F398597

General Info

Members Datasets Scaffolds Average Seq Length
306 246 612 209

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10023917|Ga0075367_100239172
Length 239
Sequence MSKDLSFIHRFEPGNRLEAPPLLLLHGTGGDENDLLPLGEAIAPGAPLLSVRGQVLEHGMPRFFRRLAEGVFDEDDVRRRANELADFVVAARSRYGLAAPIALGYSNGANIAAAVLLLRPDVLAGAILLRAMVPLRQAPTPDLAGKPVLIASGNSDPIIPRDNSARLATMLQQAGAEVQHPTLPVGHQLSQADLTLAKTWVQGLRHISIQRDPAKPVAVSGDEPGNRHVIVSDVGLNHQ

Samples

Sample ID Description Type Environment
1 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
100 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
139 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
145 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
146 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
159 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
160 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
161 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
162 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
163 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
166 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
173 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
177 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
178 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
179 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
180 2508501050 Microvirga lupini Lut6 Isolate Nodule
181 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
182 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
183 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
184 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
185 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
186 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
187 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
188 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
189 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
190 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
191 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
192 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
193 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
194 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
195 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
196 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
197 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
198 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
199 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
200 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
201 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
202 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
203 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
204 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
205 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
206 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
207 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
208 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
209 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
210 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
211 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
212 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
213 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
214 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
215 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
216 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
217 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
218 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
219 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
220 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
221 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
222 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
223 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
224 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
225 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
226 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
227 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
228 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
229 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
230 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
231 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
232 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
233 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
234 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
235 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
236 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
237 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
238 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
239 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
240 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
241 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
242 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
243 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
244 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
245 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
246 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.45
Metatranscriptomes 0.65
Isolates 21.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.12
Nodule 16.34
Rhizoplane 1.96
Rhizosphere 37.58
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075367_10023917 3300006178 Bacteria 3442
2 JGI25153J46596_10001303 3300003215 Bacteria 14946
3 JGI25160J50197_1000843 3300003354 Bacteria 16282
4 Ga0055526_1000264 3300003771 Bacteria 44056
5 Ga0055524_1004486 3300003775 Bacteria 6433
6 Ga0055543_1014177 3300004625 Bacteria 1559
7 Ga0065165_1000596 3300005262 Bacteria 53028
8 Ga0065165_1000659 3300005262 Bacteria 49829
9 Ga0065165_1030251 3300005262 Bacteria 1725
10 Ga0065165_1087013 3300005262 Bacteria 802
11 Ga0070683_100044588 3300005329 Bacteria 4090
12 Ga0070683_100212543 3300005329 Bacteria 1837
13 Ga0070660_100288905 3300005339 Bacteria 1343
14 Ga0070675_100568774 3300005354 Bacteria 1026
15 Ga0070659_100695455 3300005366 Bacteria 879
16 Ga0070714_100121439 3300005435 Bacteria 2325
17 Ga0070713_100327863 3300005436 Bacteria 1415
18 Ga0070710_10043427 3300005437 Bacteria 2489
19 Ga0070710_10220745 3300005437 Bacteria 1206
20 Ga0070711_100047343 3300005439 Bacteria 2935
21 Ga0070708_100431869 3300005445 Bacteria 1242
22 Ga0070663_100054362 3300005455 Bacteria 2861
23 Ga0070681_10025106 3300005458 Bacteria 5997
24 Ga0070681_10580000 3300005458 Bacteria 1035
25 Ga0070679_100063711 3300005530 Bacteria 3675
26 Ga0070679_100066640 3300005530 Bacteria 3589
27 Ga0070684_100018785 3300005535 Bacteria 5703
28 Ga0070672_100170091 3300005543 Bacteria 1812
29 Ga0070665_100009225 3300005548 Bacteria 9996
30 Ga0070665_100824121 3300005548 Bacteria 941
31 Ga0068855_100644202 3300005563 Bacteria 1139
32 Ga0068856_100262243 3300005614 Bacteria 1743
33 Ga0068864_100400735 3300005618 Bacteria 1304
34 Ga0068861_100525508 3300005719 Bacteria 1074
35 Ga0068863_100096091 3300005841 Bacteria 2813
36 Ga0081538_10049985 3300005981 Bacteria 2531
37 Ga0081540_1047714 3300005983 Bacteria 2151
38 Ga0075365_10002706 3300006038 Bacteria 8834
39 Ga0075365_10094869 3300006038 Bacteria 2037
40 Ga0075365_10099470 3300006038 Bacteria 1990
41 Ga0075365_10167963 3300006038 Bacteria 1531
42 Ga0075364_10013988 3300006051 Bacteria 4946
43 Ga0075364_10020895 3300006051 Bacteria 4121
44 Ga0070712_100008662 3300006175 Bacteria 6406
45 Ga0070712_100225483 3300006175 Bacteria 1486
46 Ga0075367_10008439 3300006178 Bacteria 5337
47 Ga0075369_10003114 3300006186 Bacteria 6003
48 Ga0075369_10049451 3300006186 Bacteria 1816
49 Ga0075366_10199211 3300006195 Bacteria 1217
50 Ga0075370_10029620 3300006353 Bacteria 3050
51 Ga0075370_10048154 3300006353 Bacteria 2414
52 Ga0075428_100271090 3300006844 Bacteria 1826
53 Ga0105240_10102072 3300009093 Bacteria 3487
54 Ga0105245_10369493 3300009098 Bacteria 1426
55 Ga0105243_10084588 3300009148 Bacteria 2598
56 Ga0105241_10094381 3300009174 Bacteria 2366
57 Ga0105237_10082752 3300009545 Bacteria 3200
58 Ga0105237_10294039 3300009545 Bacteria 1627
59 Ga0105237_10891342 3300009545 Bacteria 896
60 Ga0105249_10357807 3300009553 Bacteria 1480
61 Ga0105239_10835892 3300010375 Bacteria 1056
62 Ga0105239_10984898 3300010375 Bacteria 969
63 Ga0105246_10007462 3300011119 Bacteria 6701
64 Ga0157369_10027962 3300013105 Bacteria 6245
65 Ga0157369_10290622 3300013105 Bacteria 1701
66 Ga0157372_10592235 3300013307 Bacteria 1292
67 Ga0163163_10519025 3300014325 Bacteria 1253
68 Ga0182008_10051830 3300014497 Bacteria 2035
69 Ga0157376_11088327 3300014969 Bacteria 825
70 Ga0197907_10705390 3300020069 Bacteria 1274
71 Ga0206353_11627051 3300020082 Bacteria 3767
72 Ga0213874_10011033 3300021377 Bacteria 2278
73 Ga0213876_10109604 3300021384 Bacteria 1465
74 Ga0209025_1018089 3300025294 Bacteria 4025
75 Ga0209564_1000023 3300025295 Bacteria 555102
76 Ga0209564_1035093 3300025295 Bacteria 1458
77 Ga0209758_1002456 3300025297 Bacteria 18900
78 Ga0209758_1003383 3300025297 Bacteria 14598
79 Ga0209256_1000262 3300025299 Bacteria 93226
80 Ga0209256_1017538 3300025299 Bacteria 2372
81 Ga0207426_1000120 3300025302 Bacteria 219117
82 Ga0207426_1002210 3300025302 Bacteria 13068
83 Ga0209257_1045798 3300025304 Bacteria 1268
84 Ga0207697_10019348 3300025315 Bacteria 2788
85 Ga0207692_10278507 3300025898 Bacteria 1011
86 Ga0207647_10004646 3300025904 Bacteria 10177
87 Ga0207685_10035549 3300025905 Bacteria 1819
88 Ga0207654_10024819 3300025911 Bacteria 3227
89 Ga0207707_10018888 3300025912 Bacteria 6011
90 Ga0207695_10200858 3300025913 Bacteria 1908
91 Ga0207671_10281537 3300025914 Bacteria 1311
92 Ga0207693_10846172 3300025915 Bacteria 704
93 Ga0207663_10102251 3300025916 Bacteria 1927
94 Ga0207660_10074927 3300025917 Bacteria 2471
95 Ga0207652_10159583 3300025921 Bacteria 2021
96 Ga0207650_10966122 3300025925 Bacteria 724
97 Ga0207664_10205752 3300025929 Bacteria 1701
98 Ga0207690_10365683 3300025932 Bacteria 1143
99 Ga0207665_10052234 3300025939 Bacteria 2753
100 Ga0207661_10056005 3300025944 Bacteria 3164
101 Ga0207679_10284769 3300025945 Bacteria 1419
102 Ga0207712_10340060 3300025961 Bacteria 1244
103 Ga0207668_10065384 3300025972 Bacteria 2574
104 Ga0207658_10108244 3300025986 Bacteria 2192
105 Ga0207639_10033294 3300026041 Bacteria 3801
106 Ga0207678_10144574 3300026067 Bacteria 2030
107 Ga0207676_10227326 3300026095 Bacteria 1666
108 Ga0207675_100422590 3300026118 Bacteria 1316
109 Ga0207683_10760498 3300026121 Bacteria 899
110 Ga0209813_10028045 3300027866 Bacteria 1639
111 Ga0268266_10011737 3300028379 Bacteria 7600
112 Ga0268266_10601745 3300028379 Bacteria 1056
113 Ga0268265_10125808 3300028380 Bacteria 2121
114 Ga0307517_10103800 3300028786 Bacteria 2219
115 Ga0307515_10436377 3300028794 Bacteria 927
116 Ga0307510_10009227 3300033180 Bacteria 11753
117 Ga0307510_10052059 3300033180 Bacteria 4323
118 Ga0395900_0448272 3300037418 Bacteria 1247
119 Ga0395898_1099727 3300037466 Bacteria 728
120 Ga0395905_0444266 3300037471 Bacteria 1194
121 Ga0436364_0949992 3300037853 Bacteria 3645
122 Ga0436365_1493923 3300039437 Unclassified 2158
123 Ga0436361_0195427 3300039447 Bacteria 2695
124 Ga0436363_0980661 3300039450 Bacteria 3235
125 Ga0451787_012234 3300041441 Bacteria 720
126 Ga0451793_1036182 3300041452 Bacteria 1170
127 Ga0466969_0047723 3300044656 Bacteria 2119
128 Ga0466972_0051089 3300044658 Bacteria 1995
129 Ga0466966_0000275 3300044684 Bacteria 33692
130 Ga0466961_0000008 3300044693 Bacteria 142607
131 Ga0466964_0070638 3300044706 Bacteria 1476
132 Ga0466960_0340265 3300044901 Bacteria 853
133 Ga0466959_0042372 3300045049 Bacteria 3358
134 Ga0466958_0620464 3300045836 Bacteria 704
135 Ga0466967_0179600 3300045976 Bacteria 1996
136 Ga0495592_0240373 3300046454 Bacteria 1202
137 Ga0495638_0009193 3300046460 Bacteria 6949
138 Ga0495607_0117255 3300046501 Bacteria 1403
139 Ga0495583_0096333 3300046506 Bacteria 1268
140 Ga0495608_0178501 3300046511 Bacteria 1344
141 Ga0495610_0057572 3300046512 Bacteria 1863
142 Ga0495616_0090631 3300046513 Bacteria 1448
143 Ga0495618_0002681 3300046514 Bacteria 11338
144 Ga0495620_0202739 3300046515 Bacteria 763
145 Ga0495648_0000619 3300046524 Bacteria 38032
146 Ga0495648_0041473 3300046524 Bacteria 2906
147 Ga0495654_0027234 3300046530 Bacteria 2932
148 Ga0495634_0189970 3300046642 Unclassified 1282
149 Ga0495635_0490870 3300046663 Bacteria 809
150 Ga0495613_0151006 3300046689 Bacteria 1657
151 Ga0495670_0029965 3300046691 Bacteria 2703
152 Ga0495670_0408924 3300046691 Bacteria 733
153 Ga0495671_0075361 3300046692 Bacteria 1655
154 Ga0495660_0268479 3300046810 Bacteria 785
155 Ga0495687_003040 3300047443 Bacteria 12607
156 Ga0495686_0364106 3300047472 Bacteria 783
157 Ga0495626_0041406 3300048091 Bacteria 2170
158 Ga0495626_0160253 3300048091 Bacteria 944
159 Ga0496103_0009975 3300048906 Bacteria 5617
160 Ga0496104_1028825 3300048907 Bacteria 727
161 Ga0496105_0121049 3300048908 Bacteria 2158
162 Ga0496116_0006388 3300048919 Bacteria 10702
163 Ga0496117_0039966 3300048920 Bacteria 3456
164 Ga0496117_0079191 3300048920 Bacteria 2166
165 Ga0496117_0118347 3300048920 Bacteria 1633
166 Ga0496117_0167879 3300048920 Bacteria 1277
167 Ga0496118_0060897 3300048921 Bacteria 2799
168 Ga0496118_0070533 3300048921 Bacteria 2522
169 Ga0496118_0227672 3300048921 Bacteria 1079
170 Ga0496118_0228849 3300048921 Bacteria 1075
171 Ga0496119_0024479 3300048922 Bacteria 4246
172 Ga0496120_0017687 3300048923 Bacteria 4610
173 Ga0496121_0008017 3300048924 Bacteria 12602
174 Ga0496121_0017675 3300048924 Bacteria 7258
175 Ga0496121_0033943 3300048924 Bacteria 4604
176 Ga0496121_0148437 3300048924 Bacteria 1729
177 Ga0496121_0197729 3300048924 Bacteria 1436
178 Ga0496121_0591505 3300048924 Bacteria 686
179 Ga0496122_0049597 3300048925 Bacteria 3211
180 Ga0496123_0101064 3300048926 Bacteria 1677
181 Ga0496123_0170072 3300048926 Bacteria 1151
182 Ga0496124_0298053 3300048927 Bacteria 1166
183 Ga0496125_0000446 3300048928 Bacteria 75321
184 Ga0496125_0000890 3300048928 Bacteria 47410
185 Ga0496125_0043473 3300048928 Bacteria 3812
186 Ga0496126_0007348 3300048929 Bacteria 12098
187 Ga0496126_0142292 3300048929 Bacteria 2063
188 Ga0496126_0338032 3300048929 Bacteria 1234
189 Ga0496126_0544795 3300048929 Bacteria 922
190 nmdc:mga03n38_186729_c1 3300050490 Bacteria 1065
191 nmdc:mga03n38_220713_c1 3300050490 Bacteria 989
192 nmdc:mga03n38_528_c1 3300050490 Bacteria 9683
193 nmdc:mga00v17_22033_c1 3300050491 Bacteria 3672
194 nmdc:mga0yw44_304656_c1 3300050492 Bacteria 1068
195 nmdc:mga0yw44_437570_c1 3300050492 Bacteria 886
196 nmdc:mga0yw44_6296_c1 3300050492 Bacteria 5722
197 nmdc:mga0yw44_74910_c1 3300050492 Bacteria 2109
198 nmdc:mga0yw44_8739_c1 3300050492 Bacteria 5068
199 nmdc:mga06z11_3404_c1 3300050494 Bacteria 6145
200 nmdc:mga04h51_12611_c1 3300050495 Bacteria 2376
201 nmdc:mga07m45_109826_c1 3300050496 Bacteria 1588
202 nmdc:mga07m45_50660_c1 3300050496 Bacteria 2340
203 nmdc:mga0sz30_2750_c1 3300050516 Bacteria 6274
204 Ga0500578_0283246 3300053086 Bacteria 988
205 Ga0500643_000509 3300053087 Bacteria 27700
206 Ga0500643_053518 3300053087 Bacteria 1148
207 Ga0500644_0074687 3300053088 Bacteria 1231
208 Ga0500581_073754 3300053089 Bacteria 1715
209 Ga0500646_0002645 3300053090 Bacteria 4636
210 Ga0500651_0003136 3300053093 Bacteria 8961
211 Ga0500651_0032103 3300053093 Bacteria 3310
212 Ga0500566_0000366 3300053094 Bacteria 24696
213 Ga0500566_0004574 3300053094 Bacteria 8253
214 Ga0500650_0085628 3300053098 Bacteria 1474
215 Ga0500555_002456 3300053103 Bacteria 5360
216 Ga0500556_0000003 3300053104 Bacteria 679379
217 Ga0500562_019890 3300053108 Bacteria 1740
218 Ga0500592_002185 3300053116 Bacteria 3156
219 Ga0500594_0016561 3300053118 Bacteria 1793
220 Ga0500595_004759 3300053119 Bacteria 6017
221 Ga0500607_143458 3300053121 Bacteria 1119
222 Ga0500608_000546 3300053122 Bacteria 14097
223 Ga0500618_019869 3300053125 Bacteria 1650
224 Ga0500642_0000525 3300053130 Bacteria 11666
225 Ga0500652_165516 3300053131 Bacteria 912
226 Ga0500658_0100164 3300053134 Bacteria 1263
227 Ga0500559_0000440 3300053136 Bacteria 29510
228 Ga0500559_0000593 3300053136 Bacteria 24618
229 Ga0500568_0002532 3300053139 Bacteria 10677
230 Ga0500568_0004146 3300053139 Bacteria 7829
231 Ga0500590_175099 3300053148 Bacteria 939
232 Ga0500616_0000017 3300053153 Bacteria 622969
233 Ga0500616_0001128 3300053153 Bacteria 27467
234 Ga0500622_0000957 3300053156 Bacteria 24532
235 Ga0500627_0016389 3300053158 Bacteria 2889
236 Ga0500636_0012625 3300053177 Bacteria 4952
237 Ga0500636_0016640 3300053177 Bacteria 4337
238 Ga0500596_007700 3300053735 Bacteria 1750
239 Ga0500661_003345 3300055283 Bacteria 3013
240 2508732677 2508501050 Bacteria 9633614
241 2511395102 2511231028 Bacteria 8046582
242 2513639386 2513237094 Bacteria 8789602
243 2524441853 2524023205 Bacteria 8918781
244 2528850858 2528768022 Bacteria 10457665
245 2603860432 2602042107 Bacteria 6226103
246 2617346499 2617270735 Bacteria 9163226
247 2745081310 2744054633 Bacteria 8678936
248 2824608624 2824600985 Bacteria 8488197
249 2824617631 2824609381 Bacteria 8672835
250 2824658940 2824653114 Bacteria 8493680
251 2824670315 2824661429 Bacteria 9877870
252 2824774759 2824773399 Bacteria 8360218
253 2842040354 2842038055 Bacteria 8002051
254 2842046702 2842045827 Bacteria 8006841
255 2854684874 2854681122 Bacteria 4548679
256 2857525379 2857524615 Bacteria 6615449
257 2874635318 2874628541 Bacteria 8630250
258 2879106032 2879099564 Bacteria 10442239
259 2888425293 2888419890 Bacteria 7857137
260 2893070955 2893066018 Bacteria 6158120
261 2903730599 2903727486 Bacteria 8281579
262 2919074930 2919073203 Bacteria 6531949
263 2932784672 2932784394 Bacteria 9704911
264 2932795426 2932794094 Bacteria 7915132
265 2932805957 2932801729 Bacteria 7987968
266 2932809652 2932809354 Bacteria 9135765
267 2932818605 2932818245 Bacteria 9955613
268 2932828440 2932828146 Bacteria 9745859
269 2935617413 2935616580 Bacteria 9032984
270 2935639105 2935638405 Bacteria 10015038
271 2935652304 2935648319 Bacteria 8801166
272 2935660886 2935656913 Bacteria 8965014
273 2935666043 2935665750 Bacteria 9571747
274 2935675690 2935675223 Bacteria 9928132
275 2935698548 2935694250 Bacteria 9291695
276 2935704112 2935703347 Bacteria 10242284
277 2935765964 2935760218 Bacteria 9817913
278 2935802195 2935801545 Bacteria 9301974
279 2935811019 2935810662 Bacteria 9401221
280 2935828600 2935827899 Bacteria 10038562
281 2935839976 2935837841 Bacteria 9454360
282 2935856038 2935855204 Bacteria 9035059
283 2935866018 2935864058 Bacteria 9784707
284 2935877657 2935873716 Bacteria 9632195
285 2935883680 2935883170 Bacteria 7964738
286 2935992601 2935992306 Bacteria 9802711
287 2936002473 2936002035 Bacteria 9362176
288 2936014942 2936011229 Bacteria 8801034
289 2936022077 2936019824 Bacteria 8804134
290 2936032765 2936028420 Bacteria 8965941
291 2936037562 2936037263 Bacteria 9446081
292 2936050683 2936046547 Bacteria 8903709
293 2936059541 2936055302 Bacteria 8785755
294 2941536777 2941531003 Bacteria 7653939
295 2941540684 2941538514 Bacteria 9402094
296 3005507389 3005506211 Bacteria 6943378
297 8016521072 8016511872 Bacteria 9921665
298 8016639486 8016630954 Bacteria 9217207
299 8017064534 8017057580 Bacteria 10023680
300 8019583911 8019576017 Bacteria 10049540
301 8019591714 8019586578 Bacteria 10212056
302 8019599622 8019597564 Bacteria 10041141
303 8019618924 8019608314 Bacteria 10042931
304 8019649043 8019648815 Bacteria 10014479
305 8055435269 8055431914 Bacteria 4551896
306 8056968735 8056967851 Bacteria 9038162
307 Ga0075367_10023917
308 JGI25153J46596_10001303
309 JGI25160J50197_1000843
310 Ga0055526_1000264
311 Ga0055524_1004486
312 Ga0055543_1014177
313 Ga0065165_1000596
314 Ga0065165_1000659
315 Ga0065165_1030251
316 Ga0065165_1087013
317 Ga0070683_100044588
318 Ga0070683_100212543
319 Ga0070660_100288905
320 Ga0070675_100568774
321 Ga0070659_100695455
322 Ga0070714_100121439
323 Ga0070713_100327863
324 Ga0070710_10043427
325 Ga0070710_10220745
326 Ga0070711_100047343
327 Ga0070708_100431869
328 Ga0070663_100054362
329 Ga0070681_10025106
330 Ga0070681_10580000
331 Ga0070679_100063711
332 Ga0070679_100066640
333 Ga0070684_100018785
334 Ga0070672_100170091
335 Ga0070665_100009225
336 Ga0070665_100824121
337 Ga0068855_100644202
338 Ga0068856_100262243
339 Ga0068864_100400735
340 Ga0068861_100525508
341 Ga0068863_100096091
342 Ga0081538_10049985
343 Ga0081540_1047714
344 Ga0075365_10002706
345 Ga0075365_10094869
346 Ga0075365_10099470
347 Ga0075365_10167963
348 Ga0075364_10013988
349 Ga0075364_10020895
350 Ga0070712_100008662
351 Ga0070712_100225483
352 Ga0075367_10008439
353 Ga0075369_10003114
354 Ga0075369_10049451
355 Ga0075366_10199211
356 Ga0075370_10029620
357 Ga0075370_10048154
358 Ga0075428_100271090
359 Ga0105240_10102072
360 Ga0105245_10369493
361 Ga0105243_10084588
362 Ga0105241_10094381
363 Ga0105237_10082752
364 Ga0105237_10294039
365 Ga0105237_10891342
366 Ga0105249_10357807
367 Ga0105239_10835892
368 Ga0105239_10984898
369 Ga0105246_10007462
370 Ga0157369_10027962
371 Ga0157369_10290622
372 Ga0157372_10592235
373 Ga0163163_10519025
374 Ga0182008_10051830
375 Ga0157376_11088327
376 Ga0197907_10705390
377 Ga0206353_11627051
378 Ga0213874_10011033
379 Ga0213876_10109604
380 Ga0209025_1018089
381 Ga0209564_1000023
382 Ga0209564_1035093
383 Ga0209758_1002456
384 Ga0209758_1003383
385 Ga0209256_1000262
386 Ga0209256_1017538
387 Ga0207426_1000120
388 Ga0207426_1002210
389 Ga0209257_1045798
390 Ga0207697_10019348
391 Ga0207692_10278507
392 Ga0207647_10004646
393 Ga0207685_10035549
394 Ga0207654_10024819
395 Ga0207707_10018888
396 Ga0207695_10200858
397 Ga0207671_10281537
398 Ga0207693_10846172
399 Ga0207663_10102251
400 Ga0207660_10074927
401 Ga0207652_10159583
402 Ga0207650_10966122
403 Ga0207664_10205752
404 Ga0207690_10365683
405 Ga0207665_10052234
406 Ga0207661_10056005
407 Ga0207679_10284769
408 Ga0207712_10340060
409 Ga0207668_10065384
410 Ga0207658_10108244
411 Ga0207639_10033294
412 Ga0207678_10144574
413 Ga0207676_10227326
414 Ga0207675_100422590
415 Ga0207683_10760498
416 Ga0209813_10028045
417 Ga0268266_10011737
418 Ga0268266_10601745
419 Ga0268265_10125808
420 Ga0307517_10103800
421 Ga0307515_10436377
422 Ga0307510_10009227
423 Ga0307510_10052059
424 Ga0395900_0448272
425 Ga0395898_1099727
426 Ga0395905_0444266
427 Ga0436364_0949992
428 Ga0436365_1493923
429 Ga0436361_0195427
430 Ga0436363_0980661
431 Ga0451787_012234
432 Ga0451793_1036182
433 Ga0466969_0047723
434 Ga0466972_0051089
435 Ga0466966_0000275
436 Ga0466961_0000008
437 Ga0466964_0070638
438 Ga0466960_0340265
439 Ga0466959_0042372
440 Ga0466958_0620464
441 Ga0466967_0179600
442 Ga0495592_0240373
443 Ga0495638_0009193
444 Ga0495607_0117255
445 Ga0495583_0096333
446 Ga0495608_0178501
447 Ga0495610_0057572
448 Ga0495616_0090631
449 Ga0495618_0002681
450 Ga0495620_0202739
451 Ga0495648_0000619
452 Ga0495648_0041473
453 Ga0495654_0027234
454 Ga0495634_0189970
455 Ga0495635_0490870
456 Ga0495613_0151006
457 Ga0495670_0029965
458 Ga0495670_0408924
459 Ga0495671_0075361
460 Ga0495660_0268479
461 Ga0495687_003040
462 Ga0495686_0364106
463 Ga0495626_0041406
464 Ga0495626_0160253
465 Ga0496103_0009975
466 Ga0496104_1028825
467 Ga0496105_0121049
468 Ga0496116_0006388
469 Ga0496117_0039966
470 Ga0496117_0079191
471 Ga0496117_0118347
472 Ga0496117_0167879
473 Ga0496118_0060897
474 Ga0496118_0070533
475 Ga0496118_0227672
476 Ga0496118_0228849
477 Ga0496119_0024479
478 Ga0496120_0017687
479 Ga0496121_0008017
480 Ga0496121_0017675
481 Ga0496121_0033943
482 Ga0496121_0148437
483 Ga0496121_0197729
484 Ga0496121_0591505
485 Ga0496122_0049597
486 Ga0496123_0101064
487 Ga0496123_0170072
488 Ga0496124_0298053
489 Ga0496125_0000446
490 Ga0496125_0000890
491 Ga0496125_0043473
492 Ga0496126_0007348
493 Ga0496126_0142292
494 Ga0496126_0338032
495 Ga0496126_0544795
496 nmdc:mga03n38_186729_c1
497 nmdc:mga03n38_220713_c1
498 nmdc:mga03n38_528_c1
499 nmdc:mga00v17_22033_c1
500 nmdc:mga0yw44_304656_c1
501 nmdc:mga0yw44_437570_c1
502 nmdc:mga0yw44_6296_c1
503 nmdc:mga0yw44_74910_c1
504 nmdc:mga0yw44_8739_c1
505 nmdc:mga06z11_3404_c1
506 nmdc:mga04h51_12611_c1
507 nmdc:mga07m45_109826_c1
508 nmdc:mga07m45_50660_c1
509 nmdc:mga0sz30_2750_c1
510 Ga0500578_0283246
511 Ga0500643_000509
512 Ga0500643_053518
513 Ga0500644_0074687
514 Ga0500581_073754
515 Ga0500646_0002645
516 Ga0500651_0003136
517 Ga0500651_0032103
518 Ga0500566_0000366
519 Ga0500566_0004574
520 Ga0500650_0085628
521 Ga0500555_002456
522 Ga0500556_0000003
523 Ga0500562_019890
524 Ga0500592_002185
525 Ga0500594_0016561
526 Ga0500595_004759
527 Ga0500607_143458
528 Ga0500608_000546
529 Ga0500618_019869
530 Ga0500642_0000525
531 Ga0500652_165516
532 Ga0500658_0100164
533 Ga0500559_0000440
534 Ga0500559_0000593
535 Ga0500568_0002532
536 Ga0500568_0004146
537 Ga0500590_175099
538 Ga0500616_0000017
539 Ga0500616_0001128
540 Ga0500622_0000957
541 Ga0500627_0016389
542 Ga0500636_0012625
543 Ga0500636_0016640
544 Ga0500596_007700
545 Ga0500661_003345
546 2508732677
547 2511395102
548 2513639386
549 2524441853
550 2528850858
551 2603860432
552 2617346499
553 2745081310
554 2824608624
555 2824617631
556 2824658940
557 2824670315
558 2824774759
559 2842040354
560 2842046702
561 2854684874
562 2857525379
563 2874635318
564 2879106032
565 2888425293
566 2893070955
567 2903730599
568 2919074930
569 2932784672
570 2932795426
571 2932805957
572 2932809652
573 2932818605
574 2932828440
575 2935617413
576 2935639105
577 2935652304
578 2935660886
579 2935666043
580 2935675690
581 2935698548
582 2935704112
583 2935765964
584 2935802195
585 2935811019
586 2935828600
587 2935839976
588 2935856038
589 2935866018
590 2935877657
591 2935883680
592 2935992601
593 2936002473
594 2936014942
595 2936022077
596 2936032765
597 2936037562
598 2936050683
599 2936059541
600 2941536777
601 2941540684
602 3005507389
603 8016521072
604 8016639486
605 8017064534
606 8019583911
607 8019591714
608 8019599622
609 8019618924
610 8019649043
611 8055435269
612 8056968735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

10

204

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9721 3 198
3b5e-assembly1.cif.gz_A crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution 0.9456 1 197
3og9-assembly2.cif.gz_B structure of yahd with malic acid 0.9323 4 198
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9303 3 198
2r8b-assembly2.cif.gz_B the crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58 0.9173 4 198
ID Description Score Start End Superfamily
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9577 5 198 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9389 6 197 3.40.50.1820
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9386 5 198 3.40.50.1820
3og9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9322 4 198 3.40.50.1820
3b5eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9306 1 197 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5D3KR89-F1-model_v4 Alpha/beta hydrolase 1.001 1 204 GO:0016787
AF-A0A7T7XUR2-F1-model_v4 deleted 1.001 1 204
AF-M4ZG06-F1-model_v4 Putative phospholipase/carboxylesterase family protein 0.9992 20 197 GO:0016787
AF-A0A2T7TQF8-F1-model_v4 Hydrolase 0.9989 59 198 GO:0016787
AF-A0A1B3NFV6-F1-model_v4 Phospholipase/Carboxylesterase family protein 0.9965 1 198

Map