F398615

General Info

Members Datasets Scaffolds Average Seq Length
306 169 612 212

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100590417|Ga0075429_1005904172
Length 248
Sequence MRCADARGAPNNEPETMNTEPNLKVNTNRAPRTENGERHRFPPLHAIVDVDVSARAGWTPLDLARAYLDGGARFLQIRAKRLASGPFLELCDGIVGMAVPYTASVIVNDRADLAVMARAAGVHVGQEDLLPQEARRLIGPSGIVGVSTHTVAQLAAAVREPISYLAVGPVFGTATKDTGYSAVGLELVSMAARLAGAIPVVAIGGITIDTAESVLEAGATSVAVIGDLLAEGNPQRRVAAYLQRFAGG

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
164 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.63
Nodule 0
Rhizoplane 5.23
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100590417 3300006880 Bacteria 973
2 SwRhRL2b_contig_2535975 2162886007 Bacteria 1510
3 Ga0065704_10100504 3300005289 Bacteria 2270
4 Ga0065712_10068193 3300005290 Bacteria 13253
5 Ga0065712_10069221 3300005290 Bacteria 7701
6 Ga0065712_10083634 3300005290 Bacteria 2822
7 Ga0065715_10003008 3300005293 Bacteria 5964
8 Ga0065707_10205330 3300005295 Bacteria 1291
9 Ga0070676_10272636 3300005328 Bacteria 1137
10 Ga0070683_100000857 3300005329 Bacteria 22475
11 Ga0070670_100015178 3300005331 Bacteria 6611
12 Ga0070670_100030559 3300005331 Bacteria 4639
13 Ga0070670_100036837 3300005331 Bacteria 4208
14 Ga0070670_100057259 3300005331 Bacteria 3346
15 Ga0068869_100118377 3300005334 Bacteria 2023
16 Ga0068869_100300386 3300005334 Bacteria 1296
17 Ga0068869_100703258 3300005334 Unclassified 862
18 Ga0070666_10383656 3300005335 Bacteria 1009
19 Ga0070682_100482232 3300005337 Unclassified 957
20 Ga0068868_100557760 3300005338 Bacteria 1010
21 Ga0070689_100116374 3300005340 Bacteria 2131
22 Ga0070687_100103774 3300005343 Bacteria 1597
23 Ga0070661_100038904 3300005344 Bacteria 3464
24 Ga0070668_100144236 3300005347 Bacteria 1921
25 Ga0070675_100057149 3300005354 Bacteria 3216
26 Ga0070675_100266925 3300005354 Bacteria 1501
27 Ga0070675_100379095 3300005354 Bacteria 1258
28 Ga0070671_100122675 3300005355 Bacteria 2187
29 Ga0070671_100175754 3300005355 Bacteria 1812
30 Ga0070673_100253706 3300005364 Bacteria 1534
31 Ga0070673_100828912 3300005364 Unclassified 855
32 Ga0070688_100005240 3300005365 Bacteria 6813
33 Ga0070688_100088275 3300005365 Bacteria 2021
34 Ga0070667_100743448 3300005367 Bacteria 909
35 Ga0070701_10031861 3300005438 Bacteria 2620
36 Ga0070701_10254273 3300005438 Bacteria 1062
37 Ga0070678_100303115 3300005456 Bacteria 1358
38 Ga0070662_100492004 3300005457 Bacteria 1022
39 Ga0070662_100692701 3300005457 Unclassified 862
40 Ga0070681_10109393 3300005458 Bacteria 2704
41 Ga0068867_100251641 3300005459 Bacteria 1437
42 Ga0068867_100633413 3300005459 Unclassified 936
43 Ga0070685_10183684 3300005466 Bacteria 1348
44 Ga0070685_10240336 3300005466 Bacteria 1195
45 Ga0070706_100219088 3300005467 Bacteria 1776
46 Ga0070707_100042137 3300005468 Bacteria 4370
47 Ga0070707_100189616 3300005468 Bacteria 2005
48 Ga0070698_100732817 3300005471 Bacteria 931
49 Ga0070699_100013503 3300005518 Bacteria 7034
50 Ga0070684_100000384 3300005535 Bacteria 30726
51 Ga0070697_100024200 3300005536 Bacteria 4834
52 Ga0070672_100010470 3300005543 Bacteria 6432
53 Ga0070672_100142501 3300005543 Bacteria 1978
54 Ga0070672_100191911 3300005543 Bacteria 1706
55 Ga0070672_100453756 3300005543 Bacteria 1104
56 Ga0070686_100062190 3300005544 Bacteria 2415
57 Ga0070686_100074133 3300005544 Bacteria 2236
58 Ga0070695_100069689 3300005545 Bacteria 2299
59 Ga0070695_100340303 3300005545 Bacteria 1121
60 Ga0070696_100138804 3300005546 Bacteria 1774
61 Ga0070665_100014743 3300005548 Bacteria 7844
62 Ga0070664_100000442 3300005564 Bacteria 31212
63 Ga0070664_100055485 3300005564 Bacteria 3364
64 Ga0068857_100082099 3300005577 Bacteria 2879
65 Ga0068854_100093125 3300005578 Bacteria 2245
66 Ga0070702_100104243 3300005615 Bacteria 1746
67 Ga0068859_100086227 3300005617 Bacteria 3186
68 Ga0068859_100088511 3300005617 Bacteria 3146
69 Ga0068859_100316046 3300005617 Bacteria 1656
70 Ga0068859_100413540 3300005617 Bacteria 1445
71 Ga0068864_100000951 3300005618 Bacteria 24240
72 Ga0068864_100007595 3300005618 Bacteria 8931
73 Ga0068864_100080504 3300005618 Bacteria 2854
74 Ga0068864_100195061 3300005618 Bacteria 1858
75 Ga0068861_100137248 3300005719 Bacteria 1991
76 Ga0068861_100201672 3300005719 Bacteria 1670
77 Ga0068863_100137108 3300005841 Bacteria 2338
78 Ga0068858_100000761 3300005842 Bacteria 33790
79 Ga0068858_100209644 3300005842 Bacteria 1844
80 Ga0068858_100409249 3300005842 Bacteria 1304
81 Ga0068858_100499767 3300005842 Bacteria 1175
82 Ga0068860_100733625 3300005843 Bacteria 999
83 Ga0075366_10200729 3300006195 Bacteria 1213
84 Ga0068871_100089612 3300006358 Bacteria 2561
85 Ga0075428_100138817 3300006844 Bacteria 2643
86 Ga0075430_100000569 3300006846 Bacteria 28027
87 Ga0075430_100073159 3300006846 Bacteria 2874
88 Ga0075431_100049918 3300006847 Bacteria 4314
89 Ga0075431_100117110 3300006847 Bacteria 2749
90 Ga0075431_100139155 3300006847 Bacteria 2503
91 Ga0075431_100503619 3300006847 Bacteria 1202
92 Ga0075433_10000881 3300006852 Bacteria 21089
93 Ga0075433_10068251 3300006852 Bacteria 3121
94 Ga0075433_10169875 3300006852 Bacteria 1940
95 Ga0075433_10584584 3300006852 Bacteria 981
96 Ga0075434_100000096 3300006871 Bacteria 48926
97 Ga0075434_100008080 3300006871 Bacteria 9757
98 Ga0075434_100555179 3300006871 Bacteria 1168
99 Ga0075429_100292214 3300006880 Bacteria 1427
100 Ga0075429_100611865 3300006880 Bacteria 954
101 Ga0097620_100086231 3300006931 Bacteria 3186
102 Ga0097620_100088514 3300006931 Bacteria 3146
103 Ga0097620_100316067 3300006931 Bacteria 1656
104 Ga0097620_100413522 3300006931 Bacteria 1445
105 Ga0075435_100200987 3300007076 Bacteria 1689
106 Ga0075435_100242970 3300007076 Bacteria 1531
107 Ga0075435_100255943 3300007076 Bacteria 1491
108 Ga0111539_10149894 3300009094 Bacteria 2730
109 Ga0111539_10836832 3300009094 Bacteria 1071
110 Ga0111539_11503650 3300009094 Unclassified 781
111 Ga0105247_10028872 3300009101 Bacteria 3357
112 Ga0114129_10012981 3300009147 Bacteria 11860
113 Ga0114129_10134613 3300009147 Bacteria 3392
114 Ga0114129_10268763 3300009147 Bacteria 2282
115 Ga0105241_11238411 3300009174 Bacteria 708
116 Ga0105242_10755637 3300009176 Bacteria 958
117 Ga0105242_11188403 3300009176 Bacteria 781
118 Ga0105248_10008986 3300009177 Bacteria 10985
119 Ga0105248_10013264 3300009177 Bacteria 9071
120 Ga0105237_10707452 3300009545 Unclassified 1014
121 Ga0105249_10377518 3300009553 Bacteria 1443
122 Ga0105249_10395224 3300009553 Bacteria 1412
123 Ga0105249_10408571 3300009553 Bacteria 1389
124 Ga0105249_10464656 3300009553 Bacteria 1306
125 Ga0105246_10147331 3300011119 Bacteria 1778
126 Ga0105246_10341507 3300011119 Unclassified 1224
127 Ga0105246_10662863 3300011119 Bacteria 910
128 Ga0157374_10958857 3300013296 Unclassified 874
129 Ga0163162_10296904 3300013306 Bacteria 1747
130 Ga0157375_10199085 3300013308 Bacteria 2158
131 Ga0157375_10222396 3300013308 Bacteria 2046
132 Ga0157375_10880754 3300013308 Unclassified 1040
133 Ga0163163_10029377 3300014325 Bacteria 5288
134 Ga0163163_10068439 3300014325 Bacteria 3533
135 Ga0163163_10192396 3300014325 Bacteria 2088
136 Ga0163163_10466483 3300014325 Bacteria 1323
137 Ga0157380_10544749 3300014326 Bacteria 1137
138 Ga0157379_10078485 3300014968 Bacteria 2957
139 Ga0157376_10429012 3300014969 Bacteria 1284
140 Ga0207697_10081211 3300025315 Bacteria 1366
141 Ga0207710_10017523 3300025900 Bacteria 3039
142 Ga0207688_10067152 3300025901 Bacteria 2029
143 Ga0207680_10190193 3300025903 Bacteria 1393
144 Ga0207645_10330256 3300025907 Bacteria 1018
145 Ga0207684_10311100 3300025910 Bacteria 1358
146 Ga0207684_10460546 3300025910 Bacteria 1091
147 Ga0207707_10401667 3300025912 Bacteria 1176
148 Ga0207649_10007526 3300025920 Bacteria 5919
149 Ga0207652_10116394 3300025921 Bacteria 2375
150 Ga0207646_10094758 3300025922 Bacteria 2674
151 Ga0207646_10200433 3300025922 Bacteria 1803
152 Ga0207681_10102345 3300025923 Bacteria 2068
153 Ga0207681_10119037 3300025923 Bacteria 1934
154 Ga0207650_10043452 3300025925 Bacteria 3299
155 Ga0207650_10044191 3300025925 Bacteria 3273
156 Ga0207659_10068534 3300025926 Bacteria 2580
157 Ga0207659_10153262 3300025926 Bacteria 1802
158 Ga0207644_10070008 3300025931 Bacteria 2563
159 Ga0207644_10263048 3300025931 Bacteria 1380
160 Ga0207706_10344955 3300025933 Bacteria 1295
161 Ga0207706_10348856 3300025933 Bacteria 1287
162 Ga0207706_10507553 3300025933 Bacteria 1040
163 Ga0207670_10123984 3300025936 Bacteria 1883
164 Ga0207670_10373577 3300025936 Bacteria 1134
165 Ga0207691_10006312 3300025940 Bacteria 11445
166 Ga0207691_10035891 3300025940 Bacteria 4596
167 Ga0207711_10058213 3300025941 Bacteria 3324
168 Ga0207711_10081147 3300025941 Bacteria 2834
169 Ga0207711_10758679 3300025941 Unclassified 904
170 Ga0207689_10315861 3300025942 Bacteria 1296
171 Ga0207661_10000600 3300025944 Bacteria 22994
172 Ga0207679_10003967 3300025945 Bacteria 9196
173 Ga0207679_10014090 3300025945 Bacteria 5247
174 Ga0207679_10102110 3300025945 Bacteria 2245
175 Ga0207651_10067010 3300025960 Bacteria 2525
176 Ga0207651_10124840 3300025960 Bacteria 1959
177 Ga0207651_10426756 3300025960 Bacteria 1133
178 Ga0207668_10262848 3300025972 Bacteria 1407
179 Ga0207668_10456451 3300025972 Bacteria 1092
180 Ga0207640_10124267 3300025981 Bacteria 1855
181 Ga0207658_10148102 3300025986 Bacteria 1909
182 Ga0207677_10802011 3300026023 Unclassified 843
183 Ga0207703_10041479 3300026035 Bacteria 3687
184 Ga0207703_10175856 3300026035 Bacteria 1886
185 Ga0207703_10468125 3300026035 Bacteria 1180
186 Ga0207708_10217018 3300026075 Bacteria 1531
187 Ga0207641_10224572 3300026088 Bacteria 1743
188 Ga0207641_10411249 3300026088 Bacteria 1301
189 Ga0207648_10366472 3300026089 Bacteria 1301
190 Ga0207648_10400023 3300026089 Bacteria 1244
191 Ga0207676_10058577 3300026095 Bacteria 3039
192 Ga0207676_10079171 3300026095 Bacteria 2664
193 Ga0207676_10104571 3300026095 Bacteria 2355
194 Ga0207676_10693871 3300026095 Bacteria 986
195 Ga0207674_10130168 3300026116 Bacteria 2480
196 Ga0207675_100198327 3300026118 Bacteria 1927
197 Ga0207675_100401502 3300026118 Bacteria 1351
198 Ga0207683_10064221 3300026121 Bacteria 3235
199 Ga0207683_10106832 3300026121 Bacteria 2503
200 Ga0268266_10019809 3300028379 Bacteria 5733
201 Ga0307408_100025520 3300031548 Bacteria 4048
202 Ga0307410_10002544 3300031852 Bacteria 8830
203 Ga0307410_10196407 3300031852 Bacteria 1538
204 Ga0307410_10197789 3300031852 Bacteria 1533
205 Ga0307410_10622920 3300031852 Unclassified 902
206 Ga0307407_10304061 3300031903 Unclassified 1113
207 Ga0307409_100108067 3300031995 Bacteria 2325
208 Ga0307409_100155114 3300031995 Bacteria 1994
209 Ga0307409_100310566 3300031995 Bacteria 1471
210 Ga0307416_100006754 3300032002 Bacteria 7211
211 Ga0307416_100022215 3300032002 Bacteria 4575
212 Ga0307414_10019131 3300032004 Bacteria 4237
213 Ga0307411_10008385 3300032005 Bacteria 5349
214 Ga0307411_10313577 3300032005 Bacteria 1263
215 Ga0307415_100018726 3300032126 Bacteria 4189
216 Ga0307415_100454266 3300032126 Unclassified 1108
217 Ga0373937_0008581 3300036401 Bacteria 8875
218 Ga0439434_0068561 3300042435 Bacteria 1115
219 Ga0439464_0029683 3300042439 Bacteria 1529
220 Ga0451576_0038377 3300045051 Bacteria 5069
221 Ga0451576_0762101 3300045051 Bacteria 1016
222 Ga0495629_0095742 3300046459 Bacteria 2071
223 Ga0495644_0133672 3300046523 Bacteria 946
224 Ga0495633_0139459 3300046558 Bacteria 1121
225 Ga0495659_0004842 3300046664 Bacteria 4238
226 Ga0495636_0013794 3300047318 Bacteria 3207
227 Ga0495677_0014441 3300047445 Bacteria 2875
228 Ga0496101_0586522 3300048904 Unclassified 881
229 Ga0496104_0013754 3300048907 Bacteria 7298
230 Ga0496105_0061782 3300048908 Bacteria 3092
231 Ga0496105_0145930 3300048908 Bacteria 1946
232 Ga0496106_0060594 3300048909 Bacteria 2869
233 Ga0496108_0001072 3300048911 Bacteria 21340
234 Ga0496108_0007537 3300048911 Bacteria 8820
235 Ga0496109_0001229 3300048912 Bacteria 21283
236 Ga0496109_0009275 3300048912 Bacteria 8383
237 Ga0496110_0001039 3300048913 Bacteria 19543
238 Ga0496110_0173712 3300048913 Bacteria 1955
239 Ga0496112_0000481 3300048915 Bacteria 26754
240 Ga0496112_0001561 3300048915 Bacteria 17703
241 Ga0496113_0067732 3300048916 Bacteria 2708
242 Ga0496113_0126111 3300048916 Bacteria 2005
243 Ga0496113_0151220 3300048916 Bacteria 1831
244 Ga0501299_035419 3300049522 Unclassified 981
245 Ga0501036_0073013 3300049572 Bacteria 2901
246 Ga0501036_0142535 3300049572 Bacteria 2022
247 Ga0501036_0567922 3300049572 Bacteria 942
248 Ga0501039_0053138 3300049575 Bacteria 3135
249 Ga0501040_0064515 3300049576 Bacteria 2521
250 Ga0501040_0106698 3300049576 Bacteria 1957
251 Ga0501041_0165898 3300049577 Bacteria 1381
252 Ga0501046_0060749 3300049580 Bacteria 2957
253 Ga0501048_0053350 3300049582 Bacteria 2876
254 Ga0501048_0058829 3300049582 Bacteria 2724
255 Ga0501048_0321313 3300049582 Bacteria 1103
256 Ga0501071_0123635 3300049587 Bacteria 1919
257 Ga0501071_0178157 3300049587 Bacteria 1592
258 Ga0501072_0018914 3300049588 Bacteria 5316
259 Ga0501072_0045520 3300049588 Bacteria 3451
260 Ga0501072_0517518 3300049588 Bacteria 943
261 Ga0501074_0137077 3300049590 Bacteria 1750
262 Ga0501075_0215941 3300049591 Bacteria 1463
263 Ga0501075_0287818 3300049591 Bacteria 1252
264 Ga0501076_0005477 3300049592 Bacteria 9139
265 Ga0501076_0019614 3300049592 Bacteria 5170
266 Ga0501076_0303712 3300049592 Bacteria 1309
267 Ga0501076_0778570 3300049592 Bacteria 789
268 Ga0501077_0062288 3300049593 Bacteria 2367
269 Ga0501217_047383 3300049661 Unclassified 1113
270 Ga0501079_0044664 3300049741 Bacteria 3419
271 Ga0501079_0127847 3300049741 Bacteria 1977
272 Ga0501081_0003025 3300049743 Bacteria 10671
273 Ga0501081_0140810 3300049743 Bacteria 1729
274 Ga0501081_0144156 3300049743 Bacteria 1708
275 Ga0501083_0052832 3300049744 Bacteria 2729
276 Ga0501045_0035384 3300049824 Bacteria 3626
277 nmdc:mga05p37_128595_c1 3300050507 Bacteria 3109
278 nmdc:mga05p37_23869_c1 3300050507 Bacteria 5364
279 nmdc:mga05p37_82707_c1 3300050507 Bacteria 3558
280 nmdc:mga09592_339344_c1 3300050508 Bacteria 1301
281 nmdc:mga0qj67_1398_c1 3300050509 Bacteria 16934
282 nmdc:mga0qj67_231412_c1 3300050509 Bacteria 1499
283 nmdc:mga0qj67_43146_c1 3300050509 Bacteria 3552
284 nmdc:mga06r32_36060_c1 3300050510 Bacteria 4670
285 nmdc:mga06r32_79766_c1 3300050510 Bacteria 3184
286 nmdc:mga08y16_15505_c1 3300050511 Bacteria 8012
287 nmdc:mga08y16_191171_c1 3300050511 Bacteria 2123
288 nmdc:mga0n895_1130509_c1 3300050512 Unclassified 759
289 nmdc:mga0n895_1871_c1 3300050512 Bacteria 16073
290 nmdc:mga0n895_20568_c1 3300050512 Bacteria 6157
291 nmdc:mga0n895_473131_c1 3300050512 Bacteria 1264
292 nmdc:mga0n895_77990_c1 3300050512 Bacteria 3296
293 nmdc:mga0n895_950766_c1 3300050512 Bacteria 843
294 nmdc:mga0rr50_104362_c1 3300050513 Bacteria 2233
295 nmdc:mga0rr50_11091_c1 3300050513 Bacteria 5749
296 nmdc:mga0a205_139608_c1 3300050515 Bacteria 2324
297 nmdc:mga0a205_213023_c1 3300050515 Bacteria 1820
298 nmdc:mga0a205_259_c1 3300050515 Bacteria 38100
299 Ga0500555_000332 3300053103 Bacteria 20321
300 Ga0500616_0000167 3300053153 Bacteria 109823
301 Ga0500645_000331 3300053730 Bacteria 33681
302 Ga0500599_001413 3300053736 Bacteria 2750
303 Ga0501084_0049859 3300054114 Bacteria 3505
304 Ga0501084_0063454 3300054114 Bacteria 3093
305 Ga0501082_0082945 3300060353 Bacteria 2766
306 Ga0530510_0030877 3300061734 Bacteria 3850
307 Ga0075429_100590417
308 SwRhRL2b_contig_2535975
309 Ga0065704_10100504
310 Ga0065712_10068193
311 Ga0065712_10069221
312 Ga0065712_10083634
313 Ga0065715_10003008
314 Ga0065707_10205330
315 Ga0070676_10272636
316 Ga0070683_100000857
317 Ga0070670_100015178
318 Ga0070670_100030559
319 Ga0070670_100036837
320 Ga0070670_100057259
321 Ga0068869_100118377
322 Ga0068869_100300386
323 Ga0068869_100703258
324 Ga0070666_10383656
325 Ga0070682_100482232
326 Ga0068868_100557760
327 Ga0070689_100116374
328 Ga0070687_100103774
329 Ga0070661_100038904
330 Ga0070668_100144236
331 Ga0070675_100057149
332 Ga0070675_100266925
333 Ga0070675_100379095
334 Ga0070671_100122675
335 Ga0070671_100175754
336 Ga0070673_100253706
337 Ga0070673_100828912
338 Ga0070688_100005240
339 Ga0070688_100088275
340 Ga0070667_100743448
341 Ga0070701_10031861
342 Ga0070701_10254273
343 Ga0070678_100303115
344 Ga0070662_100492004
345 Ga0070662_100692701
346 Ga0070681_10109393
347 Ga0068867_100251641
348 Ga0068867_100633413
349 Ga0070685_10183684
350 Ga0070685_10240336
351 Ga0070706_100219088
352 Ga0070707_100042137
353 Ga0070707_100189616
354 Ga0070698_100732817
355 Ga0070699_100013503
356 Ga0070684_100000384
357 Ga0070697_100024200
358 Ga0070672_100010470
359 Ga0070672_100142501
360 Ga0070672_100191911
361 Ga0070672_100453756
362 Ga0070686_100062190
363 Ga0070686_100074133
364 Ga0070695_100069689
365 Ga0070695_100340303
366 Ga0070696_100138804
367 Ga0070665_100014743
368 Ga0070664_100000442
369 Ga0070664_100055485
370 Ga0068857_100082099
371 Ga0068854_100093125
372 Ga0070702_100104243
373 Ga0068859_100086227
374 Ga0068859_100088511
375 Ga0068859_100316046
376 Ga0068859_100413540
377 Ga0068864_100000951
378 Ga0068864_100007595
379 Ga0068864_100080504
380 Ga0068864_100195061
381 Ga0068861_100137248
382 Ga0068861_100201672
383 Ga0068863_100137108
384 Ga0068858_100000761
385 Ga0068858_100209644
386 Ga0068858_100409249
387 Ga0068858_100499767
388 Ga0068860_100733625
389 Ga0075366_10200729
390 Ga0068871_100089612
391 Ga0075428_100138817
392 Ga0075430_100000569
393 Ga0075430_100073159
394 Ga0075431_100049918
395 Ga0075431_100117110
396 Ga0075431_100139155
397 Ga0075431_100503619
398 Ga0075433_10000881
399 Ga0075433_10068251
400 Ga0075433_10169875
401 Ga0075433_10584584
402 Ga0075434_100000096
403 Ga0075434_100008080
404 Ga0075434_100555179
405 Ga0075429_100292214
406 Ga0075429_100611865
407 Ga0097620_100086231
408 Ga0097620_100088514
409 Ga0097620_100316067
410 Ga0097620_100413522
411 Ga0075435_100200987
412 Ga0075435_100242970
413 Ga0075435_100255943
414 Ga0111539_10149894
415 Ga0111539_10836832
416 Ga0111539_11503650
417 Ga0105247_10028872
418 Ga0114129_10012981
419 Ga0114129_10134613
420 Ga0114129_10268763
421 Ga0105241_11238411
422 Ga0105242_10755637
423 Ga0105242_11188403
424 Ga0105248_10008986
425 Ga0105248_10013264
426 Ga0105237_10707452
427 Ga0105249_10377518
428 Ga0105249_10395224
429 Ga0105249_10408571
430 Ga0105249_10464656
431 Ga0105246_10147331
432 Ga0105246_10341507
433 Ga0105246_10662863
434 Ga0157374_10958857
435 Ga0163162_10296904
436 Ga0157375_10199085
437 Ga0157375_10222396
438 Ga0157375_10880754
439 Ga0163163_10029377
440 Ga0163163_10068439
441 Ga0163163_10192396
442 Ga0163163_10466483
443 Ga0157380_10544749
444 Ga0157379_10078485
445 Ga0157376_10429012
446 Ga0207697_10081211
447 Ga0207710_10017523
448 Ga0207688_10067152
449 Ga0207680_10190193
450 Ga0207645_10330256
451 Ga0207684_10311100
452 Ga0207684_10460546
453 Ga0207707_10401667
454 Ga0207649_10007526
455 Ga0207652_10116394
456 Ga0207646_10094758
457 Ga0207646_10200433
458 Ga0207681_10102345
459 Ga0207681_10119037
460 Ga0207650_10043452
461 Ga0207650_10044191
462 Ga0207659_10068534
463 Ga0207659_10153262
464 Ga0207644_10070008
465 Ga0207644_10263048
466 Ga0207706_10344955
467 Ga0207706_10348856
468 Ga0207706_10507553
469 Ga0207670_10123984
470 Ga0207670_10373577
471 Ga0207691_10006312
472 Ga0207691_10035891
473 Ga0207711_10058213
474 Ga0207711_10081147
475 Ga0207711_10758679
476 Ga0207689_10315861
477 Ga0207661_10000600
478 Ga0207679_10003967
479 Ga0207679_10014090
480 Ga0207679_10102110
481 Ga0207651_10067010
482 Ga0207651_10124840
483 Ga0207651_10426756
484 Ga0207668_10262848
485 Ga0207668_10456451
486 Ga0207640_10124267
487 Ga0207658_10148102
488 Ga0207677_10802011
489 Ga0207703_10041479
490 Ga0207703_10175856
491 Ga0207703_10468125
492 Ga0207708_10217018
493 Ga0207641_10224572
494 Ga0207641_10411249
495 Ga0207648_10366472
496 Ga0207648_10400023
497 Ga0207676_10058577
498 Ga0207676_10079171
499 Ga0207676_10104571
500 Ga0207676_10693871
501 Ga0207674_10130168
502 Ga0207675_100198327
503 Ga0207675_100401502
504 Ga0207683_10064221
505 Ga0207683_10106832
506 Ga0268266_10019809
507 Ga0307408_100025520
508 Ga0307410_10002544
509 Ga0307410_10196407
510 Ga0307410_10197789
511 Ga0307410_10622920
512 Ga0307407_10304061
513 Ga0307409_100108067
514 Ga0307409_100155114
515 Ga0307409_100310566
516 Ga0307416_100006754
517 Ga0307416_100022215
518 Ga0307414_10019131
519 Ga0307411_10008385
520 Ga0307411_10313577
521 Ga0307415_100018726
522 Ga0307415_100454266
523 Ga0373937_0008581
524 Ga0439434_0068561
525 Ga0439464_0029683
526 Ga0451576_0038377
527 Ga0451576_0762101
528 Ga0495629_0095742
529 Ga0495644_0133672
530 Ga0495633_0139459
531 Ga0495659_0004842
532 Ga0495636_0013794
533 Ga0495677_0014441
534 Ga0496101_0586522
535 Ga0496104_0013754
536 Ga0496105_0061782
537 Ga0496105_0145930
538 Ga0496106_0060594
539 Ga0496108_0001072
540 Ga0496108_0007537
541 Ga0496109_0001229
542 Ga0496109_0009275
543 Ga0496110_0001039
544 Ga0496110_0173712
545 Ga0496112_0000481
546 Ga0496112_0001561
547 Ga0496113_0067732
548 Ga0496113_0126111
549 Ga0496113_0151220
550 Ga0501299_035419
551 Ga0501036_0073013
552 Ga0501036_0142535
553 Ga0501036_0567922
554 Ga0501039_0053138
555 Ga0501040_0064515
556 Ga0501040_0106698
557 Ga0501041_0165898
558 Ga0501046_0060749
559 Ga0501048_0053350
560 Ga0501048_0058829
561 Ga0501048_0321313
562 Ga0501071_0123635
563 Ga0501071_0178157
564 Ga0501072_0018914
565 Ga0501072_0045520
566 Ga0501072_0517518
567 Ga0501074_0137077
568 Ga0501075_0215941
569 Ga0501075_0287818
570 Ga0501076_0005477
571 Ga0501076_0019614
572 Ga0501076_0303712
573 Ga0501076_0778570
574 Ga0501077_0062288
575 Ga0501217_047383
576 Ga0501079_0044664
577 Ga0501079_0127847
578 Ga0501081_0003025
579 Ga0501081_0140810
580 Ga0501081_0144156
581 Ga0501083_0052832
582 Ga0501045_0035384
583 nmdc:mga05p37_128595_c1
584 nmdc:mga05p37_23869_c1
585 nmdc:mga05p37_82707_c1
586 nmdc:mga09592_339344_c1
587 nmdc:mga0qj67_1398_c1
588 nmdc:mga0qj67_231412_c1
589 nmdc:mga0qj67_43146_c1
590 nmdc:mga06r32_36060_c1
591 nmdc:mga06r32_79766_c1
592 nmdc:mga08y16_15505_c1
593 nmdc:mga08y16_191171_c1
594 nmdc:mga0n895_1130509_c1
595 nmdc:mga0n895_1871_c1
596 nmdc:mga0n895_20568_c1
597 nmdc:mga0n895_473131_c1
598 nmdc:mga0n895_77990_c1
599 nmdc:mga0n895_950766_c1
600 nmdc:mga0rr50_104362_c1
601 nmdc:mga0rr50_11091_c1
602 nmdc:mga0a205_139608_c1
603 nmdc:mga0a205_213023_c1
604 nmdc:mga0a205_259_c1
605 Ga0500555_000332
606 Ga0500616_0000167
607 Ga0500645_000331
608 Ga0500599_001413
609 Ga0501084_0049859
610 Ga0501084_0063454
611 Ga0501082_0082945
612 Ga0530510_0030877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

44

228

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.945 7 199
1g4t-assembly1.cif.gz_A thiamin phosphate synthase 0.932 6 199
1g67-assembly1.cif.gz_A thiamin phosphate synthase 0.9314 6 199
3nl3-assembly1.cif.gz_A the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.9156 10 197
3nm1-assembly1.cif.gz_F the crystal structure of candida glabrata thi6, a bifunctional enzyme involved in thiamin biosyhthesis of eukaryotes 0.9115 10 200
ID Description Score Start End Superfamily
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.945 7 199 3.20.20.70
af_Q5AEJ1_1_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9372 14 198 3.20.20.70
af_Q2FWG3_1_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9317 15 198 3.20.20.70
af_A0A1D6MYJ2_339_548_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9302 4 200 3.20.20.70
af_P40386_1_220_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9294 10 198 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V8DCB4-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9881 2 198 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A843S3Q4-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9871 1 199 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A383AF66-F1-model_v4 thiamine phosphate synthase (EC 2.5.1.3) 0.9851 1 194 GO:0004789
GO:0005737
GO:0009228
GO:0009229
GO:0046872
AF-A0A7Y4SIR1-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9836 14 198 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A2G4JHB9-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9836 1 198 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229

Map