F398439

General Info

Members Datasets Scaffolds Average Seq Length
306 226 612 136

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10008607|JGI25406J46586_100086074
Length 138
Sequence MKPVSIDAAFAALVLAACIAMSGSARALDLNGAWASDADNCAKVFVRKGTQVTFTDMSDVYGGGFIIEGEQITGKFARCRIKAKKDDGNTINLVAACATDIMLQNVQFSLKEVDANSVIRMFPGMEGMEIKYARCPAP

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
153 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
200 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
205 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
206 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
207 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
208 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
209 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
210 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
211 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
214 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
215 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
218 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
219 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
220 2791355199
221 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
222 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
223 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
224 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
225 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
226 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.59
Nodule 1.31
Rhizoplane 6.21
Rhizosphere 61.44
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10008607 3300003203 Bacteria 4610
2 JGI24735J21928_10144980 3300002067 Bacteria 685
3 rootL2_10123070 3300003322 Bacteria 3573
4 rootL2_10145659 3300003322 Bacteria 1851
5 rootL2_10166881 3300003322 Bacteria 1449
6 JGI25160J50197_1000600 3300003354 Bacteria 20162
7 JGI25404J52841_10003926 3300003659 Bacteria 2979
8 JGI25404J52841_10007543 3300003659 Bacteria 2303
9 JGI25404J52841_10014551 3300003659 Bacteria 1708
10 JGI25404J52841_10023020 3300003659 Bacteria 1345
11 Ga0070670_100169893 3300005331 Bacteria 1891
12 Ga0070677_10092276 3300005333 Bacteria 1319
13 Ga0068869_100001614 3300005334 Bacteria 13405
14 Ga0070666_10097937 3300005335 Bacteria 2019
15 Ga0070682_100281760 3300005337 Bacteria 1212
16 Ga0068868_100021555 3300005338 Bacteria 4853
17 Ga0068868_101782640 3300005338 Bacteria 581
18 Ga0070668_100007614 3300005347 Bacteria 8038
19 Ga0070669_100683926 3300005353 Bacteria 865
20 Ga0070674_101130835 3300005356 Bacteria 693
21 Ga0070673_100187304 3300005364 Bacteria 1775
22 Ga0070688_100568069 3300005365 Bacteria 864
23 Ga0070659_100063061 3300005366 Bacteria 2932
24 Ga0070667_100101407 3300005367 Bacteria 2487
25 Ga0070701_10602915 3300005438 Bacteria 727
26 Ga0070694_100566650 3300005444 Bacteria 911
27 Ga0070678_100113523 3300005456 Bacteria 2124
28 Ga0070678_100506578 3300005456 Bacteria 1066
29 Ga0070662_100014673 3300005457 Bacteria 5236
30 Ga0068867_100123952 3300005459 Bacteria 2000
31 Ga0070685_10087273 3300005466 Bacteria 1882
32 Ga0070698_100058340 3300005471 Bacteria 3902
33 Ga0068853_100317845 3300005539 Bacteria 1443
34 Ga0070695_101209524 3300005545 Bacteria 622
35 Ga0070693_100051760 3300005547 Bacteria 2352
36 Ga0070665_100032699 3300005548 Bacteria 5234
37 Ga0068855_100029867 3300005563 Bacteria 6519
38 Ga0070664_100477792 3300005564 Bacteria 1147
39 Ga0068857_100066343 3300005577 Bacteria 3211
40 Ga0068854_100056589 3300005578 Bacteria 2827
41 Ga0068856_100044494 3300005614 Bacteria 4370
42 Ga0070702_100062649 3300005615 Bacteria 2169
43 Ga0070702_100268679 3300005615 Bacteria 1165
44 Ga0068852_100269394 3300005616 Bacteria 1638
45 Ga0068859_100045856 3300005617 Bacteria 4390
46 Ga0068859_100052245 3300005617 Bacteria 4109
47 Ga0068864_100003289 3300005618 Bacteria 13354
48 Ga0068864_100884620 3300005618 Bacteria 881
49 Ga0068866_10114097 3300005718 Bacteria 1512
50 Ga0068861_100008579 3300005719 Bacteria 7031
51 Ga0068861_100840265 3300005719 Bacteria 865
52 Ga0068851_10291912 3300005834 Bacteria 935
53 Ga0068870_10036501 3300005840 Bacteria 2529
54 Ga0068863_100051991 3300005841 Bacteria 3883
55 Ga0068858_100012996 3300005842 Bacteria 7851
56 Ga0068860_100037537 3300005843 Bacteria 4638
57 Ga0081455_10005268 3300005937 Bacteria 14203
58 Ga0081455_10014047 3300005937 Bacteria 7870
59 Ga0081455_10027365 3300005937 Bacteria 5225
60 Ga0081455_10034346 3300005937 Bacteria 4545
61 Ga0081455_10066410 3300005937 Bacteria 3012
62 Ga0081455_10108798 3300005937 Bacteria 2207
63 Ga0081455_10885771 3300005937 Bacteria 556
64 Ga0081540_1000729 3300005983 Bacteria 30326
65 Ga0081540_1001334 3300005983 Bacteria 21502
66 Ga0081540_1004786 3300005983 Bacteria 10207
67 Ga0081540_1005094 3300005983 Bacteria 9859
68 Ga0081540_1006618 3300005983 Bacteria 8405
69 Ga0081540_1007177 3300005983 Bacteria 7994
70 Ga0081540_1027942 3300005983 Bacteria 3182
71 Ga0081540_1034079 3300005983 Bacteria 2753
72 Ga0081540_1134738 3300005983 Bacteria 1002
73 Ga0081539_10000617 3300005985 Bacteria 72003
74 Ga0081539_10016765 3300005985 Bacteria 5200
75 Ga0075365_10017390 3300006038 Bacteria 4399
76 Ga0075365_10021021 3300006038 Bacteria 4062
77 Ga0075365_10408775 3300006038 Bacteria 958
78 Ga0075368_10002154 3300006042 Bacteria 6364
79 Ga0075363_100006206 3300006048 Bacteria 5405
80 Ga0075363_100600767 3300006048 Bacteria 659
81 Ga0075364_10059293 3300006051 Bacteria 2509
82 Ga0075364_10112640 3300006051 Bacteria 1816
83 Ga0075362_10025073 3300006177 Bacteria 2535
84 Ga0075362_10205661 3300006177 Bacteria 959
85 Ga0075367_10014570 3300006178 Bacteria 4257
86 Ga0075369_10004220 3300006186 Bacteria 5293
87 Ga0075369_10022362 3300006186 Bacteria 2607
88 Ga0075366_10016947 3300006195 Bacteria 4188
89 Ga0097621_100082265 3300006237 Bacteria 2681
90 Ga0097621_100131506 3300006237 Bacteria 2131
91 Ga0075370_10050022 3300006353 Bacteria 2370
92 Ga0075370_10139027 3300006353 Bacteria 1419
93 Ga0068871_100053880 3300006358 Bacteria 3262
94 Ga0068871_100287189 3300006358 Bacteria 1441
95 Ga0068871_100350326 3300006358 Bacteria 1306
96 Ga0075433_10365659 3300006852 Bacteria 1274
97 Ga0075434_100091849 3300006871 Bacteria 3037
98 Ga0075436_100136439 3300006914 Bacteria 1723
99 Ga0097620_100045857 3300006931 Bacteria 4390
100 Ga0097620_100052245 3300006931 Bacteria 4109
101 Ga0075435_100036084 3300007076 Bacteria 3927
102 Ga0075435_100349082 3300007076 Bacteria 1268
103 Ga0099794_10141092 3300007265 Bacteria 1220
104 Ga0105240_11655527 3300009093 Bacteria 669
105 Ga0105245_10003228 3300009098 Bacteria 14607
106 Ga0105247_10003634 3300009101 Bacteria 10016
107 Ga0105247_10003960 3300009101 Bacteria 9532
108 Ga0105243_10847082 3300009148 Bacteria 905
109 Ga0105241_10006083 3300009174 Bacteria 8895
110 Ga0105242_10434928 3300009176 Bacteria 1233
111 Ga0105248_10017084 3300009177 Bacteria 7991
112 Ga0105237_10009318 3300009545 Bacteria 10518
113 Ga0105238_10014817 3300009551 Bacteria 7887
114 Ga0105249_10062540 3300009553 Bacteria 3418
115 Ga0105239_10073081 3300010375 Bacteria 3770
116 Ga0105239_10136321 3300010375 Bacteria 2733
117 Ga0105246_10000971 3300011119 Bacteria 16425
118 Ga0157374_10047616 3300013296 Bacteria 3975
119 Ga0157378_10063520 3300013297 Bacteria 3299
120 Ga0163162_10092203 3300013306 Bacteria 3113
121 Ga0163162_12104101 3300013306 Bacteria 647
122 Ga0157375_10089091 3300013308 Bacteria 3141
123 Ga0163163_10038274 3300014325 Bacteria 4673
124 Ga0157380_10195059 3300014326 Bacteria 1792
125 Ga0157377_10027133 3300014745 Bacteria 3072
126 Ga0157379_10167194 3300014968 Bacteria 1985
127 Ga0157376_10022482 3300014969 Bacteria 4918
128 Ga0163161_10101686 3300017792 Bacteria 2140
129 Ga0209758_1036790 3300025297 Bacteria 1903
130 Ga0207426_1000143 3300025302 Bacteria 192948
131 Ga0209257_1057848 3300025304 Bacteria 1064
132 Ga0207642_10272115 3300025899 Bacteria 970
133 Ga0207710_10022083 3300025900 Bacteria 2730
134 Ga0207688_10004554 3300025901 Bacteria 7546
135 Ga0207688_10255886 3300025901 Bacteria 1061
136 Ga0207680_10093446 3300025903 Bacteria 1919
137 Ga0207647_10038188 3300025904 Bacteria 3037
138 Ga0207645_10094309 3300025907 Bacteria 1926
139 Ga0207643_10602010 3300025908 Bacteria 707
140 Ga0207654_10037523 3300025911 Bacteria 2713
141 Ga0207695_11478186 3300025913 Bacteria 560
142 Ga0207681_10668455 3300025923 Bacteria 862
143 Ga0207694_10050430 3300025924 Bacteria 3223
144 Ga0207644_10018553 3300025931 Bacteria 4709
145 Ga0207690_10244610 3300025932 Bacteria 1383
146 Ga0207706_10010375 3300025933 Bacteria 8508
147 Ga0207704_11129513 3300025938 Bacteria 666
148 Ga0207711_10116690 3300025941 Bacteria 2380
149 Ga0207689_10002253 3300025942 Bacteria 18071
150 Ga0207667_10209271 3300025949 Bacteria 1999
151 Ga0207712_10135959 3300025961 Bacteria 1880
152 Ga0207668_10001702 3300025972 Bacteria 12872
153 Ga0207658_10054893 3300025986 Bacteria 2950
154 Ga0207677_10093610 3300026023 Bacteria 2191
155 Ga0207703_10039980 3300026035 Bacteria 3751
156 Ga0207639_10377971 3300026041 Bacteria 1271
157 Ga0207678_10009941 3300026067 Bacteria 8346
158 Ga0207702_10404493 3300026078 Bacteria 1317
159 Ga0207641_10156321 3300026088 Bacteria 2069
160 Ga0207676_10100125 3300026095 Bacteria 2400
161 Ga0207676_10866011 3300026095 Bacteria 884
162 Ga0207674_10068355 3300026116 Bacteria 3575
163 Ga0207675_100006564 3300026118 Bacteria 11010
164 Ga0207683_10007729 3300026121 Bacteria 9206
165 Ga0207683_10233353 3300026121 Bacteria 1678
166 Ga0209588_1020103 3300027671 Bacteria 2090
167 Ga0209813_10005970 3300027866 Bacteria 2989
168 Ga0207428_10666279 3300027907 Bacteria 746
169 Ga0268266_10003097 3300028379 Bacteria 16942
170 Ga0268266_10028485 3300028379 Bacteria 4747
171 Ga0268265_11118763 3300028380 Bacteria 782
172 Ga0268264_10052412 3300028381 Bacteria 3401
173 Ga0268264_11854843 3300028381 Bacteria 613
174 Ga0307511_10063444 3300030521 Bacteria 2790
175 Ga0307511_10189467 3300030521 Bacteria 1090
176 Ga0307509_10007956 3300031507 Bacteria 13673
177 Ga0307509_10043938 3300031507 Bacteria 4829
178 Ga0307509_10052772 3300031507 Bacteria 4339
179 Ga0307509_10226060 3300031507 Bacteria 1679
180 Ga0307408_100114314 3300031548 Bacteria 2079
181 Ga0307508_10016498 3300031616 Bacteria 6724
182 Ga0307516_10000729 3300031730 Bacteria 44867
183 Ga0307412_12072068 3300031911 Bacteria 528
184 Ga0307507_10025988 3300033179 Bacteria 6326
185 Ga0373944_0105654 3300035089 Bacteria 956
186 Ga0373943_0524972 3300035170 Bacteria 693
187 Ga0373935_0013256 3300035692 Bacteria 4972
188 Ga0373927_0014073 3300035695 Bacteria 5304
189 Ga0373947_0100188 3300035725 Bacteria 1820
190 Ga0373925_0375759 3300037068 Bacteria 1157
191 Ga0451851_0091531 3300041507 Bacteria 520
192 Ga0495603_0008967 3300046455 Bacteria 6048
193 Ga0495629_0009697 3300046459 Bacteria 7033
194 Ga0495639_0057914 3300046475 Bacteria 1771
195 Ga0495594_0582809 3300046499 Bacteria 634
196 Ga0495606_0270815 3300046507 Bacteria 933
197 Ga0495632_0131246 3300046519 Bacteria 1166
198 Ga0495654_0101409 3300046530 Bacteria 1325
199 Ga0495622_0028600 3300046557 Bacteria 2603
200 Ga0495633_0248454 3300046558 Bacteria 812
201 Ga0495668_0043640 3300046616 Bacteria 2493
202 Ga0495668_0119179 3300046616 Bacteria 1443
203 Ga0495611_0160348 3300046648 Bacteria 1051
204 Ga0495625_0083705 3300046660 Bacteria 2217
205 Ga0495647_0196243 3300046681 Bacteria 884
206 Ga0495658_0238644 3300046683 Bacteria 1141
207 Ga0495669_0254351 3300046684 Bacteria 844
208 Ga0495669_0265620 3300046684 Unclassified 825
209 Ga0495613_0124698 3300046689 Bacteria 1848
210 Ga0495624_0061195 3300046690 Bacteria 2360
211 Ga0495589_0144395 3300046794 Bacteria 1138
212 Ga0495581_0045231 3300047315 Bacteria 2545
213 Ga0496101_0062153 3300048904 Bacteria 2715
214 Ga0496101_0870340 3300048904 Unclassified 710
215 Ga0496102_0260393 3300048905 Bacteria 1635
216 Ga0496103_0179780 3300048906 Bacteria 1360
217 Ga0496104_0006525 3300048907 Bacteria 10262
218 Ga0496104_0114555 3300048907 Bacteria 2586
219 Ga0496105_0000908 3300048908 Bacteria 20156
220 Ga0496106_0042161 3300048909 Bacteria 3422
221 Ga0496107_0814605 3300048910 Bacteria 683
222 Ga0496108_0060880 3300048911 Bacteria 3176
223 Ga0496108_0832449 3300048911 Bacteria 795
224 Ga0496109_0481673 3300048912 Bacteria 1171
225 Ga0496110_0060849 3300048913 Bacteria 3332
226 Ga0496112_0056497 3300048915 Bacteria 3863
227 Ga0496113_0019915 3300048916 Bacteria 4705
228 Ga0496113_0318571 3300048916 Bacteria 1246
229 Ga0496113_1097781 3300048916 Bacteria 624
230 Ga0496115_0055233 3300048918 Bacteria 3190
231 Ga0496115_0081475 3300048918 Bacteria 2636
232 Ga0496117_0273159 3300048920 Bacteria 909
233 Ga0496118_0125682 3300048921 Bacteria 1661
234 Ga0496118_0226997 3300048921 Bacteria 1081
235 Ga0496119_0008922 3300048922 Bacteria 8713
236 Ga0496119_0049571 3300048922 Bacteria 2595
237 Ga0496120_0036085 3300048923 Bacteria 2946
238 Ga0496121_0047482 3300048924 Bacteria 3663
239 Ga0496121_0053962 3300048924 Bacteria 3363
240 Ga0496121_0115481 3300048924 Bacteria 2038
241 Ga0496125_0009279 3300048928 Bacteria 10149
242 Ga0496126_0041519 3300048929 Bacteria 4256
243 Ga0496126_0247183 3300048929 Bacteria 1488
244 Ga0496126_0966004 3300048929 Bacteria 641
245 Ga0501067_0176102 3300049583 Bacteria 1191
246 Ga0501067_0288744 3300049583 Bacteria 913
247 Ga0501069_0026686 3300049585 Bacteria 3164
248 Ga0501076_1283834 3300049592 Bacteria 602
249 nmdc:mga03683_257155_c1 3300050489 Bacteria 812
250 nmdc:mga03683_54943_c1 3300050489 Bacteria 1671
251 nmdc:mga03683_64508_c1 3300050489 Bacteria 1554
252 nmdc:mga03n38_596709_c1 3300050490 Bacteria 629
253 nmdc:mga00v17_179656_c1 3300050491 Bacteria 1365
254 nmdc:mga00v17_26050_c1 3300050491 Bacteria 3403
255 nmdc:mga00v17_36744_c1 3300050491 Bacteria 2921
256 nmdc:mga0yw44_120009_c1 3300050492 Bacteria 1693
257 nmdc:mga0yw44_155236_c1 3300050492 Bacteria 1495
258 nmdc:mga0yw44_18537_c1 3300050492 Bacteria 3816
259 nmdc:mga06z11_704522_c1 3300050494 Bacteria 615
260 nmdc:mga04h51_90025_c1 3300050495 Bacteria 1103
261 nmdc:mga07m45_13048_c1 3300050496 Bacteria 4398
262 nmdc:mga07m45_73399_c1 3300050496 Bacteria 1948
263 nmdc:mga0n895_374606_c1 3300050512 Bacteria 1441
264 nmdc:mga0n895_982371_c1 3300050512 Bacteria 826
265 nmdc:mga0rr50_312713_c1 3300050513 Bacteria 1316
266 nmdc:mga0rr50_327624_c1 3300050513 Bacteria 1285
267 nmdc:mga0a205_213263_c1 3300050515 Bacteria 1818
268 nmdc:mga0sz30_20024_c1 3300050516 Bacteria 2696
269 nmdc:mga0sz30_60402_c1 3300050516 Bacteria 1619
270 Ga0500635_0044419 3300053080 Bacteria 1499
271 Ga0500635_0060406 3300053080 Bacteria 1321
272 Ga0500647_0064380 3300053091 Bacteria 1763
273 Ga0500651_0746876 3300053093 Bacteria 520
274 Ga0500566_0064270 3300053094 Bacteria 2072
275 Ga0500640_127594 3300053095 Bacteria 1008
276 Ga0500554_259519 3300053102 Bacteria 571
277 Ga0500595_016450 3300053119 Bacteria 2755
278 Ga0500608_023818 3300053122 Bacteria 2852
279 Ga0500559_0108707 3300053136 Bacteria 1283
280 Ga0500564_124781 3300053138 Bacteria 1118
281 Ga0500590_135131 3300053148 Bacteria 1135
282 Ga0500603_034791 3300053150 Bacteria 1318
283 Ga0500603_132739 3300053150 Bacteria 762
284 Ga0500619_145605 3300053154 Bacteria 806
285 Ga0500620_008712 3300053155 Bacteria 2579
286 Ga0500634_0194994 3300053161 Bacteria 896
287 Ga0500638_039590 3300053162 Bacteria 2288
288 Ga0500638_149899 3300053162 Bacteria 1038
289 Ga0500639_069865 3300053163 Bacteria 1792
290 Ga0500636_0000082 3300053177 Bacteria 47168
291 Ga0500636_0021643 3300053177 Bacteria 3806
292 Ga0500637_0023553 3300053178 Bacteria 3369
293 Ga0500637_0608877 3300053178 Bacteria 516
294 Ga0500552_001662 3300053733 Bacteria 2125
295 Ga0500601_005126 3300053737 Bacteria 1432
296 Ga0530510_0716567 3300061734 Bacteria 763
297 2524437188 2524023205 Bacteria 8918781
298 2723846656 2721755755 Bacteria 8322773
299 2745076407 2744054633 Bacteria 8678936
300 2793082855
301 2824760751 2824753945 Bacteria 9787441
302 2824769771 2824763712 Bacteria 9792355
303 2841958373 2841957949 Bacteria 8652217
304 2876763919 2876761206 Bacteria 10111113
305 2889037072 2889033259 Bacteria 9099371
306 2904712405 2904711408 Bacteria 9771557
307 JGI25406J46586_10008607
308 JGI24735J21928_10144980
309 rootL2_10123070
310 rootL2_10145659
311 rootL2_10166881
312 JGI25160J50197_1000600
313 JGI25404J52841_10003926
314 JGI25404J52841_10007543
315 JGI25404J52841_10014551
316 JGI25404J52841_10023020
317 Ga0070670_100169893
318 Ga0070677_10092276
319 Ga0068869_100001614
320 Ga0070666_10097937
321 Ga0070682_100281760
322 Ga0068868_100021555
323 Ga0068868_101782640
324 Ga0070668_100007614
325 Ga0070669_100683926
326 Ga0070674_101130835
327 Ga0070673_100187304
328 Ga0070688_100568069
329 Ga0070659_100063061
330 Ga0070667_100101407
331 Ga0070701_10602915
332 Ga0070694_100566650
333 Ga0070678_100113523
334 Ga0070678_100506578
335 Ga0070662_100014673
336 Ga0068867_100123952
337 Ga0070685_10087273
338 Ga0070698_100058340
339 Ga0068853_100317845
340 Ga0070695_101209524
341 Ga0070693_100051760
342 Ga0070665_100032699
343 Ga0068855_100029867
344 Ga0070664_100477792
345 Ga0068857_100066343
346 Ga0068854_100056589
347 Ga0068856_100044494
348 Ga0070702_100062649
349 Ga0070702_100268679
350 Ga0068852_100269394
351 Ga0068859_100045856
352 Ga0068859_100052245
353 Ga0068864_100003289
354 Ga0068864_100884620
355 Ga0068866_10114097
356 Ga0068861_100008579
357 Ga0068861_100840265
358 Ga0068851_10291912
359 Ga0068870_10036501
360 Ga0068863_100051991
361 Ga0068858_100012996
362 Ga0068860_100037537
363 Ga0081455_10005268
364 Ga0081455_10014047
365 Ga0081455_10027365
366 Ga0081455_10034346
367 Ga0081455_10066410
368 Ga0081455_10108798
369 Ga0081455_10885771
370 Ga0081540_1000729
371 Ga0081540_1001334
372 Ga0081540_1004786
373 Ga0081540_1005094
374 Ga0081540_1006618
375 Ga0081540_1007177
376 Ga0081540_1027942
377 Ga0081540_1034079
378 Ga0081540_1134738
379 Ga0081539_10000617
380 Ga0081539_10016765
381 Ga0075365_10017390
382 Ga0075365_10021021
383 Ga0075365_10408775
384 Ga0075368_10002154
385 Ga0075363_100006206
386 Ga0075363_100600767
387 Ga0075364_10059293
388 Ga0075364_10112640
389 Ga0075362_10025073
390 Ga0075362_10205661
391 Ga0075367_10014570
392 Ga0075369_10004220
393 Ga0075369_10022362
394 Ga0075366_10016947
395 Ga0097621_100082265
396 Ga0097621_100131506
397 Ga0075370_10050022
398 Ga0075370_10139027
399 Ga0068871_100053880
400 Ga0068871_100287189
401 Ga0068871_100350326
402 Ga0075433_10365659
403 Ga0075434_100091849
404 Ga0075436_100136439
405 Ga0097620_100045857
406 Ga0097620_100052245
407 Ga0075435_100036084
408 Ga0075435_100349082
409 Ga0099794_10141092
410 Ga0105240_11655527
411 Ga0105245_10003228
412 Ga0105247_10003634
413 Ga0105247_10003960
414 Ga0105243_10847082
415 Ga0105241_10006083
416 Ga0105242_10434928
417 Ga0105248_10017084
418 Ga0105237_10009318
419 Ga0105238_10014817
420 Ga0105249_10062540
421 Ga0105239_10073081
422 Ga0105239_10136321
423 Ga0105246_10000971
424 Ga0157374_10047616
425 Ga0157378_10063520
426 Ga0163162_10092203
427 Ga0163162_12104101
428 Ga0157375_10089091
429 Ga0163163_10038274
430 Ga0157380_10195059
431 Ga0157377_10027133
432 Ga0157379_10167194
433 Ga0157376_10022482
434 Ga0163161_10101686
435 Ga0209758_1036790
436 Ga0207426_1000143
437 Ga0209257_1057848
438 Ga0207642_10272115
439 Ga0207710_10022083
440 Ga0207688_10004554
441 Ga0207688_10255886
442 Ga0207680_10093446
443 Ga0207647_10038188
444 Ga0207645_10094309
445 Ga0207643_10602010
446 Ga0207654_10037523
447 Ga0207695_11478186
448 Ga0207681_10668455
449 Ga0207694_10050430
450 Ga0207644_10018553
451 Ga0207690_10244610
452 Ga0207706_10010375
453 Ga0207704_11129513
454 Ga0207711_10116690
455 Ga0207689_10002253
456 Ga0207667_10209271
457 Ga0207712_10135959
458 Ga0207668_10001702
459 Ga0207658_10054893
460 Ga0207677_10093610
461 Ga0207703_10039980
462 Ga0207639_10377971
463 Ga0207678_10009941
464 Ga0207702_10404493
465 Ga0207641_10156321
466 Ga0207676_10100125
467 Ga0207676_10866011
468 Ga0207674_10068355
469 Ga0207675_100006564
470 Ga0207683_10007729
471 Ga0207683_10233353
472 Ga0209588_1020103
473 Ga0209813_10005970
474 Ga0207428_10666279
475 Ga0268266_10003097
476 Ga0268266_10028485
477 Ga0268265_11118763
478 Ga0268264_10052412
479 Ga0268264_11854843
480 Ga0307511_10063444
481 Ga0307511_10189467
482 Ga0307509_10007956
483 Ga0307509_10043938
484 Ga0307509_10052772
485 Ga0307509_10226060
486 Ga0307408_100114314
487 Ga0307508_10016498
488 Ga0307516_10000729
489 Ga0307412_12072068
490 Ga0307507_10025988
491 Ga0373944_0105654
492 Ga0373943_0524972
493 Ga0373935_0013256
494 Ga0373927_0014073
495 Ga0373947_0100188
496 Ga0373925_0375759
497 Ga0451851_0091531
498 Ga0495603_0008967
499 Ga0495629_0009697
500 Ga0495639_0057914
501 Ga0495594_0582809
502 Ga0495606_0270815
503 Ga0495632_0131246
504 Ga0495654_0101409
505 Ga0495622_0028600
506 Ga0495633_0248454
507 Ga0495668_0043640
508 Ga0495668_0119179
509 Ga0495611_0160348
510 Ga0495625_0083705
511 Ga0495647_0196243
512 Ga0495658_0238644
513 Ga0495669_0254351
514 Ga0495669_0265620
515 Ga0495613_0124698
516 Ga0495624_0061195
517 Ga0495589_0144395
518 Ga0495581_0045231
519 Ga0496101_0062153
520 Ga0496101_0870340
521 Ga0496102_0260393
522 Ga0496103_0179780
523 Ga0496104_0006525
524 Ga0496104_0114555
525 Ga0496105_0000908
526 Ga0496106_0042161
527 Ga0496107_0814605
528 Ga0496108_0060880
529 Ga0496108_0832449
530 Ga0496109_0481673
531 Ga0496110_0060849
532 Ga0496112_0056497
533 Ga0496113_0019915
534 Ga0496113_0318571
535 Ga0496113_1097781
536 Ga0496115_0055233
537 Ga0496115_0081475
538 Ga0496117_0273159
539 Ga0496118_0125682
540 Ga0496118_0226997
541 Ga0496119_0008922
542 Ga0496119_0049571
543 Ga0496120_0036085
544 Ga0496121_0047482
545 Ga0496121_0053962
546 Ga0496121_0115481
547 Ga0496125_0009279
548 Ga0496126_0041519
549 Ga0496126_0247183
550 Ga0496126_0966004
551 Ga0501067_0176102
552 Ga0501067_0288744
553 Ga0501069_0026686
554 Ga0501076_1283834
555 nmdc:mga03683_257155_c1
556 nmdc:mga03683_54943_c1
557 nmdc:mga03683_64508_c1
558 nmdc:mga03n38_596709_c1
559 nmdc:mga00v17_179656_c1
560 nmdc:mga00v17_26050_c1
561 nmdc:mga00v17_36744_c1
562 nmdc:mga0yw44_120009_c1
563 nmdc:mga0yw44_155236_c1
564 nmdc:mga0yw44_18537_c1
565 nmdc:mga06z11_704522_c1
566 nmdc:mga04h51_90025_c1
567 nmdc:mga07m45_13048_c1
568 nmdc:mga07m45_73399_c1
569 nmdc:mga0n895_374606_c1
570 nmdc:mga0n895_982371_c1
571 nmdc:mga0rr50_312713_c1
572 nmdc:mga0rr50_327624_c1
573 nmdc:mga0a205_213263_c1
574 nmdc:mga0sz30_20024_c1
575 nmdc:mga0sz30_60402_c1
576 Ga0500635_0044419
577 Ga0500635_0060406
578 Ga0500647_0064380
579 Ga0500651_0746876
580 Ga0500566_0064270
581 Ga0500640_127594
582 Ga0500554_259519
583 Ga0500595_016450
584 Ga0500608_023818
585 Ga0500559_0108707
586 Ga0500564_124781
587 Ga0500590_135131
588 Ga0500603_034791
589 Ga0500603_132739
590 Ga0500619_145605
591 Ga0500620_008712
592 Ga0500634_0194994
593 Ga0500638_039590
594 Ga0500638_149899
595 Ga0500639_069865
596 Ga0500636_0000082
597 Ga0500636_0021643
598 Ga0500637_0023553
599 Ga0500637_0608877
600 Ga0500552_001662
601 Ga0500601_005126
602 Ga0530510_0716567
603 2524437188
604 2723846656
605 2745076407
606 2793082855
607 2824760751
608 2824769771
609 2841958373
610 2876763919
611 2889037072
612 2904712405

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m74-assembly1.cif.gz_B atp-bound amp-activated protein kinase 0.7286 78 110
3etl-assembly1.cif.gz_A rada recombinase from methanococcus maripaludis in complex with amppnp 0.728 77 109
2oc3-assembly1.cif.gz_A crystal structure of the catalytic domain of human protein tyrosine phosphatase non-receptor type 18 0.7258 69 105
3ewa-assembly1.cif.gz_A rada recombinase from methanococcus maripaludis in complex with amppnp and ammonium ions 0.7256 77 109
3d42-assembly1.cif.gz_A crystal structure of heptp in complex with a monophosphorylated erk2 peptide 0.7223 66 111
ID Description Score Start End Superfamily
af_Q9NA36_16_125_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7584 75 112 3.10.450.50
2qkdA01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ZPR1, zinc finger domain 0.7438 75 107 2.20.25.420
af_P91532_70_161_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7372 77 112 3.10.450.50
af_Q61152_2_299_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7231 69 105 3.90.190.10
af_P49445_57_357_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7168 66 111 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A4Y9UI56-F1-model_v4 DUF3617 family protein 0.932 28 133
AF-A0A7C9VFV2-F1-model_v4 Uncharacterized protein 0.9152 20 133
AF-A0A4Y9UI56-F1-model_v4 DUF3617 family protein 0.8922 28 133
AF-A0A7C9VFV2-F1-model_v4 Uncharacterized protein 0.8791 20 133
AF-A0A7R7B283-F1-model_v4 deleted 0.8678 39 133

Map