F398303

General Info

Members Datasets Scaffolds Average Seq Length
305 164 305 146

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0204556|Ga0496104_0204556_1054_1575
Length 173
Sequence MLWVTRAHIRVNRAATGWLIRRFIDPRASFRFVEPDQVVRIQRDCHGIGFDAPGARYPHKDEIGRCSFEVLVAEYRPHDTALRMLAGIVHRADFPEELAWRNPRTLAWQFDVLSQGAPESSAVSLDDAPGLRSISRGFPLVAADDHETLERCAFLYDSLYASLREQLGYAAQT

Samples

Sample ID Description Type Environment
1 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
131 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.9
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1018909 3300002076 Unclassified 973
2 rootH1_10009429 3300003316 Bacteria 4595
3 rootL2_10282619 3300003322 Bacteria 4625
4 rootH1_10089349 3300003323 Bacteria 2151
5 JGI25404J52841_10000179 3300003659 Bacteria 7349
6 Ga0065704_10003535 3300005289 Bacteria 4157
7 Ga0065707_10002348 3300005295 Bacteria 8447
8 Ga0065707_10402365 3300005295 Bacteria 851
9 Ga0070676_11325747 3300005328 Bacteria 550
10 Ga0070683_100035088 3300005329 Bacteria 4585
11 Ga0070683_100944776 3300005329 Unclassified 827
12 Ga0070690_100000422 3300005330 Bacteria 21437
13 Ga0068869_100032622 3300005334 Bacteria 3671
14 Ga0068869_100150931 3300005334 Unclassified 1802
15 Ga0070666_10003091 3300005335 Bacteria 10102
16 Ga0068868_101300805 3300005338 Bacteria 675
17 Ga0070689_100007513 3300005340 Bacteria 7628
18 Ga0070689_100009714 3300005340 Bacteria 6827
19 Ga0070689_100026261 3300005340 Unclassified 4384
20 Ga0070687_100224595 3300005343 Bacteria 1152
21 Ga0070687_100401684 3300005343 Unclassified 899
22 Ga0070687_100420725 3300005343 Bacteria 881
23 Ga0070661_100007735 3300005344 Bacteria 7421
24 Ga0070675_100000454 3300005354 Bacteria 27986
25 Ga0070671_100054552 3300005355 Bacteria 3323
26 Ga0070671_100742409 3300005355 Unclassified 853
27 Ga0070674_100020416 3300005356 Bacteria 4233
28 Ga0070673_100166956 3300005364 Unclassified 1876
29 Ga0070673_100537757 3300005364 Unclassified 1060
30 Ga0070688_100060633 3300005365 Bacteria 2390
31 Ga0070667_100003766 3300005367 Bacteria 12879
32 Ga0070667_100105946 3300005367 Unclassified 2433
33 Ga0070667_100276720 3300005367 Unclassified 1506
34 Ga0070709_10000058 3300005434 Bacteria 85194
35 Ga0070713_101436371 3300005436 Unclassified 669
36 Ga0070710_10049717 3300005437 Bacteria 2346
37 Ga0070701_10007123 3300005438 Bacteria 4752
38 Ga0070705_100009025 3300005440 Bacteria 4950
39 Ga0070708_100017048 3300005445 Bacteria 6047
40 Ga0070708_100024721 3300005445 Bacteria 5130
41 Ga0070708_100134924 3300005445 Bacteria 2286
42 Ga0070708_100297055 3300005445 Unclassified 1521
43 Ga0070708_100607131 3300005445 Bacteria 1031
44 Ga0070708_100738303 3300005445 Unclassified 926
45 Ga0070708_100905628 3300005445 Unclassified 828
46 Ga0070663_100001221 3300005455 Bacteria 14110
47 Ga0068867_100041262 3300005459 Bacteria 3372
48 Ga0068867_100447081 3300005459 Bacteria 1100
49 Ga0070706_100003954 3300005467 Bacteria 14434
50 Ga0070706_100050153 3300005467 Bacteria 3852
51 Ga0070706_100074185 3300005467 Bacteria 3149
52 Ga0070706_100174254 3300005467 Bacteria 2008
53 Ga0070706_100236849 3300005467 Unclassified 1704
54 Ga0070706_100257060 3300005467 Bacteria 1630
55 Ga0070706_100416940 3300005467 Bacteria 1250
56 Ga0070707_100006209 3300005468 Bacteria 11129
57 Ga0070707_100027249 3300005468 Bacteria 5436
58 Ga0070707_100371909 3300005468 Bacteria 1388
59 Ga0070707_100631492 3300005468 Bacteria 1034
60 Ga0070698_100037075 3300005471 Bacteria 5029
61 Ga0070698_100081375 3300005471 Bacteria 3233
62 Ga0070698_100123624 3300005471 Bacteria 2545
63 Ga0070698_100131840 3300005471 Bacteria 2454
64 Ga0070698_100174597 3300005471 Bacteria 2089
65 Ga0070698_100389301 3300005471 Bacteria 1327
66 Ga0070698_100774383 3300005471 Bacteria 903
67 Ga0070699_100013714 3300005518 Bacteria 6973
68 Ga0070699_100052857 3300005518 Bacteria 3515
69 Ga0070699_100304066 3300005518 Bacteria 1431
70 Ga0070699_100460697 3300005518 Bacteria 1153
71 Ga0070699_100565205 3300005518 Unclassified 1036
72 Ga0070699_100654006 3300005518 Bacteria 959
73 Ga0070699_100913531 3300005518 Unclassified 804
74 Ga0070699_101077383 3300005518 Bacteria 737
75 Ga0070697_100001229 3300005536 Bacteria 19342
76 Ga0070697_100022807 3300005536 Unclassified 4976
77 Ga0070697_100187192 3300005536 Bacteria 1756
78 Ga0070697_100854893 3300005536 Bacteria 806
79 Ga0070697_100953223 3300005536 Unclassified 762
80 Ga0070672_100087238 3300005543 Bacteria 2510
81 Ga0070672_100160054 3300005543 Unclassified 1867
82 Ga0070672_100360540 3300005543 Unclassified 1241
83 Ga0070686_100071990 3300005544 Bacteria 2265
84 Ga0070686_100216076 3300005544 Unclassified 1383
85 Ga0070686_100231248 3300005544 Bacteria 1341
86 Ga0070696_100895271 3300005546 Bacteria 736
87 Ga0070665_100016810 3300005548 Bacteria 7335
88 Ga0070704_100020192 3300005549 Bacteria 4292
89 Ga0070704_100133475 3300005549 Unclassified 1928
90 Ga0070704_100991613 3300005549 Unclassified 759
91 Ga0070664_100008853 3300005564 Bacteria 8157
92 Ga0070664_100677201 3300005564 Unclassified 960
93 Ga0068857_100010272 3300005577 Bacteria 8137
94 Ga0068856_100001489 3300005614 Bacteria 24491
95 Ga0068856_100179376 3300005614 Unclassified 2131
96 Ga0070702_100137674 3300005615 Unclassified 1551
97 Ga0068859_100000008 3300005617 Bacteria 383750
98 Ga0068859_100002831 3300005617 Bacteria 17596
99 Ga0068859_100005328 3300005617 Bacteria 13082
100 Ga0068864_100040933 3300005618 Bacteria 3963
101 Ga0068864_100082215 3300005618 Bacteria 2826
102 Ga0068864_100137191 3300005618 Unclassified 2204
103 Ga0068866_10035116 3300005718 Bacteria 2446
104 Ga0068863_100059491 3300005841 Bacteria 3614
105 Ga0068863_100102025 3300005841 Unclassified 2728
106 Ga0068863_100215707 3300005841 Bacteria 1848
107 Ga0068863_100315926 3300005841 Unclassified 1517
108 Ga0068858_100001323 3300005842 Bacteria 25571
109 Ga0068858_100049974 3300005842 Unclassified 3871
110 Ga0068858_100097596 3300005842 Bacteria 2739
111 Ga0068860_100010880 3300005843 Bacteria 8971
112 Ga0068860_100345700 3300005843 Unclassified 1463
113 Ga0081540_1000396 3300005983 Bacteria 43174
114 Ga0081540_1000454 3300005983 Bacteria 40672
115 Ga0070716_100019183 3300006173 Unclassified 3572
116 Ga0070716_100133900 3300006173 Bacteria 1571
117 Ga0070716_100438857 3300006173 Unclassified 949
118 Ga0097621_100094038 3300006237 Bacteria 2513
119 Ga0068871_100102289 3300006358 Bacteria 2401
120 Ga0075428_100039902 3300006844 Bacteria 5167
121 Ga0075428_102022989 3300006844 Unclassified 597
122 Ga0075428_102025075 3300006844 Unclassified 596
123 Ga0075431_100493000 3300006847 Bacteria 1217
124 Ga0075431_100582935 3300006847 Bacteria 1104
125 Ga0075431_100874594 3300006847 Bacteria 869
126 Ga0075433_10093488 3300006852 Bacteria 2660
127 Ga0075433_10108470 3300006852 Bacteria 2462
128 Ga0075433_11213855 3300006852 Bacteria 654
129 Ga0075434_100006895 3300006871 Bacteria 10464
130 Ga0075434_100597802 3300006871 Bacteria 1122
131 Ga0075434_101078540 3300006871 Bacteria 817
132 Ga0068865_100002374 3300006881 Bacteria 11096
133 Ga0068865_100725610 3300006881 Bacteria 851
134 Ga0068865_101185791 3300006881 Bacteria 675
135 Ga0075436_100000059 3300006914 Bacteria 65361
136 Ga0075436_100034914 3300006914 Bacteria 3469
137 Ga0075436_100525465 3300006914 Unclassified 867
138 Ga0075436_101121629 3300006914 Bacteria 592
139 Ga0097620_100000008 3300006931 Bacteria 383750
140 Ga0097620_100002831 3300006931 Bacteria 17596
141 Ga0097620_100005328 3300006931 Bacteria 13082
142 Ga0075435_100005252 3300007076 Bacteria 9016
143 Ga0075435_101363064 3300007076 Bacteria 621
144 Ga0111539_10006951 3300009094 Bacteria 14525
145 Ga0111539_11737811 3300009094 Unclassified 723
146 Ga0105247_10106300 3300009101 Bacteria 1800
147 Ga0114129_10017906 3300009147 Bacteria 10084
148 Ga0114129_10020219 3300009147 Bacteria 9473
149 Ga0114129_10047146 3300009147 Bacteria 6057
150 Ga0114129_11219609 3300009147 Unclassified 936
151 Ga0114129_11378459 3300009147 Unclassified 871
152 Ga0114129_11544078 3300009147 Unclassified 814
153 Ga0114129_12066378 3300009147 Bacteria 688
154 Ga0114129_12292695 3300009147 Viruses 648
155 Ga0105243_10660272 3300009148 Unclassified 1014
156 Ga0105241_10796186 3300009174 Unclassified 870
157 Ga0105242_10120353 3300009176 Bacteria 2252
158 Ga0105248_10016816 3300009177 Bacteria 8051
159 Ga0105248_10343591 3300009177 Bacteria 1680
160 Ga0099796_10018424 3300010159 Unclassified 2096
161 Ga0157373_10219713 3300013100 Bacteria 1340
162 Ga0157378_10002910 3300013297 Bacteria 15233
163 Ga0157375_10000351 3300013308 Bacteria 41691
164 Ga0157375_10090623 3300013308 Unclassified 3117
165 Ga0157375_11976709 3300013308 Unclassified 693
166 Ga0163163_10387366 3300014325 Bacteria 1455
167 Ga0157380_10158760 3300014326 Unclassified 1963
168 Ga0157377_10024786 3300014745 Plasmid 3192
169 Ga0157379_10003272 3300014968 Bacteria 13720
170 Ga0157379_10174039 3300014968 Unclassified 1943
171 Ga0157376_10004421 3300014969 Bacteria 9790
172 Ga0157376_10010627 3300014969 Bacteria 6741
173 Ga0157376_10627599 3300014969 Unclassified 1072
174 Ga0207692_10178096 3300025898 Bacteria 1237
175 Ga0207710_10147696 3300025900 Unclassified 1139
176 Ga0207680_10000711 3300025903 Bacteria 15614
177 Ga0207699_10000065 3300025906 Bacteria 85512
178 Ga0207699_10750672 3300025906 Unclassified 716
179 Ga0207684_10021094 3300025910 Bacteria 5563
180 Ga0207684_10102429 3300025910 Unclassified 2448
181 Ga0207684_10108684 3300025910 Bacteria 2373
182 Ga0207684_10133686 3300025910 Bacteria 2129
183 Ga0207684_10145669 3300025910 Bacteria 2037
184 Ga0207684_10599139 3300025910 Bacteria 941
185 Ga0207684_11263504 3300025910 Unclassified 609
186 Ga0207684_11480572 3300025910 Unclassified 553
187 Ga0207654_10541188 3300025911 Unclassified 826
188 Ga0207660_10271389 3300025917 Unclassified 1344
189 Ga0207662_10094188 3300025918 Bacteria 1847
190 Ga0207649_10136021 3300025920 Bacteria 1675
191 Ga0207646_10011284 3300025922 Bacteria 8677
192 Ga0207646_10146963 3300025922 Unclassified 2124
193 Ga0207646_10149985 3300025922 Bacteria 2102
194 Ga0207646_10229935 3300025922 Bacteria 1675
195 Ga0207646_10283540 3300025922 Bacteria 1497
196 Ga0207700_11525364 3300025928 Bacteria 592
197 Ga0207644_10288651 3300025931 Bacteria 1319
198 Ga0207709_10506061 3300025935 Unclassified 943
199 Ga0207670_10009473 3300025936 Bacteria 5558
200 Ga0207670_10025316 3300025936 Bacteria 3723
201 Ga0207704_10005879 3300025938 Bacteria 5680
202 Ga0207691_10002450 3300025940 Bacteria 18143
203 Ga0207691_10034436 3300025940 Bacteria 4709
204 Ga0207711_10080898 3300025941 Bacteria 2838
205 Ga0207711_10238933 3300025941 Bacteria 1665
206 Ga0207661_11319458 3300025944 Unclassified 663
207 Ga0207651_10012037 3300025960 Bacteria 4873
208 Ga0207658_10010739 3300025986 Bacteria 6226
209 Ga0207658_10103912 3300025986 Unclassified 2231
210 Ga0207677_11548632 3300026023 Bacteria 613
211 Ga0207703_10013181 3300026035 Bacteria 6440
212 Ga0207678_10004342 3300026067 Bacteria 12728
213 Ga0207702_10054466 3300026078 Bacteria 3390
214 Ga0207641_10087824 3300026088 Bacteria 2713
215 Ga0207641_10139085 3300026088 Bacteria 2188
216 Ga0207641_10319418 3300026088 Unclassified 1472
217 Ga0207641_10366306 3300026088 Unclassified 1377
218 Ga0207641_10500988 3300026088 Unclassified 1179
219 Ga0207648_10006975 3300026089 Bacteria 11178
220 Ga0207648_11520780 3300026089 Unclassified 629
221 Ga0207676_10021773 3300026095 Bacteria 4706
222 Ga0207674_10044071 3300026116 Bacteria 4598
223 Ga0207428_10032026 3300027907 Bacteria 4329
224 Ga0268266_10009737 3300028379 Bacteria 8450
225 Ga0268264_10001503 3300028381 Bacteria 21734
226 Ga0268264_10896549 3300028381 Bacteria 890
227 Ga0265318_10029006 3300028577 Bacteria 2160
228 Ga0265325_10158728 3300031241 Bacteria 1065
229 Ga0265339_10097146 3300031249 Unclassified 1537
230 Ga0307408_100333915 3300031548 Bacteria 1281
231 Ga0307508_10143572 3300031616 Bacteria 1991
232 Ga0307410_10005636 3300031852 Bacteria 6656
233 Ga0307406_10186676 3300031901 Bacteria 1514
234 Ga0307407_10082130 3300031903 Bacteria 1952
235 Ga0307412_10046197 3300031911 Bacteria 2852
236 Ga0307412_10866063 3300031911 Bacteria 789
237 Ga0307409_100352461 3300031995 Bacteria 1389
238 Ga0307416_100006882 3300032002 Bacteria 7159
239 Ga0307416_100026616 3300032002 Bacteria 4265
240 Ga0307416_100501719 3300032002 Bacteria 1278
241 Ga0307414_10161959 3300032004 Bacteria 1778
242 Ga0307411_10071391 3300032005 Bacteria 2353
243 Ga0307415_100266146 3300032126 Bacteria 1402
244 Ga0373931_0078741 3300035691 Bacteria 1814
245 Ga0373935_0010412 3300035692 Bacteria 5575
246 Ga0373927_0081768 3300035695 Unclassified 2093
247 Ga0373933_0856959 3300035724 Bacteria 598
248 Ga0373937_0006880 3300036401 Bacteria 9815
249 Ga0373937_0125677 3300036401 Bacteria 2392
250 Ga0373937_0612220 3300036401 Unclassified 1034
251 Ga0373937_1130392 3300036401 Bacteria 732
252 Ga0373925_0062020 3300037068 Bacteria 2810
253 Ga0373925_0997404 3300037068 Bacteria 690
254 Ga0439450_035353 3300042008 Bacteria 1140
255 Ga0439444_0072974 3300042437 Bacteria 738
256 Ga0453683_0055521 3300044673 Bacteria 2479
257 Ga0453683_0151118 3300044673 Bacteria 1467
258 Ga0453683_0235799 3300044673 Unclassified 1165
259 Ga0451576_0217163 3300045051 Bacteria 1997
260 Ga0451576_0461223 3300045051 Unclassified 1334
261 Ga0466967_2304397 3300045976 Unclassified 534
262 Ga0495651_0578393 3300046462 Unclassified 711
263 Ga0495580_0112552 3300046472 Bacteria 1890
264 Ga0495580_0122021 3300046472 Bacteria 1809
265 Ga0495582_0062388 3300046473 Unclassified 2059
266 Ga0495658_0011186 3300046683 Bacteria 4505
267 Ga0495636_0196768 3300047318 Bacteria 919
268 Ga0495615_0011546 3300048090 Bacteria 1798
269 Ga0496100_0168374 3300048903 Unclassified 1576
270 Ga0496102_0002239 3300048905 Bacteria 16588
271 Ga0496103_0005032 3300048906 Bacteria 7971
272 Ga0496104_0204556 3300048907 Bacteria 1886
273 Ga0496104_1646774 3300048907 Unclassified 544
274 Ga0496104_1718432 3300048907 Bacteria 530
275 Ga0496105_0310586 3300048908 Unclassified 1266
276 Ga0496106_0006552 3300048909 Bacteria 8623
277 Ga0496107_0004879 3300048910 Bacteria 9113
278 Ga0496108_0003756 3300048911 Bacteria 12169
279 Ga0496109_0058863 3300048912 Bacteria 3510
280 Ga0496110_0046132 3300048913 Bacteria 3812
281 Ga0496111_0039796 3300048914 Unclassified 3372
282 Ga0496111_0080007 3300048914 Unclassified 2384
283 Ga0496111_0106183 3300048914 Unclassified 2067
284 Ga0496112_0028412 3300048915 Bacteria 5398
285 Ga0496114_0000137 3300048917 Bacteria 53099
286 Ga0496115_0100740 3300048918 Bacteria 2368
287 Ga0501038_0342493 3300049574 Bacteria 1166
288 Ga0501069_0113329 3300049585 Bacteria 1546
289 Ga0501233_035109 3300049668 Bacteria 1154
290 nmdc:mga05p37_1659412_c1 3300050507 Unclassified 626
291 nmdc:mga05p37_7896_c1 3300050507 Bacteria 12560
292 nmdc:mga0qj67_489294_c1 3300050509 Bacteria 989
293 nmdc:mga06r32_605265_c1 3300050510 Bacteria 1066
294 nmdc:mga08y16_1369454_c1 3300050511 Unclassified 672
295 nmdc:mga08y16_32842_c1 3300050511 Bacteria 5456
296 nmdc:mga0n895_1022126_c1 3300050512 Bacteria 807
297 nmdc:mga0n895_1042994_c1 3300050512 Bacteria 797
298 nmdc:mga0n895_1767297_c1 3300050512 Bacteria 580
299 nmdc:mga0n895_75769_c1 3300050512 Bacteria 3344
300 nmdc:mga0n895_87649_c1 3300050512 Bacteria 3111
301 nmdc:mga0rr50_34478_c1 3300050513 Bacteria 3625
302 nmdc:mga0rr50_796341_c1 3300050513 Unclassified 806
303 nmdc:mga08x19_1037553_c1 3300050514 Unclassified 582
304 nmdc:mga08x19_15020_c1 3300050514 Bacteria 4703
305 nmdc:mga08x19_91198_c1 3300050514 Bacteria 2011

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_11480572 Ga0207684_114805721 118
2 3300050512 nmdc:mga0n895_1042994_c1 nmdc:mga0n895_1042994_c1_373_762 124
3 3300006847 Ga0075431_100874594 Ga0075431_1008745941 131
4 3300005471 Ga0070698_100774383 Ga0070698_1007743832 139
5 3300050507 nmdc:mga05p37_7896_c1 nmdc:mga05p37_7896_c1_8994_9428 139
6 3300003323 rootH1_10089349 rootH1_100893492 140
7 3300005355 Ga0070671_100054552 Ga0070671_1000545523 140
8 3300005445 Ga0070708_100024721 Ga0070708_1000247215 140
9 3300006881 Ga0068865_100725610 Ga0068865_1007256102 140
10 3300014969 Ga0157376_10010627 Ga0157376_100106272 140
11 3300003659 JGI25404J52841_10000179 JGI25404J52841_100001797 141
12 3300005289 Ga0065704_10003535 Ga0065704_100035353 141
13 3300005295 Ga0065707_10002348 Ga0065707_100023487 141
14 3300005328 Ga0070676_11325747 Ga0070676_113257471 141
15 3300005329 Ga0070683_100035088 Ga0070683_1000350884 141
16 3300005329 Ga0070683_100944776 Ga0070683_1009447762 141
17 3300005334 Ga0068869_100032622 Ga0068869_1000326223 141
18 3300005334 Ga0068869_100150931 Ga0068869_1001509311 141
19 3300005338 Ga0068868_101300805 Ga0068868_1013008051 141
20 3300005340 Ga0070689_100009714 Ga0070689_1000097144 141
21 3300005340 Ga0070689_100026261 Ga0070689_1000262612 141
22 3300005343 Ga0070687_100224595 Ga0070687_1002245952 141
23 3300005343 Ga0070687_100401684 Ga0070687_1004016841 141
24 3300005344 Ga0070661_100007735 Ga0070661_1000077352 141
25 3300005354 Ga0070675_100000454 Ga0070675_10000045412 141
26 3300005355 Ga0070671_100742409 Ga0070671_1007424092 141
27 3300005364 Ga0070673_100537757 Ga0070673_1005377572 141
28 3300005367 Ga0070667_100276720 Ga0070667_1002767201 141
29 3300005445 Ga0070708_100905628 Ga0070708_1009056281 141
30 3300005459 Ga0068867_100447081 Ga0068867_1004470812 141
31 3300005518 Ga0070699_100913531 Ga0070699_1009135311 141
32 3300005543 Ga0070672_100160054 Ga0070672_1001600544 141
33 3300005543 Ga0070672_100360540 Ga0070672_1003605402 141
34 3300005544 Ga0070686_100071990 Ga0070686_1000719904 141
35 3300005549 Ga0070704_100991613 Ga0070704_1009916132 141
36 3300005564 Ga0070664_100008853 Ga0070664_1000088532 141
37 3300005577 Ga0068857_100010272 Ga0068857_1000102725 141
38 3300005614 Ga0068856_100179376 Ga0068856_1001793764 141
39 3300005615 Ga0070702_100137674 Ga0070702_1001376742 141
40 3300005617 Ga0068859_100002831 Ga0068859_1000028318 141
41 3300005618 Ga0068864_100040933 Ga0068864_1000409332 141
42 3300005618 Ga0068864_100137191 Ga0068864_1001371913 141
43 3300005841 Ga0068863_100102025 Ga0068863_1001020253 141
44 3300005842 Ga0068858_100049974 Ga0068858_1000499744 141
45 3300005983 Ga0081540_1000396 Ga0081540_10003969 141
46 3300005983 Ga0081540_1000454 Ga0081540_100045421 141
47 3300006871 Ga0075434_100597802 Ga0075434_1005978022 141
48 3300006931 Ga0097620_100002831 Ga0097620_1000028314 141
49 3300009094 Ga0111539_10006951 Ga0111539_100069519 141
50 3300009174 Ga0105241_10796186 Ga0105241_107961862 141
51 3300009177 Ga0105248_10343591 Ga0105248_103435913 141
52 3300013308 Ga0157375_10090623 Ga0157375_100906233 141
53 3300013308 Ga0157375_11976709 Ga0157375_119767091 141
54 3300014745 Ga0157377_10024786 Ga0157377_100247863 141
55 3300014968 Ga0157379_10174039 Ga0157379_101740394 141
56 3300025911 Ga0207654_10541188 Ga0207654_105411882 141
57 3300025917 Ga0207660_10271389 Ga0207660_102713892 141
58 3300025918 Ga0207662_10094188 Ga0207662_100941883 141
59 3300025920 Ga0207649_10136021 Ga0207649_101360211 141
60 3300025931 Ga0207644_10288651 Ga0207644_102886513 141
61 3300025936 Ga0207670_10025316 Ga0207670_100253163 141
62 3300025940 Ga0207691_10034436 Ga0207691_100344364 141
63 3300025941 Ga0207711_10238933 Ga0207711_102389333 141
64 3300025944 Ga0207661_11319458 Ga0207661_113194581 141
65 3300026023 Ga0207677_11548632 Ga0207677_115486321 141
66 3300026088 Ga0207641_10319418 Ga0207641_103194183 141
67 3300026088 Ga0207641_10500988 Ga0207641_105009882 141
68 3300026116 Ga0207674_10044071 Ga0207674_100440714 141
69 3300027907 Ga0207428_10032026 Ga0207428_100320263 141
70 3300031616 Ga0307508_10143572 Ga0307508_101435722 141
71 3300031852 Ga0307410_10005636 Ga0307410_100056363 141
72 3300031903 Ga0307407_10082130 Ga0307407_100821302 141
73 3300031911 Ga0307412_10866063 Ga0307412_108660632 141
74 3300031995 Ga0307409_100352461 Ga0307409_1003524612 141
75 3300032002 Ga0307416_100501719 Ga0307416_1005017192 141
76 3300032004 Ga0307414_10161959 Ga0307414_101619592 141
77 3300032005 Ga0307411_10071391 Ga0307411_100713912 141
78 3300035691 Ga0373931_0078741 Ga0373931_0078741_1112_1543 141
79 3300035692 Ga0373935_0010412 Ga0373935_0010412_3810_4235 141
80 3300036401 Ga0373937_0612220 Ga0373937_0612220_541_978 141
81 3300037068 Ga0373925_0997404 Ga0373925_0997404_117_554 141
82 3300042008 Ga0439450_035353 Ga0439450_035353_581_1018 141
83 3300045051 Ga0451576_0217163 Ga0451576_0217163_926_1363 141
84 3300045051 Ga0451576_0461223 Ga0451576_0461223_622_1059 141
85 3300046472 Ga0495580_0122021 Ga0495580_0122021_676_1113 141
86 3300046683 Ga0495658_0011186 Ga0495658_0011186_3201_3638 141
87 3300048907 Ga0496104_1718432 Ga0496104_1718432_38_463 141
88 3300048917 Ga0496114_0000137 Ga0496114_0000137_1834_2259 141
89 3300050511 nmdc:mga08y16_32842_c1 nmdc:mga08y16_32842_c1_1681_2115 141
90 3300050512 nmdc:mga0n895_1767297_c1 nmdc:mga0n895_1767297_c1_120_557 141
91 3300002076 JGI24749J21850_1018909 JGI24749J21850_10189092 142
92 3300003316 rootH1_10009429 rootH1_100094294 142
93 3300003322 rootL2_10282619 rootL2_102826192 142
94 3300005295 Ga0065707_10402365 Ga0065707_104023652 142
95 3300005330 Ga0070690_100000422 Ga0070690_10000042213 142
96 3300005335 Ga0070666_10003091 Ga0070666_100030915 142
97 3300005340 Ga0070689_100007513 Ga0070689_1000075131 142
98 3300005343 Ga0070687_100420725 Ga0070687_1004207252 142
99 3300005356 Ga0070674_100020416 Ga0070674_1000204163 142
100 3300005364 Ga0070673_100166956 Ga0070673_1001669563 142
101 3300005365 Ga0070688_100060633 Ga0070688_1000606331 142
102 3300005367 Ga0070667_100003766 Ga0070667_10000376614 142
103 3300005367 Ga0070667_100105946 Ga0070667_1001059462 142
104 3300005434 Ga0070709_10000058 Ga0070709_1000005813 142
105 3300005436 Ga0070713_101436371 Ga0070713_1014363711 142
106 3300005437 Ga0070710_10049717 Ga0070710_100497172 142
107 3300005438 Ga0070701_10007123 Ga0070701_100071232 142
108 3300005440 Ga0070705_100009025 Ga0070705_1000090252 142
109 3300005445 Ga0070708_100017048 Ga0070708_1000170482 142
110 3300005445 Ga0070708_100134924 Ga0070708_1001349243 142
111 3300005445 Ga0070708_100297055 Ga0070708_1002970552 142
112 3300005445 Ga0070708_100607131 Ga0070708_1006071312 142
113 3300005445 Ga0070708_100738303 Ga0070708_1007383032 142
114 3300005455 Ga0070663_100001221 Ga0070663_1000012218 142
115 3300005459 Ga0068867_100041262 Ga0068867_1000412623 142
116 3300005467 Ga0070706_100003954 Ga0070706_1000039546 142
117 3300005467 Ga0070706_100050153 Ga0070706_1000501531 142
118 3300005467 Ga0070706_100074185 Ga0070706_1000741853 142
119 3300005467 Ga0070706_100174254 Ga0070706_1001742543 142
120 3300005467 Ga0070706_100236849 Ga0070706_1002368492 142
121 3300005467 Ga0070706_100257060 Ga0070706_1002570602 142
122 3300005467 Ga0070706_100416940 Ga0070706_1004169402 142
123 3300005468 Ga0070707_100006209 Ga0070707_10000620910 142
124 3300005468 Ga0070707_100027249 Ga0070707_1000272494 142
125 3300005468 Ga0070707_100371909 Ga0070707_1003719092 142
126 3300005468 Ga0070707_100631492 Ga0070707_1006314921 142
127 3300005471 Ga0070698_100037075 Ga0070698_1000370752 142
128 3300005471 Ga0070698_100081375 Ga0070698_1000813753 142
129 3300005471 Ga0070698_100123624 Ga0070698_1001236242 142
130 3300005471 Ga0070698_100131840 Ga0070698_1001318403 142
131 3300005471 Ga0070698_100174597 Ga0070698_1001745973 142
132 3300005471 Ga0070698_100389301 Ga0070698_1003893012 142
133 3300005518 Ga0070699_100013714 Ga0070699_1000137147 142
134 3300005518 Ga0070699_100052857 Ga0070699_1000528571 142
135 3300005518 Ga0070699_100304066 Ga0070699_1003040662 142
136 3300005518 Ga0070699_100460697 Ga0070699_1004606971 142
137 3300005518 Ga0070699_100565205 Ga0070699_1005652052 142
138 3300005518 Ga0070699_100654006 Ga0070699_1006540062 142
139 3300005518 Ga0070699_101077383 Ga0070699_1010773831 142
140 3300005536 Ga0070697_100001229 Ga0070697_10000122911 142
141 3300005536 Ga0070697_100022807 Ga0070697_1000228071 142
142 3300005536 Ga0070697_100187192 Ga0070697_1001871923 142
143 3300005536 Ga0070697_100854893 Ga0070697_1008548932 142
144 3300005536 Ga0070697_100953223 Ga0070697_1009532232 142
145 3300005543 Ga0070672_100087238 Ga0070672_1000872382 142
146 3300005544 Ga0070686_100216076 Ga0070686_1002160762 142
147 3300005544 Ga0070686_100231248 Ga0070686_1002312482 142
148 3300005546 Ga0070696_100895271 Ga0070696_1008952711 142
149 3300005548 Ga0070665_100016810 Ga0070665_1000168107 142
150 3300005549 Ga0070704_100020192 Ga0070704_1000201923 142
151 3300005549 Ga0070704_100133475 Ga0070704_1001334754 142
152 3300005564 Ga0070664_100677201 Ga0070664_1006772012 142
153 3300005614 Ga0068856_100001489 Ga0068856_1000014897 142
154 3300005617 Ga0068859_100000008 Ga0068859_100000008241 142
155 3300005617 Ga0068859_100005328 Ga0068859_1000053287 142
156 3300005618 Ga0068864_100082215 Ga0068864_1000822154 142
157 3300005718 Ga0068866_10035116 Ga0068866_100351162 142
158 3300005841 Ga0068863_100059491 Ga0068863_1000594912 142
159 3300005841 Ga0068863_100215707 Ga0068863_1002157072 142
160 3300005841 Ga0068863_100315926 Ga0068863_1003159262 142
161 3300005842 Ga0068858_100001323 Ga0068858_1000013239 142
162 3300005842 Ga0068858_100097596 Ga0068858_1000975962 142
163 3300005843 Ga0068860_100010880 Ga0068860_1000108804 142
164 3300005843 Ga0068860_100345700 Ga0068860_1003457002 142
165 3300006173 Ga0070716_100019183 Ga0070716_1000191833 142
166 3300006173 Ga0070716_100133900 Ga0070716_1001339002 142
167 3300006173 Ga0070716_100438857 Ga0070716_1004388573 142
168 3300006237 Ga0097621_100094038 Ga0097621_1000940383 142
169 3300006358 Ga0068871_100102289 Ga0068871_1001022893 142
170 3300006844 Ga0075428_100039902 Ga0075428_1000399025 142
171 3300006844 Ga0075428_102022989 Ga0075428_1020229891 142
172 3300006844 Ga0075428_102025075 Ga0075428_1020250752 142
173 3300006847 Ga0075431_100493000 Ga0075431_1004930002 142
174 3300006847 Ga0075431_100582935 Ga0075431_1005829352 142
175 3300006852 Ga0075433_10093488 Ga0075433_100934883 142
176 3300006852 Ga0075433_10108470 Ga0075433_101084702 142
177 3300006852 Ga0075433_11213855 Ga0075433_112138552 142
178 3300006871 Ga0075434_100006895 Ga0075434_10000689512 142
179 3300006871 Ga0075434_101078540 Ga0075434_1010785402 142
180 3300006881 Ga0068865_100002374 Ga0068865_1000023748 142
181 3300006881 Ga0068865_101185791 Ga0068865_1011857912 142
182 3300006914 Ga0075436_100000059 Ga0075436_10000005949 142
183 3300006914 Ga0075436_100034914 Ga0075436_1000349142 142
184 3300006914 Ga0075436_100525465 Ga0075436_1005254652 142
185 3300006914 Ga0075436_101121629 Ga0075436_1011216292 142
186 3300006931 Ga0097620_100000008 Ga0097620_100000008241 142
187 3300006931 Ga0097620_100005328 Ga0097620_1000053287 142
188 3300007076 Ga0075435_100005252 Ga0075435_1000052522 142
189 3300007076 Ga0075435_101363064 Ga0075435_1013630641 142
190 3300009094 Ga0111539_11737811 Ga0111539_117378112 142
191 3300009101 Ga0105247_10106300 Ga0105247_101063002 142
192 3300009147 Ga0114129_10017906 Ga0114129_1001790612 142
193 3300009147 Ga0114129_10020219 Ga0114129_100202193 142
194 3300009147 Ga0114129_10047146 Ga0114129_100471464 142
195 3300009147 Ga0114129_11219609 Ga0114129_112196092 142
196 3300009147 Ga0114129_11378459 Ga0114129_113784591 142
197 3300009147 Ga0114129_11544078 Ga0114129_115440781 142
198 3300009147 Ga0114129_12066378 Ga0114129_120663781 142
199 3300009147 Ga0114129_12292695 Ga0114129_122926951 142
200 3300009148 Ga0105243_10660272 Ga0105243_106602721 142
201 3300009176 Ga0105242_10120353 Ga0105242_101203532 142
202 3300009177 Ga0105248_10016816 Ga0105248_100168164 142
203 3300010159 Ga0099796_10018424 Ga0099796_100184242 142
204 3300013100 Ga0157373_10219713 Ga0157373_102197131 142
205 3300013297 Ga0157378_10002910 Ga0157378_1000291015 142
206 3300013308 Ga0157375_10000351 Ga0157375_1000035124 142
207 3300014325 Ga0163163_10387366 Ga0163163_103873662 142
208 3300014326 Ga0157380_10158760 Ga0157380_101587604 142
209 3300014968 Ga0157379_10003272 Ga0157379_100032727 142
210 3300014969 Ga0157376_10004421 Ga0157376_100044215 142
211 3300014969 Ga0157376_10627599 Ga0157376_106275992 142
212 3300025898 Ga0207692_10178096 Ga0207692_101780961 142
213 3300025900 Ga0207710_10147696 Ga0207710_101476962 142
214 3300025903 Ga0207680_10000711 Ga0207680_100007115 142
215 3300025906 Ga0207699_10000065 Ga0207699_1000006558 142
216 3300025906 Ga0207699_10750672 Ga0207699_107506722 142
217 3300025910 Ga0207684_10021094 Ga0207684_100210942 142
218 3300025910 Ga0207684_10102429 Ga0207684_101024292 142
219 3300025910 Ga0207684_10108684 Ga0207684_101086842 142
220 3300025910 Ga0207684_10133686 Ga0207684_101336863 142
221 3300025910 Ga0207684_10145669 Ga0207684_101456693 142
222 3300025910 Ga0207684_10599139 Ga0207684_105991392 142
223 3300025910 Ga0207684_11263504 Ga0207684_112635042 142
224 3300025922 Ga0207646_10011284 Ga0207646_100112848 142
225 3300025922 Ga0207646_10146963 Ga0207646_101469632 142
226 3300025922 Ga0207646_10149985 Ga0207646_101499852 142
227 3300025922 Ga0207646_10229935 Ga0207646_102299352 142
228 3300025922 Ga0207646_10283540 Ga0207646_102835402 142
229 3300025928 Ga0207700_11525364 Ga0207700_115253641 142
230 3300025935 Ga0207709_10506061 Ga0207709_105060611 142
231 3300025936 Ga0207670_10009473 Ga0207670_100094735 142
232 3300025938 Ga0207704_10005879 Ga0207704_100058795 142
233 3300025940 Ga0207691_10002450 Ga0207691_1000245016 142
234 3300025941 Ga0207711_10080898 Ga0207711_100808983 142
235 3300025960 Ga0207651_10012037 Ga0207651_100120375 142
236 3300025986 Ga0207658_10010739 Ga0207658_100107395 142
237 3300025986 Ga0207658_10103912 Ga0207658_101039122 142
238 3300026035 Ga0207703_10013181 Ga0207703_100131813 142
239 3300026067 Ga0207678_10004342 Ga0207678_100043426 142
240 3300026078 Ga0207702_10054466 Ga0207702_100544663 142
241 3300026088 Ga0207641_10087824 Ga0207641_100878243 142
242 3300026088 Ga0207641_10139085 Ga0207641_101390852 142
243 3300026088 Ga0207641_10366306 Ga0207641_103663062 142
244 3300026089 Ga0207648_10006975 Ga0207648_100069758 142
245 3300026089 Ga0207648_11520780 Ga0207648_115207802 142
246 3300026095 Ga0207676_10021773 Ga0207676_100217733 142
247 3300028379 Ga0268266_10009737 Ga0268266_100097378 142
248 3300028381 Ga0268264_10001503 Ga0268264_1000150314 142
249 3300028381 Ga0268264_10896549 Ga0268264_108965492 142
250 3300028577 Ga0265318_10029006 Ga0265318_100290062 142
251 3300031241 Ga0265325_10158728 Ga0265325_101587282 142
252 3300031249 Ga0265339_10097146 Ga0265339_100971463 142
253 3300031548 Ga0307408_100333915 Ga0307408_1003339152 142
254 3300031901 Ga0307406_10186676 Ga0307406_101866762 142
255 3300031911 Ga0307412_10046197 Ga0307412_100461973 142
256 3300032002 Ga0307416_100006882 Ga0307416_1000068822 142
257 3300032002 Ga0307416_100026616 Ga0307416_1000266163 142
258 3300032126 Ga0307415_100266146 Ga0307415_1002661462 142
259 3300035695 Ga0373927_0081768 Ga0373927_0081768_1415_1849 142
260 3300035724 Ga0373933_0856959 Ga0373933_0856959_34_468 142
261 3300036401 Ga0373937_0006880 Ga0373937_0006880_8711_9160 142
262 3300036401 Ga0373937_0125677 Ga0373937_0125677_618_1085 142
263 3300036401 Ga0373937_1130392 Ga0373937_1130392_125_568 142
264 3300037068 Ga0373925_0062020 Ga0373925_0062020_2271_2705 142
265 3300042437 Ga0439444_0072974 Ga0439444_0072974_57_497 142
266 3300044673 Ga0453683_0055521 Ga0453683_0055521_224_655 142
267 3300044673 Ga0453683_0151118 Ga0453683_0151118_993_1427 142
268 3300044673 Ga0453683_0235799 Ga0453683_0235799_661_1092 142
269 3300045976 Ga0466967_2304397 Ga0466967_2304397_43_501 142
270 3300046462 Ga0495651_0578393 Ga0495651_0578393_105_536 142
271 3300046472 Ga0495580_0112552 Ga0495580_0112552_413_850 142
272 3300046473 Ga0495582_0062388 Ga0495582_0062388_51_494 142
273 3300047318 Ga0495636_0196768 Ga0495636_0196768_341_778 142
274 3300048090 Ga0495615_0011546 Ga0495615_0011546_328_768 142
275 3300048903 Ga0496100_0168374 Ga0496100_0168374_590_1018 142
276 3300048905 Ga0496102_0002239 Ga0496102_0002239_10692_11120 142
277 3300048906 Ga0496103_0005032 Ga0496103_0005032_52_480 142
278 3300048907 Ga0496104_0204556 Ga0496104_0204556_1054_1575 142
279 3300048907 Ga0496104_1646774 Ga0496104_1646774_39_467 142
280 3300048908 Ga0496105_0310586 Ga0496105_0310586_475_903 142
281 3300048909 Ga0496106_0006552 Ga0496106_0006552_7492_7920 142
282 3300048910 Ga0496107_0004879 Ga0496107_0004879_4994_5422 142
283 3300048911 Ga0496108_0003756 Ga0496108_0003756_3568_4089 142
284 3300048912 Ga0496109_0058863 Ga0496109_0058863_1790_2218 142
285 3300048913 Ga0496110_0046132 Ga0496110_0046132_1113_1541 142
286 3300048914 Ga0496111_0039796 Ga0496111_0039796_1903_2424 142
287 3300048914 Ga0496111_0080007 Ga0496111_0080007_646_1074 142
288 3300048914 Ga0496111_0106183 Ga0496111_0106183_734_1165 142
289 3300048915 Ga0496112_0028412 Ga0496112_0028412_2669_3190 142
290 3300048918 Ga0496115_0100740 Ga0496115_0100740_462_890 142
291 3300049574 Ga0501038_0342493 Ga0501038_0342493_179_670 142
292 3300049585 Ga0501069_0113329 Ga0501069_0113329_891_1397 142
293 3300049668 Ga0501233_035109 Ga0501233_035109_151_600 142
294 3300050507 nmdc:mga05p37_1659412_c1 nmdc:mga05p37_1659412_c1_77_523 142
295 3300050509 nmdc:mga0qj67_489294_c1 nmdc:mga0qj67_489294_c1_489_929 142
296 3300050510 nmdc:mga06r32_605265_c1 nmdc:mga06r32_605265_c1_72_512 142
297 3300050511 nmdc:mga08y16_1369454_c1 nmdc:mga08y16_1369454_c1_211_657 142
298 3300050512 nmdc:mga0n895_1022126_c1 nmdc:mga0n895_1022126_c1_127_561 142
299 3300050512 nmdc:mga0n895_75769_c1 nmdc:mga0n895_75769_c1_1423_1869 142
300 3300050512 nmdc:mga0n895_87649_c1 nmdc:mga0n895_87649_c1_588_1031 142
301 3300050513 nmdc:mga0rr50_34478_c1 nmdc:mga0rr50_34478_c1_2462_2905 142
302 3300050513 nmdc:mga0rr50_796341_c1 nmdc:mga0rr50_796341_c1_161_592 142
303 3300050514 nmdc:mga08x19_1037553_c1 nmdc:mga08x19_1037553_c1_16_459 142
304 3300050514 nmdc:mga08x19_15020_c1 nmdc:mga08x19_15020_c1_3589_4041 142
305 3300050514 nmdc:mga08x19_91198_c1 nmdc:mga08x19_91198_c1_633_1079 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09828

ChrB_C

ChrB, C-terminal domain

3

124

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hy5-assembly1.cif.gz_A structure of d-amino acid oxidase mutant r38h 0.695 1 33
1ib6-assembly1.cif.gz_B crystal structure of r153c e. coli malate dehydrogenase 0.6337 1 32
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.6331 1 48
3uki-assembly2.cif.gz_D crystal structure of reduced oxyr from porphyromonas gingivalis 0.6221 1 48
3onm-assembly1.cif.gz_B effector binding domain of lysr-type transcription factor rovm from y. pseudotuberculosis 0.6194 1 49
ID Description Score Start End Superfamily
3b8bA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.7114 1 48 3.40.190.80
af_Q76KC5_1_143_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6339 1 50 3.40.50.2300
af_Q2FV83_76_274_3.40.190.290 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.6232 1 49 3.40.190.290
3onmB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6194 1 49 3.40.190.10
2v25B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6169 1 48 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A838PGD4-F1-model_v4 Chromate resistance protein 0.9955 1 94
AF-A0A317HYA3-F1-model_v4 Chromate resistance protein 0.9952 1 73
AF-A0A534T345-F1-model_v4 Chromate resistance protein 0.995 2 141
AF-A0A534QE41-F1-model_v4 Chromate resistance protein 0.9949 1 141
AF-A0A535A594-F1-model_v4 Chromate resistance protein 0.9912 1 141

Feature Viewer

pLDDT pTM Quality
96.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map