F398570

General Info

Members Datasets Scaffolds Average Seq Length
306 203 612 250

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100091437|Ga0068854_1000914374
Length 293
Sequence MTSETTIAYGSRVSRHGSSRPCSPYHSSSASLTRRTLDCVPAVCFELDSSPPIPAISGAAVSHDELVLEARDGNRFAAFLATPDESSDTGVVILPDVRGLYRFYEELALRFAERGYQALAFDYFGRTAGVEKRGEDFEYREHVEAVTPEQIQADVASAVEHLRSLGAKSVFTVGFCMGGRQSWLAAAGGHGLAGAVGFYGRPGEAADGSPGPQQLASRIDAPVLALQAGADEHITADHNEAFEQALSDAGVEHELVVYEGAPHSFFDRKQEEFAGASDDAWNRTLEFIERHSQ

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
128 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
129 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
130 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
131 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 16.34
Rhizosphere 83.01
Stem 0
Stem Tuber 0
Unclassified 15.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100091437 3300005578 Bacteria 2265
2 Ga0070690_100271706 3300005330 Unclassified 1206
3 Ga0070680_100021495 3300005336 Bacteria 5129
4 Ga0070680_100024690 3300005336 Bacteria 4804
5 Ga0070680_100073021 3300005336 Bacteria 2821
6 Ga0070682_100049009 3300005337 Bacteria 2632
7 Ga0070682_100063364 3300005337 Bacteria 2344
8 Ga0070682_100072688 3300005337 Bacteria 2204
9 Ga0068868_100069181 3300005338 Unclassified 2813
10 Ga0070660_100116467 3300005339 Bacteria 2131
11 Ga0070692_10046531 3300005345 Bacteria 2243
12 Ga0070668_100441926 3300005347 Unclassified 1117
13 Ga0070669_100373257 3300005353 Unclassified 1162
14 Ga0070671_100655480 3300005355 Unclassified 909
15 Ga0070674_100015109 3300005356 Bacteria 4813
16 Ga0070659_100041071 3300005366 Unclassified 3615
17 Ga0070667_100054626 3300005367 Bacteria 3373
18 Ga0070703_10009354 3300005406 Unclassified 2765
19 Ga0070709_10113706 3300005434 Bacteria 1823
20 Ga0070709_10133968 3300005434 Bacteria 1695
21 Ga0070714_100011939 3300005435 Bacteria 6910
22 Ga0070710_10029563 3300005437 Bacteria 2941
23 Ga0070701_10007517 3300005438 Bacteria 4661
24 Ga0070705_100006982 3300005440 Bacteria 5553
25 Ga0070700_100035066 3300005441 Bacteria 3033
26 Ga0070708_100087048 3300005445 Unclassified 2838
27 Ga0070708_100616881 3300005445 Bacteria 1022
28 Ga0070678_100019703 3300005456 Bacteria 4407
29 Ga0070678_100471878 3300005456 Bacteria 1103
30 Ga0070662_100051115 3300005457 Bacteria 2983
31 Ga0070681_10033513 3300005458 Bacteria 5156
32 Ga0070681_10046318 3300005458 Bacteria 4348
33 Ga0070681_10197437 3300005458 Bacteria 1931
34 Ga0068867_100023898 3300005459 Bacteria 4377
35 Ga0068867_100218970 3300005459 Bacteria 1533
36 Ga0070698_100034715 3300005471 Bacteria 5219
37 Ga0070698_100051055 3300005471 Bacteria 4213
38 Ga0070699_100164829 3300005518 Bacteria 1962
39 Ga0070699_100300496 3300005518 Unclassified 1440
40 Ga0070679_100004051 3300005530 Bacteria 13496
41 Ga0070679_100004917 3300005530 Bacteria 12329
42 Ga0070679_100030028 3300005530 Bacteria 5364
43 Ga0070679_100049093 3300005530 Bacteria 4204
44 Ga0070684_100000243 3300005535 Bacteria 37686
45 Ga0070697_100081302 3300005536 Bacteria 2670
46 Ga0068853_100026171 3300005539 Bacteria 4898
47 Ga0070686_100144802 3300005544 Bacteria 1658
48 Ga0070686_100165163 3300005544 Bacteria 1561
49 Ga0070696_100069875 3300005546 Bacteria 2469
50 Ga0070693_100008201 3300005547 Bacteria 5134
51 Ga0070693_100107186 3300005547 Bacteria 1712
52 Ga0070665_100205132 3300005548 Bacteria 1972
53 Ga0070704_100187559 3300005549 Bacteria 1659
54 Ga0068855_100009334 3300005563 Bacteria 11847
55 Ga0068855_100352179 3300005563 Unclassified 1622
56 Ga0068857_100027127 3300005577 Bacteria 5052
57 Ga0068854_100029734 3300005578 Bacteria 3785
58 Ga0068856_100011791 3300005614 Bacteria 8473
59 Ga0068856_100302683 3300005614 Bacteria 1617
60 Ga0070702_100140084 3300005615 Bacteria 1540
61 Ga0068852_100196210 3300005616 Unclassified 1908
62 Ga0068864_100301074 3300005618 Bacteria 1501
63 Ga0068866_10130957 3300005718 Bacteria 1427
64 Ga0068860_100110465 3300005843 Bacteria 2628
65 Ga0068862_100248694 3300005844 Bacteria 1620
66 Ga0081540_1004975 3300005983 Bacteria 9992
67 Ga0081540_1012990 3300005983 Bacteria 5440
68 Ga0070715_10131605 3300006163 Bacteria 1205
69 Ga0070712_100084479 3300006175 Bacteria 2308
70 Ga0075367_10136428 3300006178 Bacteria 1518
71 Ga0097621_100490145 3300006237 Unclassified 1112
72 Ga0075428_100029209 3300006844 Bacteria 6101
73 Ga0075428_100283167 3300006844 Bacteria 1783
74 Ga0075430_100159353 3300006846 Bacteria 1879
75 Ga0075431_100269105 3300006847 Bacteria 1727
76 Ga0075433_10137418 3300006852 Bacteria 2172
77 Ga0075434_100070341 3300006871 Unclassified 3490
78 Ga0075429_100138402 3300006880 Bacteria 2131
79 Ga0105240_10345565 3300009093 Unclassified 1689
80 Ga0111539_10214329 3300009094 Unclassified 2243
81 Ga0111539_10233100 3300009094 Bacteria 2143
82 Ga0105245_10009810 3300009098 Bacteria 8343
83 Ga0105245_10038418 3300009098 Bacteria 4259
84 Ga0114129_10335634 3300009147 Bacteria 2006
85 Ga0114129_10467931 3300009147 Bacteria 1651
86 Ga0105243_10074280 3300009148 Bacteria 2757
87 Ga0105243_10156018 3300009148 Bacteria 1963
88 Ga0105241_10168459 3300009174 Unclassified 1807
89 Ga0105241_10227061 3300009174 Bacteria 1572
90 Ga0105248_10773112 3300009177 Bacteria 1084
91 Ga0105249_10093517 3300009553 Bacteria 2817
92 Ga0105239_10070167 3300010375 Bacteria 3849
93 Ga0105239_10427880 3300010375 Bacteria 1500
94 Ga0105239_10563380 3300010375 Bacteria 1298
95 Ga0157371_10138934 3300013102 Unclassified 1731
96 Ga0157370_10007497 3300013104 Bacteria 11853
97 Ga0157378_10680337 3300013297 Unclassified 1047
98 Ga0163162_10063880 3300013306 Bacteria 3725
99 Ga0163162_11136131 3300013306 Bacteria 886
100 Ga0157372_10602463 3300013307 Unclassified 1280
101 Ga0157375_10025778 3300013308 Bacteria 5470
102 Ga0157375_10082438 3300013308 Bacteria 3258
103 Ga0157375_10271882 3300013308 Bacteria 1857
104 Ga0157380_10015341 3300014326 Bacteria 5630
105 Ga0207642_10044652 3300025899 Bacteria 1963
106 Ga0207688_10100660 3300025901 Bacteria 1668
107 Ga0207647_10232445 3300025904 Bacteria 1060
108 Ga0207685_10070593 3300025905 Bacteria 1414
109 Ga0207643_10112513 3300025908 Bacteria 1605
110 Ga0207643_10191402 3300025908 Unclassified 1242
111 Ga0207654_10164220 3300025911 Bacteria 1437
112 Ga0207707_10132127 3300025912 Bacteria 2183
113 Ga0207693_10009199 3300025915 Bacteria 8065
114 Ga0207660_10012583 3300025917 Bacteria 5541
115 Ga0207660_10024169 3300025917 Bacteria 4110
116 Ga0207660_10157128 3300025917 Bacteria 1751
117 Ga0207657_10167266 3300025919 Bacteria 1783
118 Ga0207652_10000845 3300025921 Bacteria 29187
119 Ga0207652_10012028 3300025921 Bacteria 6986
120 Ga0207652_10244079 3300025921 Bacteria 1619
121 Ga0207646_10154216 3300025922 Bacteria 2072
122 Ga0207687_10005539 3300025927 Bacteria 8348
123 Ga0207700_10114538 3300025928 Bacteria 2176
124 Ga0207664_10088645 3300025929 Bacteria 2532
125 Ga0207664_10101234 3300025929 Bacteria 2380
126 Ga0207644_10256824 3300025931 Unclassified 1396
127 Ga0207690_10145024 3300025932 Unclassified 1754
128 Ga0207706_10025794 3300025933 Bacteria 5265
129 Ga0207686_10346427 3300025934 Unclassified 1117
130 Ga0207709_10404374 3300025935 Unclassified 1045
131 Ga0207669_10028106 3300025937 Bacteria 3090
132 Ga0207704_10080363 3300025938 Unclassified 2104
133 Ga0207704_10326642 3300025938 Bacteria 1185
134 Ga0207691_10528502 3300025940 Unclassified 1001
135 Ga0207661_10017673 3300025944 Bacteria 5284
136 Ga0207661_10090423 3300025944 Bacteria 2549
137 Ga0207661_10113686 3300025944 Bacteria 2294
138 Ga0207661_10226442 3300025944 Bacteria 1654
139 Ga0207679_10465662 3300025945 Bacteria 1123
140 Ga0207667_10051793 3300025949 Bacteria 4326
141 Ga0207667_10121919 3300025949 Unclassified 2686
142 Ga0207640_10046860 3300025981 Bacteria 2785
143 Ga0207640_10257057 3300025981 Bacteria 1359
144 Ga0207658_10040098 3300025986 Bacteria 3383
145 Ga0207677_10046999 3300026023 Bacteria 2895
146 Ga0207708_10002361 3300026075 Bacteria 13866
147 Ga0207702_10000955 3300026078 Bacteria 29742
148 Ga0207702_10004111 3300026078 Bacteria 13059
149 Ga0207648_10003964 3300026089 Bacteria 15378
150 Ga0207676_10242599 3300026095 Bacteria 1617
151 Ga0207674_10084104 3300026116 Bacteria 3180
152 Ga0207683_10021748 3300026121 Bacteria 5498
153 Ga0207683_10037352 3300026121 Bacteria 4229
154 Ga0207683_10109187 3300026121 Unclassified 2476
155 Ga0207428_10144448 3300027907 Bacteria 1814
156 Ga0268266_10119728 3300028379 Bacteria 2342
157 Ga0265318_10017343 3300028577 Bacteria 2958
158 Ga0307409_100110429 3300031995 Bacteria 2305
159 Ga0307416_100455956 3300032002 Bacteria 1332
160 Ga0307415_100343603 3300032126 Bacteria 1253
161 Ga0373959_0042795 3300034820 Bacteria 956
162 Ga0373941_0068729 3300035115 Bacteria 1171
163 Ga0373943_0006122 3300035170 Bacteria 5406
164 Ga0373946_0233597 3300035171 Bacteria 892
165 Ga0373962_0088683 3300035242 Bacteria 950
166 Ga0373947_0025143 3300035725 Bacteria 3472
167 Ga0373925_0005863 3300037068 Bacteria 9108
168 Ga0395899_0052792 3300037312 Bacteria 3012
169 Ga0395899_0097315 3300037312 Bacteria 2127
170 Ga0395900_0007825 3300037418 Bacteria 11017
171 Ga0395900_0022176 3300037418 Bacteria 6495
172 Ga0395900_0071890 3300037418 Bacteria 3557
173 Ga0395900_0167945 3300037418 Bacteria 2235
174 Ga0395898_0173096 3300037466 Bacteria 2063
175 Ga0395898_0192431 3300037466 Bacteria 1949
176 Ga0395898_0206696 3300037466 Unclassified 1873
177 Ga0395905_0111133 3300037471 Bacteria 2573
178 Ga0395905_0322173 3300037471 Unclassified 1435
179 Ga0395901_0012376 3300038443 Bacteria 8654
180 Ga0395901_0064433 3300038443 Bacteria 3815
181 Ga0395901_0579664 3300038443 Bacteria 1133
182 Ga0436360_0925433 3300039438 Bacteria 1059
183 Ga0439453_0019954 3300041408 Bacteria 1198
184 Ga0439461_0003026 3300041410 Bacteria 2739
185 Ga0439448_0008258 3300042005 Bacteria 3043
186 Ga0450920_013140 3300042122 Bacteria 1558
187 Ga0439446_0004441 3300042156 Bacteria 3558
188 Ga0439458_0003909 3300042157 Bacteria 3444
189 Ga0466964_0078675 3300044706 Bacteria 1410
190 Ga0466964_0201189 3300044706 Bacteria 956
191 Ga0451576_0019332 3300045051 Bacteria 7433
192 Ga0466967_0032772 3300045976 Bacteria 4391
193 Ga0466967_0050404 3300045976 Bacteria 3645
194 Ga0466967_0722250 3300045976 Bacteria 987
195 Ga0495592_0155728 3300046454 Bacteria 1576
196 Ga0495603_0000065 3300046455 Bacteria 46432
197 Ga0495641_0007359 3300046461 Bacteria 6886
198 Ga0495653_0100494 3300046463 Bacteria 2097
199 Ga0495639_0134850 3300046475 Bacteria 1184
200 Ga0495664_0145747 3300046477 Unclassified 1436
201 Ga0495585_0067617 3300046492 Unclassified 1954
202 Ga0495594_0008893 3300046499 Bacteria 5179
203 Ga0495608_0136142 3300046511 Bacteria 1570
204 Ga0495630_0121440 3300046517 Bacteria 1982
205 Ga0495652_0094477 3300046529 Unclassified 2439
206 Ga0495652_0219004 3300046529 Bacteria 1432
207 Ga0495645_0056907 3300046543 Unclassified 2839
208 Ga0495656_0035325 3300046615 Unclassified 2053
209 Ga0495635_0229841 3300046663 Bacteria 1253
210 Ga0495588_0000827 3300046674 Bacteria 13760
211 Ga0495646_0163432 3300046680 Unclassified 1231
212 Ga0495581_0174667 3300047315 Bacteria 1256
213 Ga0495674_0168197 3300047319 Bacteria 1831
214 Ga0495676_0008128 3300047321 Bacteria 9624
215 Ga0495676_0082968 3300047321 Bacteria 2424
216 Ga0495684_0327079 3300047471 Bacteria 1094
217 Ga0496100_0025426 3300048903 Bacteria 3622
218 Ga0496101_0125000 3300048904 Bacteria 1948
219 Ga0496101_0192089 3300048904 Unclassified 1576
220 Ga0496101_0240880 3300048904 Bacteria 1408
221 Ga0496101_0348872 3300048904 Unclassified 1163
222 Ga0496101_0356854 3300048904 Unclassified 1149
223 Ga0496102_0011412 3300048905 Bacteria 7658
224 Ga0496102_0045346 3300048905 Bacteria 3992
225 Ga0496102_0151658 3300048905 Bacteria 2178
226 Ga0496102_0594506 3300048905 Bacteria 1029
227 Ga0496103_0002423 3300048906 Bacteria 11733
228 Ga0496103_0105379 3300048906 Bacteria 1788
229 Ga0496103_0374145 3300048906 Bacteria 915
230 Ga0496104_0003705 3300048907 Bacteria 13190
231 Ga0496104_0005528 3300048907 Bacteria 11070
232 Ga0496104_0014088 3300048907 Bacteria 7217
233 Ga0496104_0379220 3300048907 Bacteria 1327
234 Ga0496105_0001160 3300048908 Bacteria 18350
235 Ga0496105_0018536 3300048908 Bacteria 5599
236 Ga0496105_0051963 3300048908 Bacteria 3384
237 Ga0496105_0260020 3300048908 Bacteria 1404
238 Ga0496106_0006999 3300048909 Bacteria 8330
239 Ga0496106_0165893 3300048909 Unclassified 1748
240 Ga0496107_0039621 3300048910 Bacteria 3380
241 Ga0496107_0166848 3300048910 Unclassified 1633
242 Ga0496107_0298109 3300048910 Unclassified 1200
243 Ga0496107_0347146 3300048910 Bacteria 1104
244 Ga0496108_0001991 3300048911 Bacteria 16351
245 Ga0496108_0035809 3300048911 Bacteria 4127
246 Ga0496109_0045809 3300048912 Bacteria 3970
247 Ga0496109_0071449 3300048912 Bacteria 3186
248 Ga0496109_0270436 3300048912 Bacteria 1601
249 Ga0496110_0002084 3300048913 Bacteria 14913
250 Ga0496110_0008634 3300048913 Bacteria 8207
251 Ga0496110_0009658 3300048913 Bacteria 7812
252 Ga0496110_0455447 3300048913 Bacteria 1166
253 Ga0496111_0000319 3300048914 Bacteria 23843
254 Ga0496111_0029455 3300048914 Bacteria 3899
255 Ga0496111_0052888 3300048914 Bacteria 2933
256 Ga0496112_0006115 3300048915 Bacteria 10522
257 Ga0496112_0093941 3300048915 Bacteria 2969
258 Ga0496113_0009340 3300048916 Bacteria 6430
259 Ga0496113_0023529 3300048916 Bacteria 4368
260 Ga0496113_0635803 3300048916 Unclassified 854
261 Ga0496114_0001179 3300048917 Bacteria 19806
262 Ga0496114_0032147 3300048917 Bacteria 4318
263 Ga0496114_0178842 3300048917 Bacteria 1852
264 Ga0496115_0008849 3300048918 Bacteria 7463
265 Ga0496115_0016444 3300048918 Bacteria 5634
266 Ga0496115_0028645 3300048918 Bacteria 4367
267 Ga0501032_0049215 3300049569 Bacteria 2844
268 Ga0501033_0239916 3300049570 Bacteria 1286
269 Ga0501036_0055990 3300049572 Bacteria 3340
270 Ga0501037_0097189 3300049573 Bacteria 2128
271 Ga0501039_0015140 3300049575 Bacteria 5901
272 Ga0501040_0525975 3300049576 Bacteria 853
273 Ga0501041_0056379 3300049577 Bacteria 2401
274 Ga0501041_0156161 3300049577 Unclassified 1425
275 Ga0501042_0001046 3300049578 Bacteria 15775
276 Ga0501046_0017025 3300049580 Bacteria 6077
277 Ga0501048_0045225 3300049582 Bacteria 3145
278 Ga0501048_0177002 3300049582 Bacteria 1512
279 Ga0501067_0001871 3300049583 Bacteria 11558
280 Ga0501069_0014686 3300049585 Bacteria 4189
281 Ga0501069_0105186 3300049585 Bacteria 1604
282 Ga0501071_0250970 3300049587 Bacteria 1335
283 Ga0501074_0031503 3300049590 Bacteria 3841
284 Ga0501075_0007212 3300049591 Bacteria 7702
285 Ga0501076_0023653 3300049592 Bacteria 4738
286 Ga0501077_0004630 3300049593 Bacteria 8354
287 Ga0501079_0007062 3300049741 Bacteria 8473
288 Ga0501080_0217048 3300049742 Bacteria 1751
289 Ga0501081_0005125 3300049743 Bacteria 8432
290 Ga0501083_0110486 3300049744 Bacteria 1808
291 Ga0501045_0004920 3300049824 Bacteria 9251
292 nmdc:mga06z11_160629_c1 3300050494 Bacteria 1284
293 nmdc:mga09592_129860_c1 3300050508 Bacteria 2167
294 nmdc:mga09592_196453_c1 3300050508 Bacteria 1746
295 nmdc:mga08y16_172480_c1 3300050511 Bacteria 2247
296 nmdc:mga08y16_244704_c1 3300050511 Bacteria 1854
297 nmdc:mga08y16_471668_c1 3300050511 Bacteria 1278
298 nmdc:mga0n895_153808_c1 3300050512 Bacteria 2331
299 nmdc:mga0n895_567681_c1 3300050512 Bacteria 1139
300 nmdc:mga0rr50_96817_c1 3300050513 Unclassified 2309
301 nmdc:mga0a205_82424_c1 3300050515 Bacteria 3107
302 Ga0495601_0223670 3300053077 Unclassified 1229
303 Ga0501084_0013106 3300054114 Bacteria 6861
304 Ga0501082_0045848 3300060353 Bacteria 3769
305 Ga0530510_0036427 3300061734 Bacteria 3546
306 Ga0530510_0387795 3300061734 Unclassified 1052
307 Ga0068854_100091437
308 Ga0070690_100271706
309 Ga0070680_100021495
310 Ga0070680_100024690
311 Ga0070680_100073021
312 Ga0070682_100049009
313 Ga0070682_100063364
314 Ga0070682_100072688
315 Ga0068868_100069181
316 Ga0070660_100116467
317 Ga0070692_10046531
318 Ga0070668_100441926
319 Ga0070669_100373257
320 Ga0070671_100655480
321 Ga0070674_100015109
322 Ga0070659_100041071
323 Ga0070667_100054626
324 Ga0070703_10009354
325 Ga0070709_10113706
326 Ga0070709_10133968
327 Ga0070714_100011939
328 Ga0070710_10029563
329 Ga0070701_10007517
330 Ga0070705_100006982
331 Ga0070700_100035066
332 Ga0070708_100087048
333 Ga0070708_100616881
334 Ga0070678_100019703
335 Ga0070678_100471878
336 Ga0070662_100051115
337 Ga0070681_10033513
338 Ga0070681_10046318
339 Ga0070681_10197437
340 Ga0068867_100023898
341 Ga0068867_100218970
342 Ga0070698_100034715
343 Ga0070698_100051055
344 Ga0070699_100164829
345 Ga0070699_100300496
346 Ga0070679_100004051
347 Ga0070679_100004917
348 Ga0070679_100030028
349 Ga0070679_100049093
350 Ga0070684_100000243
351 Ga0070697_100081302
352 Ga0068853_100026171
353 Ga0070686_100144802
354 Ga0070686_100165163
355 Ga0070696_100069875
356 Ga0070693_100008201
357 Ga0070693_100107186
358 Ga0070665_100205132
359 Ga0070704_100187559
360 Ga0068855_100009334
361 Ga0068855_100352179
362 Ga0068857_100027127
363 Ga0068854_100029734
364 Ga0068856_100011791
365 Ga0068856_100302683
366 Ga0070702_100140084
367 Ga0068852_100196210
368 Ga0068864_100301074
369 Ga0068866_10130957
370 Ga0068860_100110465
371 Ga0068862_100248694
372 Ga0081540_1004975
373 Ga0081540_1012990
374 Ga0070715_10131605
375 Ga0070712_100084479
376 Ga0075367_10136428
377 Ga0097621_100490145
378 Ga0075428_100029209
379 Ga0075428_100283167
380 Ga0075430_100159353
381 Ga0075431_100269105
382 Ga0075433_10137418
383 Ga0075434_100070341
384 Ga0075429_100138402
385 Ga0105240_10345565
386 Ga0111539_10214329
387 Ga0111539_10233100
388 Ga0105245_10009810
389 Ga0105245_10038418
390 Ga0114129_10335634
391 Ga0114129_10467931
392 Ga0105243_10074280
393 Ga0105243_10156018
394 Ga0105241_10168459
395 Ga0105241_10227061
396 Ga0105248_10773112
397 Ga0105249_10093517
398 Ga0105239_10070167
399 Ga0105239_10427880
400 Ga0105239_10563380
401 Ga0157371_10138934
402 Ga0157370_10007497
403 Ga0157378_10680337
404 Ga0163162_10063880
405 Ga0163162_11136131
406 Ga0157372_10602463
407 Ga0157375_10025778
408 Ga0157375_10082438
409 Ga0157375_10271882
410 Ga0157380_10015341
411 Ga0207642_10044652
412 Ga0207688_10100660
413 Ga0207647_10232445
414 Ga0207685_10070593
415 Ga0207643_10112513
416 Ga0207643_10191402
417 Ga0207654_10164220
418 Ga0207707_10132127
419 Ga0207693_10009199
420 Ga0207660_10012583
421 Ga0207660_10024169
422 Ga0207660_10157128
423 Ga0207657_10167266
424 Ga0207652_10000845
425 Ga0207652_10012028
426 Ga0207652_10244079
427 Ga0207646_10154216
428 Ga0207687_10005539
429 Ga0207700_10114538
430 Ga0207664_10088645
431 Ga0207664_10101234
432 Ga0207644_10256824
433 Ga0207690_10145024
434 Ga0207706_10025794
435 Ga0207686_10346427
436 Ga0207709_10404374
437 Ga0207669_10028106
438 Ga0207704_10080363
439 Ga0207704_10326642
440 Ga0207691_10528502
441 Ga0207661_10017673
442 Ga0207661_10090423
443 Ga0207661_10113686
444 Ga0207661_10226442
445 Ga0207679_10465662
446 Ga0207667_10051793
447 Ga0207667_10121919
448 Ga0207640_10046860
449 Ga0207640_10257057
450 Ga0207658_10040098
451 Ga0207677_10046999
452 Ga0207708_10002361
453 Ga0207702_10000955
454 Ga0207702_10004111
455 Ga0207648_10003964
456 Ga0207676_10242599
457 Ga0207674_10084104
458 Ga0207683_10021748
459 Ga0207683_10037352
460 Ga0207683_10109187
461 Ga0207428_10144448
462 Ga0268266_10119728
463 Ga0265318_10017343
464 Ga0307409_100110429
465 Ga0307416_100455956
466 Ga0307415_100343603
467 Ga0373959_0042795
468 Ga0373941_0068729
469 Ga0373943_0006122
470 Ga0373946_0233597
471 Ga0373962_0088683
472 Ga0373947_0025143
473 Ga0373925_0005863
474 Ga0395899_0052792
475 Ga0395899_0097315
476 Ga0395900_0007825
477 Ga0395900_0022176
478 Ga0395900_0071890
479 Ga0395900_0167945
480 Ga0395898_0173096
481 Ga0395898_0192431
482 Ga0395898_0206696
483 Ga0395905_0111133
484 Ga0395905_0322173
485 Ga0395901_0012376
486 Ga0395901_0064433
487 Ga0395901_0579664
488 Ga0436360_0925433
489 Ga0439453_0019954
490 Ga0439461_0003026
491 Ga0439448_0008258
492 Ga0450920_013140
493 Ga0439446_0004441
494 Ga0439458_0003909
495 Ga0466964_0078675
496 Ga0466964_0201189
497 Ga0451576_0019332
498 Ga0466967_0032772
499 Ga0466967_0050404
500 Ga0466967_0722250
501 Ga0495592_0155728
502 Ga0495603_0000065
503 Ga0495641_0007359
504 Ga0495653_0100494
505 Ga0495639_0134850
506 Ga0495664_0145747
507 Ga0495585_0067617
508 Ga0495594_0008893
509 Ga0495608_0136142
510 Ga0495630_0121440
511 Ga0495652_0094477
512 Ga0495652_0219004
513 Ga0495645_0056907
514 Ga0495656_0035325
515 Ga0495635_0229841
516 Ga0495588_0000827
517 Ga0495646_0163432
518 Ga0495581_0174667
519 Ga0495674_0168197
520 Ga0495676_0008128
521 Ga0495676_0082968
522 Ga0495684_0327079
523 Ga0496100_0025426
524 Ga0496101_0125000
525 Ga0496101_0192089
526 Ga0496101_0240880
527 Ga0496101_0348872
528 Ga0496101_0356854
529 Ga0496102_0011412
530 Ga0496102_0045346
531 Ga0496102_0151658
532 Ga0496102_0594506
533 Ga0496103_0002423
534 Ga0496103_0105379
535 Ga0496103_0374145
536 Ga0496104_0003705
537 Ga0496104_0005528
538 Ga0496104_0014088
539 Ga0496104_0379220
540 Ga0496105_0001160
541 Ga0496105_0018536
542 Ga0496105_0051963
543 Ga0496105_0260020
544 Ga0496106_0006999
545 Ga0496106_0165893
546 Ga0496107_0039621
547 Ga0496107_0166848
548 Ga0496107_0298109
549 Ga0496107_0347146
550 Ga0496108_0001991
551 Ga0496108_0035809
552 Ga0496109_0045809
553 Ga0496109_0071449
554 Ga0496109_0270436
555 Ga0496110_0002084
556 Ga0496110_0008634
557 Ga0496110_0009658
558 Ga0496110_0455447
559 Ga0496111_0000319
560 Ga0496111_0029455
561 Ga0496111_0052888
562 Ga0496112_0006115
563 Ga0496112_0093941
564 Ga0496113_0009340
565 Ga0496113_0023529
566 Ga0496113_0635803
567 Ga0496114_0001179
568 Ga0496114_0032147
569 Ga0496114_0178842
570 Ga0496115_0008849
571 Ga0496115_0016444
572 Ga0496115_0028645
573 Ga0501032_0049215
574 Ga0501033_0239916
575 Ga0501036_0055990
576 Ga0501037_0097189
577 Ga0501039_0015140
578 Ga0501040_0525975
579 Ga0501041_0056379
580 Ga0501041_0156161
581 Ga0501042_0001046
582 Ga0501046_0017025
583 Ga0501048_0045225
584 Ga0501048_0177002
585 Ga0501067_0001871
586 Ga0501069_0014686
587 Ga0501069_0105186
588 Ga0501071_0250970
589 Ga0501074_0031503
590 Ga0501075_0007212
591 Ga0501076_0023653
592 Ga0501077_0004630
593 Ga0501079_0007062
594 Ga0501080_0217048
595 Ga0501081_0005125
596 Ga0501083_0110486
597 Ga0501045_0004920
598 nmdc:mga06z11_160629_c1
599 nmdc:mga09592_129860_c1
600 nmdc:mga09592_196453_c1
601 nmdc:mga08y16_172480_c1
602 nmdc:mga08y16_244704_c1
603 nmdc:mga08y16_471668_c1
604 nmdc:mga0n895_153808_c1
605 nmdc:mga0n895_567681_c1
606 nmdc:mga0rr50_96817_c1
607 nmdc:mga0a205_82424_c1
608 Ga0495601_0223670
609 Ga0501084_0013106
610 Ga0501082_0045848
611 Ga0530510_0036427
612 Ga0530510_0387795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

76

292

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8622 18 246
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.8594 19 249
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8454 24 246
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.8342 18 251
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.8338 12 249
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8721 19 249 3.40.50.1820
af_B4FY74_55_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.855 36 249 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8523 20 247 3.40.50.1820
3f67A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8482 18 246 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8394 22 246 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A538DXJ4-F1-model_v4 Dienelactone hydrolase family protein 0.9833 1 217 GO:0016787
AF-A0A538GDI7-F1-model_v4 Dienelactone hydrolase family protein 0.9816 78 249 GO:0016787
AF-A0A7W1N809-F1-model_v4 Dienelactone hydrolase family protein 0.9782 42 249 GO:0016787
AF-A0A2W4MFV4-F1-model_v4 Dienelactone hydrolase family protein 0.9736 115 249 GO:0016787
AF-A0A536SA63-F1-model_v4 Dienelactone hydrolase family protein 0.9711 26 249 GO:0016787

Map