Bacteria 8289
17 Ga0105239_10113195 3300010375 Bacteria 3009
18 Ga0163163_10139170 3300014325 Bacteria 2469
19 Ga0157380_10262683 3300014326 Bacteria 1569
20 Ga0182008_10005316 3300014497 Bacteria 7353
21 Ga0182006_1048973 3300015261 Bacteria 1632
22 Ga0182007_10000559 3300015262 Bacteria 22019
23 Ga0183367_1005 3300015688 Bacteria 652063
24 Ga0163161_10087679 3300017792 Bacteria 2299
25 Ga0207700_10170623 3300025928 Bacteria 1815
26 Ga0207664_10163356 3300025929 Bacteria 1901
27 Ga0207704_10221975 3300025938 Bacteria 1399
28 Ga0207668_10052627 3300025972 Bacteria 2817
29 Ga0207668_10089203 3300025972 Bacteria 2260
30 Ga0207703_10104248 3300026035 Bacteria 2409
31 Ga0207678_10000999 3300026067 Bacteria 25767
32 Ga0209813_10017613 3300027866 Bacteria 1963
33 Ga0307517_10003419 3300028786 Bacteria 24704
34 Ga0307517_10083716 3300028786 Bacteria 2693
35 Ga0307517_10092672 3300028786 Bacteria 2456
36 Ga0307515_10004459 3300028794 Bacteria 28986
37 Ga0307515_10015411 3300028794 Bacteria 14086
38 Ga0307515_10023009 3300028794 Bacteria 10953
39 Ga0307515_10042601 3300028794 Bacteria 7093
40 Ga0307515_10094413 3300028794 Bacteria 3695
41 Ga0307515_10216906 3300028794 Bacteria 1742
42 Ga0307512_10003171 3300030522 Bacteria 19505
43 Ga0307512_10003328 3300030522 Bacteria 18859
44 Ga0307512_10004230 3300030522 Bacteria 15862
45 Ga0307512_10017789 3300030522 Bacteria 6508
46 Ga0307512_10022815 3300030522 Bacteria 5609
47 Ga0307512_10074547 3300030522 Bacteria 2490
48 Ga0307513_10000742 3300031456 Bacteria 46923
49 Ga0307513_10003969 3300031456 Bacteria 19864
50 Ga0307513_10072046 3300031456 Bacteria 3603
51 Ga0307508_10004585 3300031616 Bacteria 13448
52 Ga0307508_10006690 3300031616 Bacteria 10809
53 Ga0307508_10015802 3300031616 Bacteria 6878
54 Ga0307508_10044214 3300031616 Bacteria 3986
55 Ga0307508_10063126 3300031616 Bacteria 3269
56 Ga0307508_10092941 3300031616 Bacteria 2606
57 Ga0307514_10019004 3300031649 Bacteria 5626
58 Ga0307516_10005680 3300031730 Bacteria 14799
59 Ga0307516_10013821 3300031730 Bacteria 8573
60 Ga0307518_10000734 3300031838 Bacteria 24656
61 Ga0307518_10022917 3300031838 Bacteria 4497
62 Ga0307518_10071281 3300031838 Bacteria 2517
63 Ga0307518_10204734 3300031838 Bacteria 1306
64 Ga0307409_100130013 3300031995 Bacteria 2150
65 Ga0307507_10001972 3300033179 Bacteria 44505
66 Ga0307507_10009256 3300033179 Bacteria 13197
67 Ga0307507_10145598 3300033179 Bacteria 1801
68 Ga0307510_10010238 3300033180 Bacteria 11150
69 Ga0307510_10196408 3300033180 Bacteria 1559
70 Ga0395900_0205769 3300037418 Bacteria 1989
71 Ga0395898_0004525 3300037466 Bacteria 15185
72 Ga0395901_0115637 3300038443 Bacteria 2818
73 Ga0451837_0589884 3300041494 Bacteria 5960
74 Ga0451853_1087050 3300041512 Bacteria 2459
75 Ga0451853_2735051 3300041512 Bacteria 7194
76 Ga0439448_0026046 3300042005 Bacteria 1837
77 Ga0450903_000321 3300042138 Bacteria 10578
78 Ga0439458_0002693 3300042157 Bacteria 4288
79 Ga0466972_0001509 3300044658 Bacteria 11327
80 Ga0466961_0065389 3300044693 Bacteria 2311
81 Ga0466970_0172243 3300044765 Bacteria 1200
82 Ga0466957_0029796 3300044842 Bacteria 3256
83 Ga0466960_0081347 3300044901 Bacteria 1633
84 Ga0495603_0055213 3300046455 Bacteria 2353
85 Ga0495629_0004555 3300046459 Bacteria 10367
86 Ga0495629_0008659 3300046459 Bacteria 7495
87 Ga0495629_0010761 3300046459 Bacteria 6655
88 Ga0495629_0087804 3300046459 Bacteria 2169
89 Ga0495638_0104329 3300046460 Bacteria 1691
90 Ga0495641_0097759 3300046461 Bacteria 1310
91 Ga0495651_0087699 3300046462 Bacteria 2339
92 Ga0495653_0005858 3300046463 Bacteria 10061
93 Ga0495580_0080820 3300046472 Bacteria 2265
94 Ga0495582_0017375 3300046473 Bacteria 3937
95 Ga0495605_0019001 3300046474 Bacteria 3678
96 Ga0495639_0052217 3300046475 Bacteria 1860
97 Ga0495662_0000876 3300046476 Bacteria 14697
98 Ga0495662_0034604 3300046476 Bacteria 2438
99 Ga0495664_0087281 3300046477 Bacteria 1874
100 Ga0495664_0146420 3300046477 Bacteria 1432
101 Ga0495584_0052925 3300046491 Bacteria 2043
102 Ga0495585_0026195 3300046492 Bacteria 3331
103 Ga0495594_0063281 3300046499 Bacteria 2049
104 Ga0495594_0064406 3300046499 Bacteria 2032
105 Ga0495594_0111282 3300046499 Bacteria 1544
106 Ga0495596_0041124 3300046500 Bacteria 1823
107 Ga0495606_0089720 3300046507 Bacteria 1893
108 Ga0495608_0001788 3300046511 Bacteria 15362
109 Ga0495610_0010730 3300046512 Bacteria 5667
110 Ga0495616_0021858 3300046513 Bacteria 3458
111 Ga0495628_0012348 3300046516 Bacteria 7200
112 Ga0495628_0033089 3300046516 Bacteria 4169
113 Ga0495630_0123946 3300046517 Bacteria 1960
114 Ga0495632_0044198 3300046519 Bacteria 2224
115 Ga0495632_0051099 3300046519 Bacteria 2036
116 Ga0495648_0074783 3300046524 Bacteria 1950
117 Ga0495666_0002763 3300046526 Bacteria 8764
118 Ga0495666_0019016 3300046526 Bacteria 3412
119 Ga0495654_0073584 3300046530 Bacteria 1616
120 Ga0495665_0008798 3300046531 Bacteria 5479
121 Ga0495640_0003626 3300046533 Bacteria 12393
122 Ga0495640_0078416 3300046533 Bacteria 2200
123 Ga0495586_0049541 3300046535 Bacteria 2271
124 Ga0495587_0092493 3300046536 Bacteria 1746
125 Ga0495609_0026477 3300046538 Bacteria 2655
126 Ga0495597_0006792 3300046542 Bacteria 5885
127 Ga0495645_0099657 3300046543 Bacteria 2067
128 Ga0495667_0001231 3300046559 Bacteria 16759
129 Ga0495668_0040977 3300046616 Bacteria 2581
130 Ga0495634_0015975 3300046642 Bacteria 5378
131 Ga0495634_0045224 3300046642 Bacteria 2977
132 Ga0495634_0218420 3300046642 Bacteria 1177
133 Ga0495611_0008668 3300046648 Bacteria 4302
134 Ga0495625_0007849 3300046660 Bacteria 9194
135 Ga0495625_0048302 3300046660 Bacteria 3065
136 Ga0495661_0037974 3300046665 Bacteria 3004
137 Ga0495588_0001296 3300046674 Bacteria 10697
138 Ga0495588_0055054 3300046674 Bacteria 2053
139 Ga0495588_0171024 3300046674 Bacteria 1149
140 Ga0495657_0007263 3300046675 Bacteria 8579
141 Ga0495657_0011255 3300046675 Bacteria 6701
142 Ga0495657_0069093 3300046675 Bacteria 2312
143 Ga0495623_0028883 3300046679 Bacteria 3568
144 Ga0495613_0008287 3300046689 Bacteria 7716
145 Ga0495613_0034185 3300046689 Bacteria 3776
146 Ga0495613_0109723 3300046689 Bacteria 1989
147 Ga0495613_0138835 3300046689 Bacteria 1737
148 Ga0495624_0023816 3300046690 Bacteria 4033
149 Ga0495624_0035847 3300046690 Bacteria 3201
150 Ga0495624_0065357 3300046690 Bacteria 2272
151 Ga0495671_0147142 3300046692 Bacteria 1147
152 Ga0495589_0006504 3300046794 Bacteria 6163
153 Ga0495600_0029183 3300046809 Bacteria 3570
154 Ga0495581_0066863 3300047315 Bacteria 2078
155 Ga0495581_0070313 3300047315 Bacteria 2024
156 Ga0495604_0014274 3300047317 Bacteria 6333
157 Ga0495604_0056503 3300047317 Bacteria 3021
158 Ga0495674_0021218 3300047319 Bacteria 6009
159 Ga0495674_0236260 3300047319 Bacteria 1507
160 Ga0495676_0002468 3300047321 Bacteria 16443
161 Ga0495676_0026575 3300047321 Bacteria 4981
162 Ga0495676_0096388 3300047321 Bacteria 2199
163 Ga0495687_012894 3300047443 Bacteria 4392
164 Ga0495675_0015791 3300047444 Bacteria 4776
165 Ga0495675_0023333 3300047444 Bacteria 3941
166 Ga0495685_020241 3300047447 Bacteria 2286
167 Ga0495673_0100640 3300047469 Bacteria 1169
168 Ga0495681_0000532 3300047470 Bacteria 29171
169 Ga0495681_0089835 3300047470 Bacteria 1358
170 Ga0495686_0039104 3300047472 Bacteria 3031
171 Ga0495593_0060533 3300047673 Bacteria 1982
172 Ga0495602_0026180 3300048088 Bacteria 5630
173 Ga0495614_0009002 3300048089 Bacteria 4429
174 Ga0495614_0029072 3300048089 Bacteria 2379
175 Ga0496102_0000378 3300048905 Bacteria 53414
176 Ga0496103_0060210 3300048906 Bacteria 2360
177 Ga0496104_0090981 3300048907 Bacteria 2916
178 Ga0496104_0194614 3300048907 Bacteria 1940
179 Ga0496105_0060806 3300048908 Bacteria 3117
180 Ga0496108_0000961 3300048911 Bacteria 22412
181 Ga0496109_0190621 3300048912 Bacteria 1926
182 Ga0496114_0104606 3300048917 Bacteria 2421
183 Ga0496122_0002411 3300048925 Bacteria 26622
184 Ga0496123_0000363 3300048926 Bacteria 85560
185 Ga0495678_055608 3300049459 Bacteria 1509
186 Ga0501034_0007171 3300049571 Bacteria 11895
187 Ga0501034_0007504 3300049571 Bacteria 11601
188 Ga0501036_0000650 3300049572 Bacteria 25471
189 Ga0501037_0012574 3300049573 Bacteria 6237
190 Ga0501038_0000905 3300049574 Bacteria 26256
191 Ga0501039_0041302 3300049575 Bacteria 3562
192 Ga0501042_0012451 3300049578 Bacteria 5765
193 Ga0501043_0000670 3300049579 Bacteria 30192
194 Ga0501047_0000046 3300049581 Bacteria 170205
195 Ga0501047_0000847 3300049581 Bacteria 31481
196 Ga0501048_0007446 3300049582 Bacteria 8296
197 Ga0501070_0108297 3300049586 Bacteria 2296
198 Ga0501074_0000386 3300049590 Bacteria 26175
199 Ga0501081_0064085 3300049743 Bacteria 2552
200 Ga0501044_0027149 3300049823 Bacteria 6055
201 nmdc:mga0yw44_60506_c1 3300050492 Bacteria 2320
202 nmdc:mga06z11_8699_c1 3300050494 Bacteria 4249
203 nmdc:mga04h51_7072_c1 3300050495 Bacteria 2943
204 Ga0500644_0013370 3300053088 Bacteria 2292
205 Ga0500644_0023406 3300053088 Bacteria 1876
206 Ga0500651_0026997 3300053093 Bacteria 3610
207 Ga0500556_0001401 3300053104 Bacteria 10497
208 Ga0500560_000102 3300053107 Bacteria 8749
209 Ga0500594_0010255 3300053118 Bacteria 2172
210 Ga0500594_0012147 3300053118 Bacteria 2023
211 Ga0500652_008926 3300053131 Bacteria 3367
212 Ga0500559_0000418 3300053136 Bacteria 30441
213 Ga0500573_0098181 3300053140 Bacteria 1650
214 Ga0500577_0103979 3300053142 Bacteria 1164
215 Ga0500616_0031025 3300053153 Bacteria 2931
216 Ga0466962_0011199 3300061719 Bacteria 4319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10003922 JGI25406J46586_100039227 295
2 3300005985 Ga0081539_10000301 Ga0081539_1000030116 295
3 3300046689 Ga0495613_0109723 Ga0495613_0109723_1015_1974 319
4 3300048925 Ga0496122_0002411 Ga0496122_0002411_23018_23977 319
5 3300048926 Ga0496123_0000363 Ga0496123_0000363_8366_9325 319
6 iso_pu_bacteria 2867428634 2867436928 319
7 iso_pu_bacteria 8003856774 8003860792 320
8 3300046472 Ga0495580_0080820 Ga0495580_0080820_993_1961 322
9 3300010375 Ga0105239_10113195 Ga0105239_101131952 324
10 3300028786 Ga0307517_10083716 Ga0307517_100837161 329
11 3300028794 Ga0307515_10042601 Ga0307515_100426014 329
12 3300030522 Ga0307512_10003171 Ga0307512_1000317113 329
13 3300031616 Ga0307508_10004585 Ga0307508_1000458510 329
14 3300031616 Ga0307508_10044214 Ga0307508_100442144 329
15 3300031616 Ga0307508_10063126 Ga0307508_100631263 329
16 3300017792 Ga0163161_10087679 Ga0163161_100876792 335
17 3300041512 Ga0451853_1087050 Ga0451853_1087050_624_1634 335
18 iso_pu_bacteria 2501939600 2501940639 335
19 iso_pu_bacteria 2515154155 2515857890 335
20 iso_pu_bacteria 2547132111 2547410822 335
21 iso_pu_bacteria 2582581313 2585308067 335
22 iso_pu_bacteria 2582581314 2585320232 335
23 iso_pu_bacteria 2585427649 2586059214 335
24 iso_pu_bacteria 2643221548 2643763027 335
25 iso_pu_bacteria 2643221632 2644181281 335
26 iso_pu_bacteria 2643221647 2644267881 335
27 iso_pu_bacteria 2643221678 2644436929 335
28 iso_pu_bacteria 2643221682 2644464115 335
29 iso_pu_bacteria 2643221692 2644516745 335
30 iso_pu_bacteria 2675903058 2676476960 335
31 iso_pu_bacteria 2675903059 2676479885 335
32 iso_pu_bacteria 2738543034 2739365730 335
33 iso_pu_bacteria 2751185725 2753036342 335
34 iso_pu_bacteria 2751185792 2753324213 335
35 iso_pu_bacteria 2784132148 2784589987 335
36 iso_pu_bacteria 2784746768 2785366023 335
37 iso_pu_bacteria 2786546132 2786667005 335
38 iso_pu_bacteria 2791355406 2793976778 335
39 iso_pu_bacteria 2799112218 2799186250 335
40 iso_pu_bacteria 2808606359 2808841823 335
41 iso_pu_bacteria 2808606375 2808917545 335
42 iso_pu_bacteria 2808606448 2809233666 335
43 iso_pu_bacteria 2808606522 2809592033 335
44 iso_pu_bacteria 2811994882 2812372324 335
45 iso_pu_bacteria 2811994917 2812479432 335
46 iso_pu_bacteria 2816332119 2816426509 335
47 iso_pu_bacteria 2818991463 2819698534 335
48 iso_pu_bacteria 2818991472 2819747305 335
49 iso_pu_bacteria 2827628540 2827632525 335
50 iso_pu_bacteria 2855670206 2855672679 335
51 iso_pu_bacteria 2855676851 2855678055 335
52 iso_pu_bacteria 2856858025 2856862724 335
53 iso_pu_bacteria 2857288857 2857291371 335
54 iso_pu_bacteria 2858848962 2858849002 335
55 iso_pu_bacteria 2858882152 2858886481 335
56 iso_pu_bacteria 2858888857 2858893944 335
57 iso_pu_bacteria 2858895516 2858902353 335
58 iso_pu_bacteria 2862281513 2862285698 335
59 iso_pu_bacteria 2867312974 2867317578 335
60 iso_pu_bacteria 2867319477 2867325644 335
61 iso_pu_bacteria 2869048445 2869051257 335
62 iso_pu_bacteria 2869061728 2869066567 335
63 iso_pu_bacteria 2869068681 2869072030 335
64 iso_pu_bacteria 2873314349 2873319818 335
65 iso_pu_bacteria 2877676314 2877684473 335
66 iso_pu_bacteria 2880489317 2880489405 335
67 iso_pu_bacteria 2880495981 2880496311 335
68 iso_pu_bacteria 2899370129 2899375106 335
69 iso_pu_bacteria 2904765812 2904767783 335
70 iso_pu_bacteria 2904770941 2904774441 335
71 iso_pu_bacteria 2912715099 2912722215 335
72 iso_pu_bacteria 2919420072 2919423788 335
73 iso_pu_bacteria 2919432681 2919436396 335
74 iso_pu_bacteria 2919468124 2919469732 335
75 iso_pu_bacteria 2929219909 2929221664 335
76 iso_pu_bacteria 2929226422 2929232087 335
77 iso_pu_bacteria 2954380949 2954389959 335
78 iso_pu_bacteria 2954673503 2954682090 335
79 iso_pu_bacteria 2954682443 2954690835 335
80 iso_pu_bacteria 2954691527 2954700695 335
81 iso_pu_bacteria 2954701450 2954701535 335
82 iso_pu_bacteria 2954711539 2954719327 335
83 iso_pu_bacteria 2954721474 2954729297 335
84 iso_pu_bacteria 2954731030 2954732511 335
85 iso_pu_bacteria 2954740390 2954748198 335
86 iso_pu_bacteria 2954749733 2954751390 335
87 iso_pu_bacteria 2954759201 2954767322 335
88 iso_pu_bacteria 3006425503 3006426866 335
89 iso_pu_bacteria 649633069 649815499 335
90 iso_pu_bacteria 8003314358 8003324108 335
91 iso_pu_bacteria 8003830390 8003832000 335
92 iso_pu_bacteria 8003870546 8003875728 335
93 iso_pu_bacteria 8023623736 8023627356 335
94 iso_pu_bacteria 8047710418 8047711922 335
95 iso_pu_bacteria 8047893842 8047903648 335
96 iso_pu_bacteria 8048127548 8048132010 335
97 iso_pu_bacteria 8048356638 8048356910 335
98 iso_pu_bacteria 8048369669 8048378915 335
99 iso_pu_bacteria 8048379754 8048388018 335
100 iso_pu_bacteria 8053945823 8053951065 335
101 iso_pu_bacteria 8054704163 8054705371 335
102 iso_pu_bacteria 8054727385 8054729693 335
103 iso_pu_bacteria 8054734606 8054735902 335
104 iso_pu_bacteria 8056829672 8056834665 335
105 iso_pu_bacteria 8057568493 8057571302 335
106 3300005615 Ga0070702_100081188 Ga0070702_1000811882 336
107 3300014326 Ga0157380_10262683 Ga0157380_102626832 336
108 3300025938 Ga0207704_10221975 Ga0207704_102219752 336
109 3300003578 Ga0006562J51391_1090052 Ga0006562J51391_10900521 338
110 3300002067 JGI24735J21928_10001112 JGI24735J21928_100011127 339
111 3300003316 rootH1_10086152 rootH1_100861521 339
112 3300003578 Ga0006562J51391_1074314 Ga0006562J51391_10743143 339
113 3300003578 Ga0006562J51391_1074318 Ga0006562J51391_10743182 339
114 3300005347 Ga0070668_100004531 Ga0070668_1000045313 339
115 3300005347 Ga0070668_100012200 Ga0070668_1000122003 339
116 3300005435 Ga0070714_100080489 Ga0070714_1000804892 339
117 3300005435 Ga0070714_100110848 Ga0070714_1001108483 339
118 3300005455 Ga0070663_100031676 Ga0070663_1000316764 339
119 3300005842 Ga0068858_100040492 Ga0068858_1000404921 339
120 3300006042 Ga0075368_10014408 Ga0075368_100144083 339
121 3300006178 Ga0075367_10002600 Ga0075367_100026005 339
122 3300014325 Ga0163163_10139170 Ga0163163_101391702 339
123 3300014497 Ga0182008_10005316 Ga0182008_100053166 339
124 3300015261 Ga0182006_1048973 Ga0182006_10489732 339
125 3300015262 Ga0182007_10000559 Ga0182007_100005595 339
126 3300015688 Ga0183367_1005 Ga0183367_1005200 339
127 3300025928 Ga0207700_10170623 Ga0207700_101706232 339
128 3300025929 Ga0207664_10163356 Ga0207664_101633562 339
129 3300025972 Ga0207668_10052627 Ga0207668_100526272 339
130 3300025972 Ga0207668_10089203 Ga0207668_100892031 339
131 3300026035 Ga0207703_10104248 Ga0207703_101042482 339
132 3300026067 Ga0207678_10000999 Ga0207678_1000099926 339
133 3300027866 Ga0209813_10017613 Ga0209813_100176131 339
134 3300028786 Ga0307517_10003419 Ga0307517_1000341914 339
135 3300028786 Ga0307517_10092672 Ga0307517_100926722 339
136 3300028794 Ga0307515_10004459 Ga0307515_100044598 339
137 3300028794 Ga0307515_10015411 Ga0307515_100154114 339
138 3300028794 Ga0307515_10023009 Ga0307515_100230093 339
139 3300028794 Ga0307515_10094413 Ga0307515_100944133 339
140 3300028794 Ga0307515_10216906 Ga0307515_102169062 339
141 3300030522 Ga0307512_10003328 Ga0307512_1000332810 339
142 3300030522 Ga0307512_10004230 Ga0307512_1000423010 339
143 3300030522 Ga0307512_10017789 Ga0307512_100177893 339
144 3300030522 Ga0307512_10022815 Ga0307512_100228156 339
145 3300030522 Ga0307512_10074547 Ga0307512_100745472 339
146 3300031456 Ga0307513_10000742 Ga0307513_1000074215 339
147 3300031456 Ga0307513_10003969 Ga0307513_1000396910 339
148 3300031456 Ga0307513_10072046 Ga0307513_100720462 339
149 3300031616 Ga0307508_10006690 Ga0307508_100066904 339
150 3300031616 Ga0307508_10015802 Ga0307508_100158025 339
151 3300031616 Ga0307508_10092941 Ga0307508_100929413 339
152 3300031649 Ga0307514_10019004 Ga0307514_100190044 339
153 3300031730 Ga0307516_10005680 Ga0307516_1000568016 339
154 3300031730 Ga0307516_10013821 Ga0307516_100138212 339
155 3300031838 Ga0307518_10000734 Ga0307518_1000073424 339
156 3300031838 Ga0307518_10022917 Ga0307518_100229173 339
157 3300031838 Ga0307518_10071281 Ga0307518_100712811 339
158 3300031838 Ga0307518_10204734 Ga0307518_102047342 339
159 3300031995 Ga0307409_100130013 Ga0307409_1001300132 339
160 3300033179 Ga0307507_10001972 Ga0307507_1000197228 339
161 3300033179 Ga0307507_10009256 Ga0307507_100092567 339
162 3300033179 Ga0307507_10145598 Ga0307507_101455982 339
163 3300033180 Ga0307510_10010238 Ga0307510_100102381 339
164 3300033180 Ga0307510_10196408 Ga0307510_101964081 339
165 3300037418 Ga0395900_0205769 Ga0395900_0205769_68_1087 339
166 3300037466 Ga0395898_0004525 Ga0395898_0004525_9825_10853 339
167 3300038443 Ga0395901_0115637 Ga0395901_0115637_214_1233 339
168 3300041494 Ga0451837_0589884 Ga0451837_0589884_4360_5379 339
169 3300041512 Ga0451853_2735051 Ga0451853_2735051_4543_5562 339
170 3300042005 Ga0439448_0026046 Ga0439448_0026046_565_1584 339
171 3300042138 Ga0450903_000321 Ga0450903_000321_4507_5526 339
172 3300042157 Ga0439458_0002693 Ga0439458_0002693_466_1485 339
173 3300044658 Ga0466972_0001509 Ga0466972_0001509_3096_4118 339
174 3300044693 Ga0466961_0065389 Ga0466961_0065389_581_1612 339
175 3300044765 Ga0466970_0172243 Ga0466970_0172243_164_1186 339
176 3300044842 Ga0466957_0029796 Ga0466957_0029796_2133_3161 339
177 3300044901 Ga0466960_0081347 Ga0466960_0081347_537_1556 339
178 3300046455 Ga0495603_0055213 Ga0495603_0055213_210_1229 339
179 3300046459 Ga0495629_0004555 Ga0495629_0004555_859_1878 339
180 3300046459 Ga0495629_0008659 Ga0495629_0008659_3420_4439 339
181 3300046459 Ga0495629_0010761 Ga0495629_0010761_3806_4825 339
182 3300046459 Ga0495629_0087804 Ga0495629_0087804_684_1703 339
183 3300046460 Ga0495638_0104329 Ga0495638_0104329_302_1321 339
184 3300046461 Ga0495641_0097759 Ga0495641_0097759_143_1162 339
185 3300046462 Ga0495651_0087699 Ga0495651_0087699_178_1197 339
186 3300046463 Ga0495653_0005858 Ga0495653_0005858_1842_2861 339
187 3300046473 Ga0495582_0017375 Ga0495582_0017375_675_1694 339
188 3300046474 Ga0495605_0019001 Ga0495605_0019001_1495_2514 339
189 3300046475 Ga0495639_0052217 Ga0495639_0052217_80_1099 339
190 3300046476 Ga0495662_0000876 Ga0495662_0000876_7640_8659 339
191 3300046476 Ga0495662_0034604 Ga0495662_0034604_388_1410 339
192 3300046477 Ga0495664_0087281 Ga0495664_0087281_802_1821 339
193 3300046477 Ga0495664_0146420 Ga0495664_0146420_71_1090 339
194 3300046491 Ga0495584_0052925 Ga0495584_0052925_953_1972 339
195 3300046492 Ga0495585_0026195 Ga0495585_0026195_1689_2708 339
196 3300046499 Ga0495594_0063281 Ga0495594_0063281_808_1827 339
197 3300046499 Ga0495594_0064406 Ga0495594_0064406_190_1209 339
198 3300046499 Ga0495594_0111282 Ga0495594_0111282_43_1062 339
199 3300046500 Ga0495596_0041124 Ga0495596_0041124_444_1463 339
200 3300046507 Ga0495606_0089720 Ga0495606_0089720_714_1733 339
201 3300046511 Ga0495608_0001788 Ga0495608_0001788_13402_14421 339
202 3300046512 Ga0495610_0010730 Ga0495610_0010730_4258_5277 339
203 3300046513 Ga0495616_0021858 Ga0495616_0021858_1535_2554 339
204 3300046516 Ga0495628_0012348 Ga0495628_0012348_1064_2083 339
205 3300046516 Ga0495628_0033089 Ga0495628_0033089_297_1316 339
206 3300046517 Ga0495630_0123946 Ga0495630_0123946_764_1783 339
207 3300046519 Ga0495632_0044198 Ga0495632_0044198_185_1204 339
208 3300046519 Ga0495632_0051099 Ga0495632_0051099_169_1188 339
209 3300046524 Ga0495648_0074783 Ga0495648_0074783_837_1856 339
210 3300046526 Ga0495666_0002763 Ga0495666_0002763_1548_2567 339
211 3300046526 Ga0495666_0019016 Ga0495666_0019016_333_1352 339
212 3300046530 Ga0495654_0073584 Ga0495654_0073584_190_1209 339
213 3300046531 Ga0495665_0008798 Ga0495665_0008798_3419_4438 339
214 3300046533 Ga0495640_0003626 Ga0495640_0003626_1827_2846 339
215 3300046533 Ga0495640_0078416 Ga0495640_0078416_101_1120 339
216 3300046535 Ga0495586_0049541 Ga0495586_0049541_698_1717 339
217 3300046536 Ga0495587_0092493 Ga0495587_0092493_555_1574 339
218 3300046538 Ga0495609_0026477 Ga0495609_0026477_1294_2313 339
219 3300046542 Ga0495597_0006792 Ga0495597_0006792_1302_2321 339
220 3300046543 Ga0495645_0099657 Ga0495645_0099657_1018_2037 339
221 3300046559 Ga0495667_0001231 Ga0495667_0001231_229_1248 339
222 3300046616 Ga0495668_0040977 Ga0495668_0040977_32_1051 339
223 3300046642 Ga0495634_0015975 Ga0495634_0015975_1290_2309 339
224 3300046642 Ga0495634_0045224 Ga0495634_0045224_1032_2051 339
225 3300046642 Ga0495634_0218420 Ga0495634_0218420_58_1077 339
226 3300046648 Ga0495611_0008668 Ga0495611_0008668_1701_2720 339
227 3300046660 Ga0495625_0007849 Ga0495625_0007849_7657_8676 339
228 3300046660 Ga0495625_0048302 Ga0495625_0048302_505_1524 339
229 3300046665 Ga0495661_0037974 Ga0495661_0037974_955_1974 339
230 3300046674 Ga0495588_0001296 Ga0495588_0001296_2713_3732 339
231 3300046674 Ga0495588_0055054 Ga0495588_0055054_428_1447 339
232 3300046674 Ga0495588_0171024 Ga0495588_0171024_78_1097 339
233 3300046675 Ga0495657_0007263 Ga0495657_0007263_846_1937 339
234 3300046675 Ga0495657_0011255 Ga0495657_0011255_101_1120 339
235 3300046675 Ga0495657_0069093 Ga0495657_0069093_77_1096 339
236 3300046679 Ga0495623_0028883 Ga0495623_0028883_2449_3468 339
237 3300046689 Ga0495613_0008287 Ga0495613_0008287_1580_2599 339
238 3300046689 Ga0495613_0034185 Ga0495613_0034185_1090_2109 339
239 3300046689 Ga0495613_0138835 Ga0495613_0138835_240_1259 339
240 3300046690 Ga0495624_0023816 Ga0495624_0023816_2156_3175 339
241 3300046690 Ga0495624_0035847 Ga0495624_0035847_466_1485 339
242 3300046690 Ga0495624_0065357 Ga0495624_0065357_1149_2168 339
243 3300046692 Ga0495671_0147142 Ga0495671_0147142_65_1084 339
244 3300046794 Ga0495589_0006504 Ga0495589_0006504_1425_2444 339
245 3300046809 Ga0495600_0029183 Ga0495600_0029183_1788_2807 339
246 3300047315 Ga0495581_0066863 Ga0495581_0066863_1038_2057 339
247 3300047315 Ga0495581_0070313 Ga0495581_0070313_473_1492 339
248 3300047317 Ga0495604_0014274 Ga0495604_0014274_702_1721 339
249 3300047317 Ga0495604_0056503 Ga0495604_0056503_641_1660 339
250 3300047319 Ga0495674_0021218 Ga0495674_0021218_828_1847 339
251 3300047319 Ga0495674_0236260 Ga0495674_0236260_249_1268 339
252 3300047321 Ga0495676_0002468 Ga0495676_0002468_8651_9670 339
253 3300047321 Ga0495676_0026575 Ga0495676_0026575_830_1849 339
254 3300047321 Ga0495676_0096388 Ga0495676_0096388_308_1327 339
255 3300047443 Ga0495687_012894 Ga0495687_012894_2165_3184 339
256 3300047444 Ga0495675_0015791 Ga0495675_0015791_400_1476 339
257 3300047444 Ga0495675_0023333 Ga0495675_0023333_2171_3190 339
258 3300047447 Ga0495685_020241 Ga0495685_020241_494_1513 339
259 3300047469 Ga0495673_0100640 Ga0495673_0100640_75_1094 339
260 3300047470 Ga0495681_0000532 Ga0495681_0000532_20241_21260 339
261 3300047470 Ga0495681_0089835 Ga0495681_0089835_165_1184 339
262 3300047472 Ga0495686_0039104 Ga0495686_0039104_750_1769 339
263 3300047673 Ga0495593_0060533 Ga0495593_0060533_213_1232 339
264 3300048088 Ga0495602_0026180 Ga0495602_0026180_914_1933 339
265 3300048089 Ga0495614_0009002 Ga0495614_0009002_967_1986 339
266 3300048089 Ga0495614_0029072 Ga0495614_0029072_952_1971 339
267 3300048905 Ga0496102_0000378 Ga0496102_0000378_10922_11941 339
268 3300048906 Ga0496103_0060210 Ga0496103_0060210_154_1173 339
269 3300048907 Ga0496104_0090981 Ga0496104_0090981_1134_2153 339
270 3300048907 Ga0496104_0194614 Ga0496104_0194614_768_1787 339
271 3300048908 Ga0496105_0060806 Ga0496105_0060806_297_1316 339
272 3300048911 Ga0496108_0000961 Ga0496108_0000961_15142_16161 339
273 3300048912 Ga0496109_0190621 Ga0496109_0190621_102_1121 339
274 3300048917 Ga0496114_0104606 Ga0496114_0104606_1081_2100 339
275 3300049459 Ga0495678_055608 Ga0495678_055608_135_1154 339
276 3300049571 Ga0501034_0007171 Ga0501034_0007171_766_1785 339
277 3300049571 Ga0501034_0007504 Ga0501034_0007504_6680_7699 339
278 3300049572 Ga0501036_0000650 Ga0501036_0000650_3037_4056 339
279 3300049573 Ga0501037_0012574 Ga0501037_0012574_3720_4739 339
280 3300049574 Ga0501038_0000905 Ga0501038_0000905_5815_6834 339
281 3300049575 Ga0501039_0041302 Ga0501039_0041302_2319_3338 339
282 3300049578 Ga0501042_0012451 Ga0501042_0012451_1681_2700 339
283 3300049579 Ga0501043_0000670 Ga0501043_0000670_16470_17489 339
284 3300049581 Ga0501047_0000046 Ga0501047_0000046_39203_40222 339
285 3300049581 Ga0501047_0000847 Ga0501047_0000847_5193_6212 339
286 3300049582 Ga0501048_0007446 Ga0501048_0007446_4766_5785 339
287 3300049586 Ga0501070_0108297 Ga0501070_0108297_583_1605 339
288 3300049590 Ga0501074_0000386 Ga0501074_0000386_10155_11174 339
289 3300049743 Ga0501081_0064085 Ga0501081_0064085_273_1295 339
290 3300049823 Ga0501044_0027149 Ga0501044_0027149_2177_3196 339
291 3300050492 nmdc:mga0yw44_60506_c1 nmdc:mga0yw44_60506_c1_253_1296 339
292 3300050494 nmdc:mga06z11_8699_c1 nmdc:mga06z11_8699_c1_1459_2478 339
293 3300050495 nmdc:mga04h51_7072_c1 nmdc:mga04h51_7072_c1_882_1901 339
294 3300053088 Ga0500644_0013370 Ga0500644_0013370_1014_2078 339
295 3300053088 Ga0500644_0023406 Ga0500644_0023406_89_1108 339
296 3300053093 Ga0500651_0026997 Ga0500651_0026997_1014_2078 339
297 3300053104 Ga0500556_0001401 Ga0500556_0001401_771_1790 339
298 3300053107 Ga0500560_000102 Ga0500560_000102_2024_3043 339
299 3300053118 Ga0500594_0010255 Ga0500594_0010255_329_1348 339
300 3300053118 Ga0500594_0012147 Ga0500594_0012147_843_1907 339
301 3300053131 Ga0500652_008926 Ga0500652_008926_335_1399 339
302 3300053136 Ga0500559_0000418 Ga0500559_0000418_13529_14548 339
303 3300053140 Ga0500573_0098181 Ga0500573_0098181_76_1095 339
304 3300053142 Ga0500577_0103979 Ga0500577_0103979_68_1087 339
305 3300053153 Ga0500616_0031025 Ga0500616_0031025_1307_2326 339
306 3300061719 Ga0466962_0011199 Ga0466962_0011199_1045_2073 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

45

344

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9445 2 312
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9438 3 312
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9423 2 312
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9361 2 312
4xk2-assembly1.cif.gz_C crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9343 2 312
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9261 2 312 3.20.20.100
af_O59826_13_339_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9247 1 312 3.20.20.100
af_E9QGU5_66_406_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9176 2 312 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9172 1 318 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.913 1 312 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A838IDV3-F1-model_v4 Aldo/keto reductase 0.9817 1 277 GO:0005829
GO:0016491
AF-A0A6B3IEK8-F1-model_v4 Aldo/keto reductase 0.9792 1 198 GO:0005829
GO:0016491
AF-A0A6G2KLX0-F1-model_v4 deleted 0.9791 1 286
AF-A0A529VB17-F1-model_v4 deleted 0.9783 1 209
AF-A0A7X0G781-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9777 1 189 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
90.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map