F398358

General Info

Members Datasets Scaffolds Average Seq Length
305 199 610 104

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0238518|Ga0501083_0238518_343_720
Length 125
Sequence MYNKENLTKIKKMNELAPKLMEAFWAFDRLAVAEGAIPVKYKELIAVAVAVTTQCPYCVDIHANSARKAGVTDAELTEACMVAAALRAGGAVTHATHALSGEPTNGSSARHSDPELARSRRGTEN

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0
Rhizoplane 5.9
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0238518 3300049744 Bacteria 1184
2 Ga0065712_10325596 3300005290 Bacteria 822
3 Ga0065707_10374996 3300005295 Bacteria 885
4 Ga0070658_10075174 3300005327 Bacteria 2771
5 Ga0070676_10273021 3300005328 Unclassified 1136
6 Ga0070683_101630297 3300005329 Unclassified 620
7 Ga0070690_100000105 3300005330 Bacteria 43555
8 Ga0070690_100009687 3300005330 Bacteria 5587
9 Ga0070690_100081708 3300005330 Bacteria 2115
10 Ga0070670_100001743 3300005331 Bacteria 17718
11 Ga0070670_100572964 3300005331 Bacteria 1008
12 Ga0070677_10307888 3300005333 Bacteria 807
13 Ga0070666_10024372 3300005335 Bacteria 3941
14 Ga0070666_10048167 3300005335 Bacteria 2863
15 Ga0070666_10752507 3300005335 Unclassified 716
16 Ga0070680_100823551 3300005336 Bacteria 800
17 Ga0070680_101328471 3300005336 Bacteria 622
18 Ga0068868_100054298 3300005338 Bacteria 3157
19 Ga0070660_100478830 3300005339 Bacteria 1034
20 Ga0070660_100693884 3300005339 Bacteria 853
21 Ga0070689_100000031 3300005340 Bacteria 93387
22 Ga0070689_100065018 3300005340 Bacteria 2840
23 Ga0070689_100112751 3300005340 Bacteria 2165
24 Ga0070689_100200380 3300005340 Bacteria 1630
25 Ga0070691_10197594 3300005341 Bacteria 1055
26 Ga0070661_100150296 3300005344 Unclassified 1760
27 Ga0070692_10174838 3300005345 Bacteria 1240
28 Ga0070668_100392502 3300005347 Unclassified 1183
29 Ga0070668_101654806 3300005347 Unclassified 587
30 Ga0070669_102026217 3300005353 Bacteria 503
31 Ga0070675_100009131 3300005354 Bacteria 7702
32 Ga0070675_100040559 3300005354 Bacteria 3801
33 Ga0070675_100823361 3300005354 Bacteria 849
34 Ga0070671_100009982 3300005355 Bacteria 7623
35 Ga0070671_100053425 3300005355 Bacteria 3359
36 Ga0070688_100000603 3300005365 Bacteria 17987
37 Ga0070688_100260270 3300005365 Bacteria 1239
38 Ga0070659_100128236 3300005366 Bacteria 2059
39 Ga0070659_100375911 3300005366 Bacteria 1196
40 Ga0070667_100140473 3300005367 Unclassified 2115
41 Ga0070703_10209037 3300005406 Bacteria 770
42 Ga0070709_10201434 3300005434 Bacteria 1410
43 Ga0070709_10262138 3300005434 Bacteria 1249
44 Ga0070713_100384453 3300005436 Unclassified 1308
45 Ga0070713_100675258 3300005436 Bacteria 985
46 Ga0070710_10375397 3300005437 Bacteria 947
47 Ga0070710_10954678 3300005437 Bacteria 622
48 Ga0070701_10180901 3300005438 Bacteria 1234
49 Ga0070711_100411176 3300005439 Bacteria 1100
50 Ga0070705_100366723 3300005440 Bacteria 1055
51 Ga0070700_100004446 3300005441 Bacteria 7326
52 Ga0070700_101019923 3300005441 Unclassified 681
53 Ga0070694_100104593 3300005444 Bacteria 2008
54 Ga0070678_100000790 3300005456 Bacteria 15894
55 Ga0070678_100434542 3300005456 Unclassified 1147
56 Ga0070662_100111342 3300005457 Bacteria 2086
57 Ga0068867_100005305 3300005459 Bacteria 9103
58 Ga0068867_100111495 3300005459 Bacteria 2102
59 Ga0068867_100625263 3300005459 Bacteria 942
60 Ga0068867_101823350 3300005459 Bacteria 572
61 Ga0070685_10000421 3300005466 Bacteria 24908
62 Ga0070685_10083042 3300005466 Bacteria 1924
63 Ga0070685_10140855 3300005466 Bacteria 1518
64 Ga0070706_100161275 3300005467 Bacteria 2094
65 Ga0070707_101946857 3300005468 Unclassified 555
66 Ga0070699_100044014 3300005518 Bacteria 3864
67 Ga0070684_100280970 3300005535 Bacteria 1525
68 Ga0070697_100266833 3300005536 Viruses 1467
69 Ga0070697_100654127 3300005536 Bacteria 926
70 Ga0068853_100380329 3300005539 Bacteria 1318
71 Ga0070672_100000243 3300005543 Bacteria 30530
72 Ga0070686_100000330 3300005544 Bacteria 30807
73 Ga0070695_100379732 3300005545 Bacteria 1066
74 Ga0070665_100067324 3300005548 Bacteria 3591
75 Ga0070665_100340262 3300005548 Bacteria 1505
76 Ga0070664_101163662 3300005564 Bacteria 727
77 Ga0070664_102039902 3300005564 Unclassified 544
78 Ga0068854_100737765 3300005578 Unclassified 853
79 Ga0068854_101703426 3300005578 Bacteria 576
80 Ga0068856_100004018 3300005614 Bacteria 14731
81 Ga0070702_100629676 3300005615 Bacteria 808
82 Ga0068852_100324604 3300005616 Bacteria 1496
83 Ga0068859_100001426 3300005617 Bacteria 24236
84 Ga0068859_101218629 3300005617 Bacteria 829
85 Ga0068859_102063090 3300005617 Bacteria 629
86 Ga0068864_100283699 3300005618 Bacteria 1546
87 Ga0068866_10026070 3300005718 Bacteria 2756
88 Ga0068861_100062188 3300005719 Bacteria 2867
89 Ga0068861_100104054 3300005719 Bacteria 2264
90 Ga0068861_101101101 3300005719 Bacteria 763
91 Ga0068851_10444984 3300005834 Bacteria 769
92 Ga0068863_100183381 3300005841 Bacteria 2010
93 Ga0068858_100551132 3300005842 Bacteria 1116
94 Ga0068858_101612749 3300005842 Unclassified 640
95 Ga0068858_102138912 3300005842 Bacteria 553
96 Ga0068860_100294005 3300005843 Bacteria 1590
97 Ga0068860_101683085 3300005843 Bacteria 656
98 Ga0068862_100138572 3300005844 Bacteria 2158
99 Ga0068862_100251515 3300005844 Bacteria 1611
100 Ga0068862_100686295 3300005844 Bacteria 991
101 Ga0070717_10165034 3300006028 Bacteria 1923
102 Ga0075363_100991916 3300006048 Bacteria 517
103 Ga0075364_10561425 3300006051 Bacteria 780
104 Ga0070715_10098530 3300006163 Bacteria 1359
105 Ga0070712_100120824 3300006175 Bacteria 1971
106 Ga0070712_100170934 3300006175 Bacteria 1686
107 Ga0097621_100051018 3300006237 Bacteria 3366
108 Ga0097621_100122354 3300006237 Bacteria 2208
109 Ga0097621_101998463 3300006237 Bacteria 554
110 Ga0068871_100009620 3300006358 Bacteria 7019
111 Ga0068871_100258492 3300006358 Bacteria 1518
112 Ga0075430_100029133 3300006846 Bacteria 4686
113 Ga0075431_100035536 3300006847 Bacteria 5130
114 Ga0075429_100341386 3300006880 Bacteria 1311
115 Ga0068865_100287481 3300006881 Bacteria 1311
116 Ga0075436_101085315 3300006914 Unclassified 602
117 Ga0097620_100001426 3300006931 Bacteria 24236
118 Ga0097620_101218619 3300006931 Bacteria 829
119 Ga0097620_102063045 3300006931 Bacteria 629
120 Ga0105240_10225386 3300009093 Unclassified 2181
121 Ga0105240_10726944 3300009093 Bacteria 1081
122 Ga0111539_10000109 3300009094 Bacteria 89705
123 Ga0111539_10403384 3300009094 Bacteria 1592
124 Ga0105245_12355651 3300009098 Bacteria 586
125 Ga0105247_10401089 3300009101 Bacteria 977
126 Ga0105247_11128720 3300009101 Bacteria 620
127 Ga0105243_11984670 3300009148 Bacteria 616
128 Ga0105242_10114013 3300009176 Bacteria 2309
129 Ga0105248_10001714 3300009177 Bacteria 24367
130 Ga0105248_11326492 3300009177 Unclassified 814
131 Ga0105248_11640847 3300009177 Bacteria 729
132 Ga0105248_12400544 3300009177 Unclassified 601
133 Ga0105237_11187143 3300009545 Bacteria 770
134 Ga0105238_10309820 3300009551 Bacteria 1563
135 Ga0105238_10532775 3300009551 Bacteria 1178
136 Ga0105249_10015914 3300009553 Bacteria 6666
137 Ga0105249_10275177 3300009553 Unclassified 1679
138 Ga0105249_10541679 3300009553 Bacteria 1214
139 Ga0105249_10621966 3300009553 Bacteria 1136
140 Ga0105249_11053219 3300009553 Bacteria 883
141 Ga0105249_12702237 3300009553 Bacteria 568
142 Ga0157370_12098641 3300013104 Bacteria 506
143 Ga0157374_10003649 3300013296 Bacteria 12952
144 Ga0157378_10006263 3300013297 Bacteria 10417
145 Ga0157378_10064518 3300013297 Bacteria 3276
146 Ga0157378_10647298 3300013297 Bacteria 1072
147 Ga0163162_10025857 3300013306 Bacteria 5802
148 Ga0163162_11128355 3300013306 Bacteria 889
149 Ga0157372_10175826 3300013307 Bacteria 2478
150 Ga0157375_10000797 3300013308 Bacteria 27613
151 Ga0157375_10001713 3300013308 Bacteria 18827
152 Ga0157375_11790948 3300013308 Unclassified 728
153 Ga0163163_10550440 3300014325 Bacteria 1216
154 Ga0163163_12664895 3300014325 Bacteria 557
155 Ga0157380_10039773 3300014326 Bacteria 3659
156 Ga0157380_10103911 3300014326 Unclassified 2371
157 Ga0157379_12152133 3300014968 Unclassified 553
158 Ga0157376_10110488 3300014969 Bacteria 2418
159 Ga0207697_10016552 3300025315 Bacteria 3037
160 Ga0207688_10349243 3300025901 Unclassified 911
161 Ga0207680_10046665 3300025903 Bacteria 2562
162 Ga0207680_10203720 3300025903 Bacteria 1350
163 Ga0207680_10540076 3300025903 Unclassified 832
164 Ga0207647_10236086 3300025904 Bacteria 1051
165 Ga0207699_10088392 3300025906 Bacteria 1939
166 Ga0207699_10330741 3300025906 Bacteria 1071
167 Ga0207645_10027742 3300025907 Bacteria 3655
168 Ga0207695_10196368 3300025913 Unclassified 1934
169 Ga0207671_10703576 3300025914 Bacteria 803
170 Ga0207693_10303139 3300025915 Bacteria 1251
171 Ga0207693_10481800 3300025915 Bacteria 969
172 Ga0207663_10065748 3300025916 Bacteria 2319
173 Ga0207660_10897321 3300025917 Bacteria 723
174 Ga0207662_11355086 3300025918 Bacteria 505
175 Ga0207657_10574482 3300025919 Bacteria 880
176 Ga0207649_10460993 3300025920 Bacteria 961
177 Ga0207649_10666624 3300025920 Unclassified 805
178 Ga0207681_10509126 3300025923 Bacteria 987
179 Ga0207681_11619522 3300025923 Bacteria 542
180 Ga0207694_10100816 3300025924 Bacteria 2288
181 Ga0207694_10769468 3300025924 Unclassified 813
182 Ga0207650_10003332 3300025925 Bacteria 11053
183 Ga0207650_10071883 3300025925 Bacteria 2603
184 Ga0207650_10764178 3300025925 Bacteria 818
185 Ga0207659_10162383 3300025926 Bacteria 1755
186 Ga0207659_10847793 3300025926 Bacteria 785
187 Ga0207687_11431199 3300025927 Bacteria 594
188 Ga0207700_10194848 3300025928 Unclassified 1704
189 Ga0207644_10004597 3300025931 Bacteria 8977
190 Ga0207690_10141355 3300025932 Unclassified 1774
191 Ga0207686_10265546 3300025934 Bacteria 1260
192 Ga0207670_10000040 3300025936 Bacteria 102329
193 Ga0207670_10044390 3300025936 Bacteria 2940
194 Ga0207670_10117093 3300025936 Bacteria 1930
195 Ga0207670_10141363 3300025936 Bacteria 1775
196 Ga0207665_10960587 3300025939 Bacteria 679
197 Ga0207691_10000064 3300025940 Bacteria 85026
198 Ga0207691_10287764 3300025940 Bacteria 1413
199 Ga0207711_10017804 3300025941 Bacteria 5903
200 Ga0207711_10793483 3300025941 Bacteria 882
201 Ga0207661_10113730 3300025944 Bacteria 2294
202 Ga0207679_12067149 3300025945 Unclassified 518
203 Ga0207667_11225019 3300025949 Unclassified 729
204 Ga0207667_11458674 3300025949 Bacteria 656
205 Ga0207651_10008261 3300025960 Bacteria 5612
206 Ga0207651_10016801 3300025960 Bacteria 4301
207 Ga0207712_10811502 3300025961 Unclassified 823
208 Ga0207712_10922367 3300025961 Bacteria 773
209 Ga0207668_10160763 3300025972 Unclassified 1750
210 Ga0207668_10227014 3300025972 Bacteria 1503
211 Ga0207658_10525860 3300025986 Bacteria 1056
212 Ga0207658_10613360 3300025986 Bacteria 978
213 Ga0207703_10272988 3300026035 Bacteria 1533
214 Ga0207703_11613692 3300026035 Unclassified 624
215 Ga0207639_10152358 3300026041 Bacteria 1938
216 Ga0207639_11796288 3300026041 Bacteria 574
217 Ga0207678_10858326 3300026067 Unclassified 802
218 Ga0207708_10000527 3300026075 Bacteria 29539
219 Ga0207702_10012337 3300026078 Bacteria 7113
220 Ga0207648_10004215 3300026089 Bacteria 14859
221 Ga0207676_11192013 3300026095 Bacteria 754
222 Ga0207674_10522117 3300026116 Bacteria 1147
223 Ga0207675_100111125 3300026118 Bacteria 2586
224 Ga0207675_100169696 3300026118 Bacteria 2085
225 Ga0207675_100298381 3300026118 Bacteria 1569
226 Ga0207675_101047501 3300026118 Bacteria 835
227 Ga0207675_101360642 3300026118 Bacteria 731
228 Ga0207683_10000117 3300026121 Bacteria 64937
229 Ga0207683_10148748 3300026121 Bacteria 2113
230 Ga0207698_11468126 3300026142 Bacteria 697
231 Ga0207428_10007444 3300027907 Bacteria 9980
232 Ga0268266_10280960 3300028379 Bacteria 1548
233 Ga0268265_10066773 3300028380 Bacteria 2782
234 Ga0268264_10262467 3300028381 Bacteria 1610
235 Ga0268264_11703302 3300028381 Bacteria 641
236 Ga0265338_10006427 3300028800 Bacteria 14980
237 Ga0265324_10127317 3300029957 Bacteria 865
238 Ga0265332_10022172 3300031238 Bacteria 2803
239 Ga0265325_10000720 3300031241 Bacteria 23881
240 Ga0265339_10000938 3300031249 Bacteria 22370
241 Ga0265331_10000287 3300031250 Bacteria 55511
242 Ga0265313_10001662 3300031595 Bacteria 20594
243 Ga0265314_10000123 3300031711 Bacteria 119667
244 Ga0265342_10163397 3300031712 Bacteria 1229
245 Ga0307405_11046210 3300031731 Bacteria 699
246 Ga0307413_10081703 3300031824 Bacteria 2073
247 Ga0307413_10099666 3300031824 Unclassified 1916
248 Ga0307410_10699992 3300031852 Unclassified 854
249 Ga0307410_10746447 3300031852 Bacteria 828
250 Ga0307407_10741822 3300031903 Bacteria 743
251 Ga0307412_11538912 3300031911 Bacteria 606
252 Ga0307409_100057757 3300031995 Bacteria 3009
253 Ga0307409_100112494 3300031995 Bacteria 2286
254 Ga0307416_101195113 3300032002 Bacteria 866
255 Ga0373923_0473833 3300035111 Unclassified 609
256 Ga0373941_0131107 3300035115 Unclassified 903
257 Ga0373931_0336613 3300035691 Bacteria 941
258 Ga0373937_0561988 3300036401 Bacteria 1084
259 Ga0373937_1627135 3300036401 Bacteria 593
260 Ga0439437_004930 3300042000 Bacteria 1463
261 Ga0439441_124474 3300042001 Unclassified 593
262 Ga0451577_0286881 3300042876 Bacteria 1492
263 Ga0451576_0078638 3300045051 Unclassified 3432
264 Ga0495592_0354623 3300046454 Bacteria 940
265 Ga0495651_0631919 3300046462 Bacteria 673
266 Ga0495653_0230684 3300046463 Bacteria 1239
267 Ga0495628_0582522 3300046516 Bacteria 801
268 Ga0495630_0049369 3300046517 Bacteria 3150
269 Ga0495667_0379857 3300046559 Bacteria 891
270 Ga0495680_0594911 3300047322 Bacteria 741
271 Ga0495683_0475921 3300047323 Unclassified 510
272 Ga0495684_0292628 3300047471 Bacteria 1172
273 Ga0496104_0082076 3300048907 Bacteria 3075
274 Ga0496104_0515585 3300048907 Bacteria 1107
275 Ga0496105_0065034 3300048908 Bacteria 3010
276 Ga0496106_0370186 3300048909 Bacteria 1151
277 Ga0496108_0037023 3300048911 Bacteria 4062
278 Ga0496109_0091068 3300048912 Bacteria 2820
279 Ga0496109_1401748 3300048912 Unclassified 634
280 Ga0496110_0386341 3300048913 Bacteria 1276
281 Ga0496111_0799859 3300048914 Unclassified 682
282 Ga0496112_0322454 3300048915 Bacteria 1489
283 Ga0496112_0558425 3300048915 Bacteria 1078
284 Ga0496112_0565200 3300048915 Bacteria 1071
285 Ga0496112_1109393 3300048915 Unclassified 709
286 Ga0496112_1585311 3300048915 Bacteria 568
287 Ga0496114_0024995 3300048917 Bacteria 4878
288 Ga0496114_0823841 3300048917 Unclassified 807
289 Ga0496115_0197507 3300048918 Bacteria 1662
290 Ga0496115_0596493 3300048918 Unclassified 879
291 Ga0501032_0000037 3300049569 Bacteria 116729
292 Ga0501033_0000009 3300049570 Bacteria 272351
293 Ga0501080_0296076 3300049742 Bacteria 1468
294 nmdc:mga09592_239738_c1 3300050508 Bacteria 1571
295 nmdc:mga0qj67_29266_c1 3300050509 Bacteria 4279
296 nmdc:mga06r32_40854_c1 3300050510 Bacteria 4405
297 nmdc:mga08y16_1750331_c1 3300050511 Unclassified 576
298 nmdc:mga08y16_280_c1 3300050511 Bacteria 46474
299 nmdc:mga08y16_388235_c1 3300050511 Bacteria 1430
300 nmdc:mga08x19_836283_c1 3300050514 Bacteria 654
301 Ga0495601_0218357 3300053077 Bacteria 1245
302 Ga0500568_0008661 3300053139 Bacteria 4885
303 Ga0500616_0008285 3300053153 Bacteria 6474
304 Ga0500636_0097303 3300053177 Bacteria 1678
305 Ga0501084_0289507 3300054114 Bacteria 1383
306 Ga0501083_0238518
307 Ga0065712_10325596
308 Ga0065707_10374996
309 Ga0070658_10075174
310 Ga0070676_10273021
311 Ga0070683_101630297
312 Ga0070690_100000105
313 Ga0070690_100009687
314 Ga0070690_100081708
315 Ga0070670_100001743
316 Ga0070670_100572964
317 Ga0070677_10307888
318 Ga0070666_10024372
319 Ga0070666_10048167
320 Ga0070666_10752507
321 Ga0070680_100823551
322 Ga0070680_101328471
323 Ga0068868_100054298
324 Ga0070660_100478830
325 Ga0070660_100693884
326 Ga0070689_100000031
327 Ga0070689_100065018
328 Ga0070689_100112751
329 Ga0070689_100200380
330 Ga0070691_10197594
331 Ga0070661_100150296
332 Ga0070692_10174838
333 Ga0070668_100392502
334 Ga0070668_101654806
335 Ga0070669_102026217
336 Ga0070675_100009131
337 Ga0070675_100040559
338 Ga0070675_100823361
339 Ga0070671_100009982
340 Ga0070671_100053425
341 Ga0070688_100000603
342 Ga0070688_100260270
343 Ga0070659_100128236
344 Ga0070659_100375911
345 Ga0070667_100140473
346 Ga0070703_10209037
347 Ga0070709_10201434
348 Ga0070709_10262138
349 Ga0070713_100384453
350 Ga0070713_100675258
351 Ga0070710_10375397
352 Ga0070710_10954678
353 Ga0070701_10180901
354 Ga0070711_100411176
355 Ga0070705_100366723
356 Ga0070700_100004446
357 Ga0070700_101019923
358 Ga0070694_100104593
359 Ga0070678_100000790
360 Ga0070678_100434542
361 Ga0070662_100111342
362 Ga0068867_100005305
363 Ga0068867_100111495
364 Ga0068867_100625263
365 Ga0068867_101823350
366 Ga0070685_10000421
367 Ga0070685_10083042
368 Ga0070685_10140855
369 Ga0070706_100161275
370 Ga0070707_101946857
371 Ga0070699_100044014
372 Ga0070684_100280970
373 Ga0070697_100266833
374 Ga0070697_100654127
375 Ga0068853_100380329
376 Ga0070672_100000243
377 Ga0070686_100000330
378 Ga0070695_100379732
379 Ga0070665_100067324
380 Ga0070665_100340262
381 Ga0070664_101163662
382 Ga0070664_102039902
383 Ga0068854_100737765
384 Ga0068854_101703426
385 Ga0068856_100004018
386 Ga0070702_100629676
387 Ga0068852_100324604
388 Ga0068859_100001426
389 Ga0068859_101218629
390 Ga0068859_102063090
391 Ga0068864_100283699
392 Ga0068866_10026070
393 Ga0068861_100062188
394 Ga0068861_100104054
395 Ga0068861_101101101
396 Ga0068851_10444984
397 Ga0068863_100183381
398 Ga0068858_100551132
399 Ga0068858_101612749
400 Ga0068858_102138912
401 Ga0068860_100294005
402 Ga0068860_101683085
403 Ga0068862_100138572
404 Ga0068862_100251515
405 Ga0068862_100686295
406 Ga0070717_10165034
407 Ga0075363_100991916
408 Ga0075364_10561425
409 Ga0070715_10098530
410 Ga0070712_100120824
411 Ga0070712_100170934
412 Ga0097621_100051018
413 Ga0097621_100122354
414 Ga0097621_101998463
415 Ga0068871_100009620
416 Ga0068871_100258492
417 Ga0075430_100029133
418 Ga0075431_100035536
419 Ga0075429_100341386
420 Ga0068865_100287481
421 Ga0075436_101085315
422 Ga0097620_100001426
423 Ga0097620_101218619
424 Ga0097620_102063045
425 Ga0105240_10225386
426 Ga0105240_10726944
427 Ga0111539_10000109
428 Ga0111539_10403384
429 Ga0105245_12355651
430 Ga0105247_10401089
431 Ga0105247_11128720
432 Ga0105243_11984670
433 Ga0105242_10114013
434 Ga0105248_10001714
435 Ga0105248_11326492
436 Ga0105248_11640847
437 Ga0105248_12400544
438 Ga0105237_11187143
439 Ga0105238_10309820
440 Ga0105238_10532775
441 Ga0105249_10015914
442 Ga0105249_10275177
443 Ga0105249_10541679
444 Ga0105249_10621966
445 Ga0105249_11053219
446 Ga0105249_12702237
447 Ga0157370_12098641
448 Ga0157374_10003649
449 Ga0157378_10006263
450 Ga0157378_10064518
451 Ga0157378_10647298
452 Ga0163162_10025857
453 Ga0163162_11128355
454 Ga0157372_10175826
455 Ga0157375_10000797
456 Ga0157375_10001713
457 Ga0157375_11790948
458 Ga0163163_10550440
459 Ga0163163_12664895
460 Ga0157380_10039773
461 Ga0157380_10103911
462 Ga0157379_12152133
463 Ga0157376_10110488
464 Ga0207697_10016552
465 Ga0207688_10349243
466 Ga0207680_10046665
467 Ga0207680_10203720
468 Ga0207680_10540076
469 Ga0207647_10236086
470 Ga0207699_10088392
471 Ga0207699_10330741
472 Ga0207645_10027742
473 Ga0207695_10196368
474 Ga0207671_10703576
475 Ga0207693_10303139
476 Ga0207693_10481800
477 Ga0207663_10065748
478 Ga0207660_10897321
479 Ga0207662_11355086
480 Ga0207657_10574482
481 Ga0207649_10460993
482 Ga0207649_10666624
483 Ga0207681_10509126
484 Ga0207681_11619522
485 Ga0207694_10100816
486 Ga0207694_10769468
487 Ga0207650_10003332
488 Ga0207650_10071883
489 Ga0207650_10764178
490 Ga0207659_10162383
491 Ga0207659_10847793
492 Ga0207687_11431199
493 Ga0207700_10194848
494 Ga0207644_10004597
495 Ga0207690_10141355
496 Ga0207686_10265546
497 Ga0207670_10000040
498 Ga0207670_10044390
499 Ga0207670_10117093
500 Ga0207670_10141363
501 Ga0207665_10960587
502 Ga0207691_10000064
503 Ga0207691_10287764
504 Ga0207711_10017804
505 Ga0207711_10793483
506 Ga0207661_10113730
507 Ga0207679_12067149
508 Ga0207667_11225019
509 Ga0207667_11458674
510 Ga0207651_10008261
511 Ga0207651_10016801
512 Ga0207712_10811502
513 Ga0207712_10922367
514 Ga0207668_10160763
515 Ga0207668_10227014
516 Ga0207658_10525860
517 Ga0207658_10613360
518 Ga0207703_10272988
519 Ga0207703_11613692
520 Ga0207639_10152358
521 Ga0207639_11796288
522 Ga0207678_10858326
523 Ga0207708_10000527
524 Ga0207702_10012337
525 Ga0207648_10004215
526 Ga0207676_11192013
527 Ga0207674_10522117
528 Ga0207675_100111125
529 Ga0207675_100169696
530 Ga0207675_100298381
531 Ga0207675_101047501
532 Ga0207675_101360642
533 Ga0207683_10000117
534 Ga0207683_10148748
535 Ga0207698_11468126
536 Ga0207428_10007444
537 Ga0268266_10280960
538 Ga0268265_10066773
539 Ga0268264_10262467
540 Ga0268264_11703302
541 Ga0265338_10006427
542 Ga0265324_10127317
543 Ga0265332_10022172
544 Ga0265325_10000720
545 Ga0265339_10000938
546 Ga0265331_10000287
547 Ga0265313_10001662
548 Ga0265314_10000123
549 Ga0265342_10163397
550 Ga0307405_11046210
551 Ga0307413_10081703
552 Ga0307413_10099666
553 Ga0307410_10699992
554 Ga0307410_10746447
555 Ga0307407_10741822
556 Ga0307412_11538912
557 Ga0307409_100057757
558 Ga0307409_100112494
559 Ga0307416_101195113
560 Ga0373923_0473833
561 Ga0373941_0131107
562 Ga0373931_0336613
563 Ga0373937_0561988
564 Ga0373937_1627135
565 Ga0439437_004930
566 Ga0439441_124474
567 Ga0451577_0286881
568 Ga0451576_0078638
569 Ga0495592_0354623
570 Ga0495651_0631919
571 Ga0495653_0230684
572 Ga0495628_0582522
573 Ga0495630_0049369
574 Ga0495667_0379857
575 Ga0495680_0594911
576 Ga0495683_0475921
577 Ga0495684_0292628
578 Ga0496104_0082076
579 Ga0496104_0515585
580 Ga0496105_0065034
581 Ga0496106_0370186
582 Ga0496108_0037023
583 Ga0496109_0091068
584 Ga0496109_1401748
585 Ga0496110_0386341
586 Ga0496111_0799859
587 Ga0496112_0322454
588 Ga0496112_0558425
589 Ga0496112_0565200
590 Ga0496112_1109393
591 Ga0496112_1585311
592 Ga0496114_0024995
593 Ga0496114_0823841
594 Ga0496115_0197507
595 Ga0496115_0596493
596 Ga0501032_0000037
597 Ga0501033_0000009
598 Ga0501080_0296076
599 nmdc:mga09592_239738_c1
600 nmdc:mga0qj67_29266_c1
601 nmdc:mga06r32_40854_c1
602 nmdc:mga08y16_1750331_c1
603 nmdc:mga08y16_280_c1
604 nmdc:mga08y16_388235_c1
605 nmdc:mga08x19_836283_c1
606 Ga0495601_0218357
607 Ga0500568_0008661
608 Ga0500616_0008285
609 Ga0500636_0097303
610 Ga0501084_0289507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

18

100

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vke-assembly1.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (tm1620) from thermotoga maritima at 1.56 a resolution 0.9651 20 83
1me5-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis alkylperoxidase ahpd h132q mutant 0.9609 37 84
2qeu-assembly1.cif.gz_B crystal structure of putative carboxymuconolactone decarboxylase (yp_555818.1) from burkholderia xenovorans lb400 at 1.65 a resolution 0.9244 10 86
3bey-assembly1.cif.gz_E crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.911 18 98
1knc-assembly1.cif.gz_A structure of ahpd from mycobacterium tuberculosis, a novel enzyme with thioredoxin-like activity. 0.91 32 84
ID Description Score Start End Superfamily
1vkeF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9651 20 83 1.20.1290.10
1vkeB00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9566 20 86 1.20.1290.10
1vkeC00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.956 20 86 1.20.1290.10
af_A4HXU1_714_811_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8866 12 68 1.20.1290.10
af_U3JAG5_124_286_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8849 13 72 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A4Q6AEF4-F1-model_v4 Alkylhydroperoxidase 0.9872 39 92 GO:0015036
GO:0032843
GO:0045454
GO:0051920
AF-A0A7W8IL63-F1-model_v4 AhpD family alkylhydroperoxidase 0.9715 1 100 GO:0051920
AF-A0A7G8BJL8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9695 22 101 GO:0051920
AF-A0A1Q6WK07-F1-model_v4 Alkylhydroperoxidase 0.9686 10 98 GO:0051920
AF-A0A843B008-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.967 10 86 GO:0051920

Map