F398303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 164 | 305 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0204556|Ga0496104_0204556_1054_1575 |
| Length | 173 |
| Sequence | MLWVTRAHIRVNRAATGWLIRRFIDPRASFRFVEPDQVVRIQRDCHGIGFDAPGARYPHKDEIGRCSFEVLVAEYRPHDTALRMLAGIVHRADFPEELAWRNPRTLAWQFDVLSQGAPESSAVSLDDAPGLRSISRGFPLVAADDHETLERCAFLYDSLYASLREQLGYAAQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 131 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 132 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 143 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 144 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 145 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 154 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 155 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 158 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.9 |
| Rhizosphere | 92.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1018909 | 3300002076 | Unclassified | 973 |
| 2 | rootH1_10009429 | 3300003316 | Bacteria | 4595 |
| 3 | rootL2_10282619 | 3300003322 | Bacteria | 4625 |
| 4 | rootH1_10089349 | 3300003323 | Bacteria | 2151 |
| 5 | JGI25404J52841_10000179 | 3300003659 | Bacteria | 7349 |
| 6 | Ga0065704_10003535 | 3300005289 | Bacteria | 4157 |
| 7 | Ga0065707_10002348 | 3300005295 | Bacteria | 8447 |
| 8 | Ga0065707_10402365 | 3300005295 | Bacteria | 851 |
| 9 | Ga0070676_11325747 | 3300005328 | Bacteria | 550 |
| 10 | Ga0070683_100035088 | 3300005329 | Bacteria | 4585 |
| 11 | Ga0070683_100944776 | 3300005329 | Unclassified | 827 |
| 12 | Ga0070690_100000422 | 3300005330 | Bacteria | 21437 |
| 13 | Ga0068869_100032622 | 3300005334 | Bacteria | 3671 |
| 14 | Ga0068869_100150931 | 3300005334 | Unclassified | 1802 |
| 15 | Ga0070666_10003091 | 3300005335 | Bacteria | 10102 |
| 16 | Ga0068868_101300805 | 3300005338 | Bacteria | 675 |
| 17 | Ga0070689_100007513 | 3300005340 | Bacteria | 7628 |
| 18 | Ga0070689_100009714 | 3300005340 | Bacteria | 6827 |
| 19 | Ga0070689_100026261 | 3300005340 | Unclassified | 4384 |
| 20 | Ga0070687_100224595 | 3300005343 | Bacteria | 1152 |
| 21 | Ga0070687_100401684 | 3300005343 | Unclassified | 899 |
| 22 | Ga0070687_100420725 | 3300005343 | Bacteria | 881 |
| 23 | Ga0070661_100007735 | 3300005344 | Bacteria | 7421 |
| 24 | Ga0070675_100000454 | 3300005354 | Bacteria | 27986 |
| 25 | Ga0070671_100054552 | 3300005355 | Bacteria | 3323 |
| 26 | Ga0070671_100742409 | 3300005355 | Unclassified | 853 |
| 27 | Ga0070674_100020416 | 3300005356 | Bacteria | 4233 |
| 28 | Ga0070673_100166956 | 3300005364 | Unclassified | 1876 |
| 29 | Ga0070673_100537757 | 3300005364 | Unclassified | 1060 |
| 30 | Ga0070688_100060633 | 3300005365 | Bacteria | 2390 |
| 31 | Ga0070667_100003766 | 3300005367 | Bacteria | 12879 |
| 32 | Ga0070667_100105946 | 3300005367 | Unclassified | 2433 |
| 33 | Ga0070667_100276720 | 3300005367 | Unclassified | 1506 |
| 34 | Ga0070709_10000058 | 3300005434 | Bacteria | 85194 |
| 35 | Ga0070713_101436371 | 3300005436 | Unclassified | 669 |
| 36 | Ga0070710_10049717 | 3300005437 | Bacteria | 2346 |
| 37 | Ga0070701_10007123 | 3300005438 | Bacteria | 4752 |
| 38 | Ga0070705_100009025 | 3300005440 | Bacteria | 4950 |
| 39 | Ga0070708_100017048 | 3300005445 | Bacteria | 6047 |
| 40 | Ga0070708_100024721 | 3300005445 | Bacteria | 5130 |
| 41 | Ga0070708_100134924 | 3300005445 | Bacteria | 2286 |
| 42 | Ga0070708_100297055 | 3300005445 | Unclassified | 1521 |
| 43 | Ga0070708_100607131 | 3300005445 | Bacteria | 1031 |
| 44 | Ga0070708_100738303 | 3300005445 | Unclassified | 926 |
| 45 | Ga0070708_100905628 | 3300005445 | Unclassified | 828 |
| 46 | Ga0070663_100001221 | 3300005455 | Bacteria | 14110 |
| 47 | Ga0068867_100041262 | 3300005459 | Bacteria | 3372 |
| 48 | Ga0068867_100447081 | 3300005459 | Bacteria | 1100 |
| 49 | Ga0070706_100003954 | 3300005467 | Bacteria | 14434 |
| 50 | Ga0070706_100050153 | 3300005467 | Bacteria | 3852 |
| 51 | Ga0070706_100074185 | 3300005467 | Bacteria | 3149 |
| 52 | Ga0070706_100174254 | 3300005467 | Bacteria | 2008 |
| 53 | Ga0070706_100236849 | 3300005467 | Unclassified | 1704 |
| 54 | Ga0070706_100257060 | 3300005467 | Bacteria | 1630 |
| 55 | Ga0070706_100416940 | 3300005467 | Bacteria | 1250 |
| 56 | Ga0070707_100006209 | 3300005468 | Bacteria | 11129 |
| 57 | Ga0070707_100027249 | 3300005468 | Bacteria | 5436 |
| 58 | Ga0070707_100371909 | 3300005468 | Bacteria | 1388 |
| 59 | Ga0070707_100631492 | 3300005468 | Bacteria | 1034 |
| 60 | Ga0070698_100037075 | 3300005471 | Bacteria | 5029 |
| 61 | Ga0070698_100081375 | 3300005471 | Bacteria | 3233 |
| 62 | Ga0070698_100123624 | 3300005471 | Bacteria | 2545 |
| 63 | Ga0070698_100131840 | 3300005471 | Bacteria | 2454 |
| 64 | Ga0070698_100174597 | 3300005471 | Bacteria | 2089 |
| 65 | Ga0070698_100389301 | 3300005471 | Bacteria | 1327 |
| 66 | Ga0070698_100774383 | 3300005471 | Bacteria | 903 |
| 67 | Ga0070699_100013714 | 3300005518 | Bacteria | 6973 |
| 68 | Ga0070699_100052857 | 3300005518 | Bacteria | 3515 |
| 69 | Ga0070699_100304066 | 3300005518 | Bacteria | 1431 |
| 70 | Ga0070699_100460697 | 3300005518 | Bacteria | 1153 |
| 71 | Ga0070699_100565205 | 3300005518 | Unclassified | 1036 |
| 72 | Ga0070699_100654006 | 3300005518 | Bacteria | 959 |
| 73 | Ga0070699_100913531 | 3300005518 | Unclassified | 804 |
| 74 | Ga0070699_101077383 | 3300005518 | Bacteria | 737 |
| 75 | Ga0070697_100001229 | 3300005536 | Bacteria | 19342 |
| 76 | Ga0070697_100022807 | 3300005536 | Unclassified | 4976 |
| 77 | Ga0070697_100187192 | 3300005536 | Bacteria | 1756 |
| 78 | Ga0070697_100854893 | 3300005536 | Bacteria | 806 |
| 79 | Ga0070697_100953223 | 3300005536 | Unclassified | 762 |
| 80 | Ga0070672_100087238 | 3300005543 | Bacteria | 2510 |
| 81 | Ga0070672_100160054 | 3300005543 | Unclassified | 1867 |
| 82 | Ga0070672_100360540 | 3300005543 | Unclassified | 1241 |
| 83 | Ga0070686_100071990 | 3300005544 | Bacteria | 2265 |
| 84 | Ga0070686_100216076 | 3300005544 | Unclassified | 1383 |
| 85 | Ga0070686_100231248 | 3300005544 | Bacteria | 1341 |
| 86 | Ga0070696_100895271 | 3300005546 | Bacteria | 736 |
| 87 | Ga0070665_100016810 | 3300005548 | Bacteria | 7335 |
| 88 | Ga0070704_100020192 | 3300005549 | Bacteria | 4292 |
| 89 | Ga0070704_100133475 | 3300005549 | Unclassified | 1928 |
| 90 | Ga0070704_100991613 | 3300005549 | Unclassified | 759 |
| 91 | Ga0070664_100008853 | 3300005564 | Bacteria | 8157 |
| 92 | Ga0070664_100677201 | 3300005564 | Unclassified | 960 |
| 93 | Ga0068857_100010272 | 3300005577 | Bacteria | 8137 |
| 94 | Ga0068856_100001489 | 3300005614 | Bacteria | 24491 |
| 95 | Ga0068856_100179376 | 3300005614 | Unclassified | 2131 |
| 96 | Ga0070702_100137674 | 3300005615 | Unclassified | 1551 |
| 97 | Ga0068859_100000008 | 3300005617 | Bacteria | 383750 |
| 98 | Ga0068859_100002831 | 3300005617 | Bacteria | 17596 |
| 99 | Ga0068859_100005328 | 3300005617 | Bacteria | 13082 |
| 100 | Ga0068864_100040933 | 3300005618 | Bacteria | 3963 |
| 101 | Ga0068864_100082215 | 3300005618 | Bacteria | 2826 |
| 102 | Ga0068864_100137191 | 3300005618 | Unclassified | 2204 |
| 103 | Ga0068866_10035116 | 3300005718 | Bacteria | 2446 |
| 104 | Ga0068863_100059491 | 3300005841 | Bacteria | 3614 |
| 105 | Ga0068863_100102025 | 3300005841 | Unclassified | 2728 |
| 106 | Ga0068863_100215707 | 3300005841 | Bacteria | 1848 |
| 107 | Ga0068863_100315926 | 3300005841 | Unclassified | 1517 |
| 108 | Ga0068858_100001323 | 3300005842 | Bacteria | 25571 |
| 109 | Ga0068858_100049974 | 3300005842 | Unclassified | 3871 |
| 110 | Ga0068858_100097596 | 3300005842 | Bacteria | 2739 |
| 111 | Ga0068860_100010880 | 3300005843 | Bacteria | 8971 |
| 112 | Ga0068860_100345700 | 3300005843 | Unclassified | 1463 |
| 113 | Ga0081540_1000396 | 3300005983 | Bacteria | 43174 |
| 114 | Ga0081540_1000454 | 3300005983 | Bacteria | 40672 |
| 115 | Ga0070716_100019183 | 3300006173 | Unclassified | 3572 |
| 116 | Ga0070716_100133900 | 3300006173 | Bacteria | 1571 |
| 117 | Ga0070716_100438857 | 3300006173 | Unclassified | 949 |
| 118 | Ga0097621_100094038 | 3300006237 | Bacteria | 2513 |
| 119 | Ga0068871_100102289 | 3300006358 | Bacteria | 2401 |
| 120 | Ga0075428_100039902 | 3300006844 | Bacteria | 5167 |
| 121 | Ga0075428_102022989 | 3300006844 | Unclassified | 597 |
| 122 | Ga0075428_102025075 | 3300006844 | Unclassified | 596 |
| 123 | Ga0075431_100493000 | 3300006847 | Bacteria | 1217 |
| 124 | Ga0075431_100582935 | 3300006847 | Bacteria | 1104 |
| 125 | Ga0075431_100874594 | 3300006847 | Bacteria | 869 |
| 126 | Ga0075433_10093488 | 3300006852 | Bacteria | 2660 |
| 127 | Ga0075433_10108470 | 3300006852 | Bacteria | 2462 |
| 128 | Ga0075433_11213855 | 3300006852 | Bacteria | 654 |
| 129 | Ga0075434_100006895 | 3300006871 | Bacteria | 10464 |
| 130 | Ga0075434_100597802 | 3300006871 | Bacteria | 1122 |
| 131 | Ga0075434_101078540 | 3300006871 | Bacteria | 817 |
| 132 | Ga0068865_100002374 | 3300006881 | Bacteria | 11096 |
| 133 | Ga0068865_100725610 | 3300006881 | Bacteria | 851 |
| 134 | Ga0068865_101185791 | 3300006881 | Bacteria | 675 |
| 135 | Ga0075436_100000059 | 3300006914 | Bacteria | 65361 |
| 136 | Ga0075436_100034914 | 3300006914 | Bacteria | 3469 |
| 137 | Ga0075436_100525465 | 3300006914 | Unclassified | 867 |
| 138 | Ga0075436_101121629 | 3300006914 | Bacteria | 592 |
| 139 | Ga0097620_100000008 | 3300006931 | Bacteria | 383750 |
| 140 | Ga0097620_100002831 | 3300006931 | Bacteria | 17596 |
| 141 | Ga0097620_100005328 | 3300006931 | Bacteria | 13082 |
| 142 | Ga0075435_100005252 | 3300007076 | Bacteria | 9016 |
| 143 | Ga0075435_101363064 | 3300007076 | Bacteria | 621 |
| 144 | Ga0111539_10006951 | 3300009094 | Bacteria | 14525 |
| 145 | Ga0111539_11737811 | 3300009094 | Unclassified | 723 |
| 146 | Ga0105247_10106300 | 3300009101 | Bacteria | 1800 |
| 147 | Ga0114129_10017906 | 3300009147 | Bacteria | 10084 |
| 148 | Ga0114129_10020219 | 3300009147 | Bacteria | 9473 |
| 149 | Ga0114129_10047146 | 3300009147 | Bacteria | 6057 |
| 150 | Ga0114129_11219609 | 3300009147 | Unclassified | 936 |
| 151 | Ga0114129_11378459 | 3300009147 | Unclassified | 871 |
| 152 | Ga0114129_11544078 | 3300009147 | Unclassified | 814 |
| 153 | Ga0114129_12066378 | 3300009147 | Bacteria | 688 |
| 154 | Ga0114129_12292695 | 3300009147 | Viruses | 648 |
| 155 | Ga0105243_10660272 | 3300009148 | Unclassified | 1014 |
| 156 | Ga0105241_10796186 | 3300009174 | Unclassified | 870 |
| 157 | Ga0105242_10120353 | 3300009176 | Bacteria | 2252 |
| 158 | Ga0105248_10016816 | 3300009177 | Bacteria | 8051 |
| 159 | Ga0105248_10343591 | 3300009177 | Bacteria | 1680 |
| 160 | Ga0099796_10018424 | 3300010159 | Unclassified | 2096 |
| 161 | Ga0157373_10219713 | 3300013100 | Bacteria | 1340 |
| 162 | Ga0157378_10002910 | 3300013297 | Bacteria | 15233 |
| 163 | Ga0157375_10000351 | 3300013308 | Bacteria | 41691 |
| 164 | Ga0157375_10090623 | 3300013308 | Unclassified | 3117 |
| 165 | Ga0157375_11976709 | 3300013308 | Unclassified | 693 |
| 166 | Ga0163163_10387366 | 3300014325 | Bacteria | 1455 |
| 167 | Ga0157380_10158760 | 3300014326 | Unclassified | 1963 |
| 168 | Ga0157377_10024786 | 3300014745 | Plasmid | 3192 |
| 169 | Ga0157379_10003272 | 3300014968 | Bacteria | 13720 |
| 170 | Ga0157379_10174039 | 3300014968 | Unclassified | 1943 |
| 171 | Ga0157376_10004421 | 3300014969 | Bacteria | 9790 |
| 172 | Ga0157376_10010627 | 3300014969 | Bacteria | 6741 |
| 173 | Ga0157376_10627599 | 3300014969 | Unclassified | 1072 |
| 174 | Ga0207692_10178096 | 3300025898 | Bacteria | 1237 |
| 175 | Ga0207710_10147696 | 3300025900 | Unclassified | 1139 |
| 176 | Ga0207680_10000711 | 3300025903 | Bacteria | 15614 |
| 177 | Ga0207699_10000065 | 3300025906 | Bacteria | 85512 |
| 178 | Ga0207699_10750672 | 3300025906 | Unclassified | 716 |
| 179 | Ga0207684_10021094 | 3300025910 | Bacteria | 5563 |
| 180 | Ga0207684_10102429 | 3300025910 | Unclassified | 2448 |
| 181 | Ga0207684_10108684 | 3300025910 | Bacteria | 2373 |
| 182 | Ga0207684_10133686 | 3300025910 | Bacteria | 2129 |
| 183 | Ga0207684_10145669 | 3300025910 | Bacteria | 2037 |
| 184 | Ga0207684_10599139 | 3300025910 | Bacteria | 941 |
| 185 | Ga0207684_11263504 | 3300025910 | Unclassified | 609 |
| 186 | Ga0207684_11480572 | 3300025910 | Unclassified | 553 |
| 187 | Ga0207654_10541188 | 3300025911 | Unclassified | 826 |
| 188 | Ga0207660_10271389 | 3300025917 | Unclassified | 1344 |
| 189 | Ga0207662_10094188 | 3300025918 | Bacteria | 1847 |
| 190 | Ga0207649_10136021 | 3300025920 | Bacteria | 1675 |
| 191 | Ga0207646_10011284 | 3300025922 | Bacteria | 8677 |
| 192 | Ga0207646_10146963 | 3300025922 | Unclassified | 2124 |
| 193 | Ga0207646_10149985 | 3300025922 | Bacteria | 2102 |
| 194 | Ga0207646_10229935 | 3300025922 | Bacteria | 1675 |
| 195 | Ga0207646_10283540 | 3300025922 | Bacteria | 1497 |
| 196 | Ga0207700_11525364 | 3300025928 | Bacteria | 592 |
| 197 | Ga0207644_10288651 | 3300025931 | Bacteria | 1319 |
| 198 | Ga0207709_10506061 | 3300025935 | Unclassified | 943 |
| 199 | Ga0207670_10009473 | 3300025936 | Bacteria | 5558 |
| 200 | Ga0207670_10025316 | 3300025936 | Bacteria | 3723 |
| 201 | Ga0207704_10005879 | 3300025938 | Bacteria | 5680 |
| 202 | Ga0207691_10002450 | 3300025940 | Bacteria | 18143 |
| 203 | Ga0207691_10034436 | 3300025940 | Bacteria | 4709 |
| 204 | Ga0207711_10080898 | 3300025941 | Bacteria | 2838 |
| 205 | Ga0207711_10238933 | 3300025941 | Bacteria | 1665 |
| 206 | Ga0207661_11319458 | 3300025944 | Unclassified | 663 |
| 207 | Ga0207651_10012037 | 3300025960 | Bacteria | 4873 |
| 208 | Ga0207658_10010739 | 3300025986 | Bacteria | 6226 |
| 209 | Ga0207658_10103912 | 3300025986 | Unclassified | 2231 |
| 210 | Ga0207677_11548632 | 3300026023 | Bacteria | 613 |
| 211 | Ga0207703_10013181 | 3300026035 | Bacteria | 6440 |
| 212 | Ga0207678_10004342 | 3300026067 | Bacteria | 12728 |
| 213 | Ga0207702_10054466 | 3300026078 | Bacteria | 3390 |
| 214 | Ga0207641_10087824 | 3300026088 | Bacteria | 2713 |
| 215 | Ga0207641_10139085 | 3300026088 | Bacteria | 2188 |
| 216 | Ga0207641_10319418 | 3300026088 | Unclassified | 1472 |
| 217 | Ga0207641_10366306 | 3300026088 | Unclassified | 1377 |
| 218 | Ga0207641_10500988 | 3300026088 | Unclassified | 1179 |
| 219 | Ga0207648_10006975 | 3300026089 | Bacteria | 11178 |
| 220 | Ga0207648_11520780 | 3300026089 | Unclassified | 629 |
| 221 | Ga0207676_10021773 | 3300026095 | Bacteria | 4706 |
| 222 | Ga0207674_10044071 | 3300026116 | Bacteria | 4598 |
| 223 | Ga0207428_10032026 | 3300027907 | Bacteria | 4329 |
| 224 | Ga0268266_10009737 | 3300028379 | Bacteria | 8450 |
| 225 | Ga0268264_10001503 | 3300028381 | Bacteria | 21734 |
| 226 | Ga0268264_10896549 | 3300028381 | Bacteria | 890 |
| 227 | Ga0265318_10029006 | 3300028577 | Bacteria | 2160 |
| 228 | Ga0265325_10158728 | 3300031241 | Bacteria | 1065 |
| 229 | Ga0265339_10097146 | 3300031249 | Unclassified | 1537 |
| 230 | Ga0307408_100333915 | 3300031548 | Bacteria | 1281 |
| 231 | Ga0307508_10143572 | 3300031616 | Bacteria | 1991 |
| 232 | Ga0307410_10005636 | 3300031852 | Bacteria | 6656 |
| 233 | Ga0307406_10186676 | 3300031901 | Bacteria | 1514 |
| 234 | Ga0307407_10082130 | 3300031903 | Bacteria | 1952 |
| 235 | Ga0307412_10046197 | 3300031911 | Bacteria | 2852 |
| 236 | Ga0307412_10866063 | 3300031911 | Bacteria | 789 |
| 237 | Ga0307409_100352461 | 3300031995 | Bacteria | 1389 |
| 238 | Ga0307416_100006882 | 3300032002 | Bacteria | 7159 |
| 239 | Ga0307416_100026616 | 3300032002 | Bacteria | 4265 |
| 240 | Ga0307416_100501719 | 3300032002 | Bacteria | 1278 |
| 241 | Ga0307414_10161959 | 3300032004 | Bacteria | 1778 |
| 242 | Ga0307411_10071391 | 3300032005 | Bacteria | 2353 |
| 243 | Ga0307415_100266146 | 3300032126 | Bacteria | 1402 |
| 244 | Ga0373931_0078741 | 3300035691 | Bacteria | 1814 |
| 245 | Ga0373935_0010412 | 3300035692 | Bacteria | 5575 |
| 246 | Ga0373927_0081768 | 3300035695 | Unclassified | 2093 |
| 247 | Ga0373933_0856959 | 3300035724 | Bacteria | 598 |
| 248 | Ga0373937_0006880 | 3300036401 | Bacteria | 9815 |
| 249 | Ga0373937_0125677 | 3300036401 | Bacteria | 2392 |
| 250 | Ga0373937_0612220 | 3300036401 | Unclassified | 1034 |
| 251 | Ga0373937_1130392 | 3300036401 | Bacteria | 732 |
| 252 | Ga0373925_0062020 | 3300037068 | Bacteria | 2810 |
| 253 | Ga0373925_0997404 | 3300037068 | Bacteria | 690 |
| 254 | Ga0439450_035353 | 3300042008 | Bacteria | 1140 |
| 255 | Ga0439444_0072974 | 3300042437 | Bacteria | 738 |
| 256 | Ga0453683_0055521 | 3300044673 | Bacteria | 2479 |
| 257 | Ga0453683_0151118 | 3300044673 | Bacteria | 1467 |
| 258 | Ga0453683_0235799 | 3300044673 | Unclassified | 1165 |
| 259 | Ga0451576_0217163 | 3300045051 | Bacteria | 1997 |
| 260 | Ga0451576_0461223 | 3300045051 | Unclassified | 1334 |
| 261 | Ga0466967_2304397 | 3300045976 | Unclassified | 534 |
| 262 | Ga0495651_0578393 | 3300046462 | Unclassified | 711 |
| 263 | Ga0495580_0112552 | 3300046472 | Bacteria | 1890 |
| 264 | Ga0495580_0122021 | 3300046472 | Bacteria | 1809 |
| 265 | Ga0495582_0062388 | 3300046473 | Unclassified | 2059 |
| 266 | Ga0495658_0011186 | 3300046683 | Bacteria | 4505 |
| 267 | Ga0495636_0196768 | 3300047318 | Bacteria | 919 |
| 268 | Ga0495615_0011546 | 3300048090 | Bacteria | 1798 |
| 269 | Ga0496100_0168374 | 3300048903 | Unclassified | 1576 |
| 270 | Ga0496102_0002239 | 3300048905 | Bacteria | 16588 |
| 271 | Ga0496103_0005032 | 3300048906 | Bacteria | 7971 |
| 272 | Ga0496104_0204556 | 3300048907 | Bacteria | 1886 |
| 273 | Ga0496104_1646774 | 3300048907 | Unclassified | 544 |
| 274 | Ga0496104_1718432 | 3300048907 | Bacteria | 530 |
| 275 | Ga0496105_0310586 | 3300048908 | Unclassified | 1266 |
| 276 | Ga0496106_0006552 | 3300048909 | Bacteria | 8623 |
| 277 | Ga0496107_0004879 | 3300048910 | Bacteria | 9113 |
| 278 | Ga0496108_0003756 | 3300048911 | Bacteria | 12169 |
| 279 | Ga0496109_0058863 | 3300048912 | Bacteria | 3510 |
| 280 | Ga0496110_0046132 | 3300048913 | Bacteria | 3812 |
| 281 | Ga0496111_0039796 | 3300048914 | Unclassified | 3372 |
| 282 | Ga0496111_0080007 | 3300048914 | Unclassified | 2384 |
| 283 | Ga0496111_0106183 | 3300048914 | Unclassified | 2067 |
| 284 | Ga0496112_0028412 | 3300048915 | Bacteria | 5398 |
| 285 | Ga0496114_0000137 | 3300048917 | Bacteria | 53099 |
| 286 | Ga0496115_0100740 | 3300048918 | Bacteria | 2368 |
| 287 | Ga0501038_0342493 | 3300049574 | Bacteria | 1166 |
| 288 | Ga0501069_0113329 | 3300049585 | Bacteria | 1546 |
| 289 | Ga0501233_035109 | 3300049668 | Bacteria | 1154 |
| 290 | nmdc:mga05p37_1659412_c1 | 3300050507 | Unclassified | 626 |
| 291 | nmdc:mga05p37_7896_c1 | 3300050507 | Bacteria | 12560 |
| 292 | nmdc:mga0qj67_489294_c1 | 3300050509 | Bacteria | 989 |
| 293 | nmdc:mga06r32_605265_c1 | 3300050510 | Bacteria | 1066 |
| 294 | nmdc:mga08y16_1369454_c1 | 3300050511 | Unclassified | 672 |
| 295 | nmdc:mga08y16_32842_c1 | 3300050511 | Bacteria | 5456 |
| 296 | nmdc:mga0n895_1022126_c1 | 3300050512 | Bacteria | 807 |
| 297 | nmdc:mga0n895_1042994_c1 | 3300050512 | Bacteria | 797 |
| 298 | nmdc:mga0n895_1767297_c1 | 3300050512 | Bacteria | 580 |
| 299 | nmdc:mga0n895_75769_c1 | 3300050512 | Bacteria | 3344 |
| 300 | nmdc:mga0n895_87649_c1 | 3300050512 | Bacteria | 3111 |
| 301 | nmdc:mga0rr50_34478_c1 | 3300050513 | Bacteria | 3625 |
| 302 | nmdc:mga0rr50_796341_c1 | 3300050513 | Unclassified | 806 |
| 303 | nmdc:mga08x19_1037553_c1 | 3300050514 | Unclassified | 582 |
| 304 | nmdc:mga08x19_15020_c1 | 3300050514 | Bacteria | 4703 |
| 305 | nmdc:mga08x19_91198_c1 | 3300050514 | Bacteria | 2011 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025910 | Ga0207684_11480572 | Ga0207684_114805721 | 118 |
| 2 | 3300050512 | nmdc:mga0n895_1042994_c1 | nmdc:mga0n895_1042994_c1_373_762 | 124 |
| 3 | 3300006847 | Ga0075431_100874594 | Ga0075431_1008745941 | 131 |
| 4 | 3300005471 | Ga0070698_100774383 | Ga0070698_1007743832 | 139 |
| 5 | 3300050507 | nmdc:mga05p37_7896_c1 | nmdc:mga05p37_7896_c1_8994_9428 | 139 |
| 6 | 3300003323 | rootH1_10089349 | rootH1_100893492 | 140 |
| 7 | 3300005355 | Ga0070671_100054552 | Ga0070671_1000545523 | 140 |
| 8 | 3300005445 | Ga0070708_100024721 | Ga0070708_1000247215 | 140 |
| 9 | 3300006881 | Ga0068865_100725610 | Ga0068865_1007256102 | 140 |
| 10 | 3300014969 | Ga0157376_10010627 | Ga0157376_100106272 | 140 |
| 11 | 3300003659 | JGI25404J52841_10000179 | JGI25404J52841_100001797 | 141 |
| 12 | 3300005289 | Ga0065704_10003535 | Ga0065704_100035353 | 141 |
| 13 | 3300005295 | Ga0065707_10002348 | Ga0065707_100023487 | 141 |
| 14 | 3300005328 | Ga0070676_11325747 | Ga0070676_113257471 | 141 |
| 15 | 3300005329 | Ga0070683_100035088 | Ga0070683_1000350884 | 141 |
| 16 | 3300005329 | Ga0070683_100944776 | Ga0070683_1009447762 | 141 |
| 17 | 3300005334 | Ga0068869_100032622 | Ga0068869_1000326223 | 141 |
| 18 | 3300005334 | Ga0068869_100150931 | Ga0068869_1001509311 | 141 |
| 19 | 3300005338 | Ga0068868_101300805 | Ga0068868_1013008051 | 141 |
| 20 | 3300005340 | Ga0070689_100009714 | Ga0070689_1000097144 | 141 |
| 21 | 3300005340 | Ga0070689_100026261 | Ga0070689_1000262612 | 141 |
| 22 | 3300005343 | Ga0070687_100224595 | Ga0070687_1002245952 | 141 |
| 23 | 3300005343 | Ga0070687_100401684 | Ga0070687_1004016841 | 141 |
| 24 | 3300005344 | Ga0070661_100007735 | Ga0070661_1000077352 | 141 |
| 25 | 3300005354 | Ga0070675_100000454 | Ga0070675_10000045412 | 141 |
| 26 | 3300005355 | Ga0070671_100742409 | Ga0070671_1007424092 | 141 |
| 27 | 3300005364 | Ga0070673_100537757 | Ga0070673_1005377572 | 141 |
| 28 | 3300005367 | Ga0070667_100276720 | Ga0070667_1002767201 | 141 |
| 29 | 3300005445 | Ga0070708_100905628 | Ga0070708_1009056281 | 141 |
| 30 | 3300005459 | Ga0068867_100447081 | Ga0068867_1004470812 | 141 |
| 31 | 3300005518 | Ga0070699_100913531 | Ga0070699_1009135311 | 141 |
| 32 | 3300005543 | Ga0070672_100160054 | Ga0070672_1001600544 | 141 |
| 33 | 3300005543 | Ga0070672_100360540 | Ga0070672_1003605402 | 141 |
| 34 | 3300005544 | Ga0070686_100071990 | Ga0070686_1000719904 | 141 |
| 35 | 3300005549 | Ga0070704_100991613 | Ga0070704_1009916132 | 141 |
| 36 | 3300005564 | Ga0070664_100008853 | Ga0070664_1000088532 | 141 |
| 37 | 3300005577 | Ga0068857_100010272 | Ga0068857_1000102725 | 141 |
| 38 | 3300005614 | Ga0068856_100179376 | Ga0068856_1001793764 | 141 |
| 39 | 3300005615 | Ga0070702_100137674 | Ga0070702_1001376742 | 141 |
| 40 | 3300005617 | Ga0068859_100002831 | Ga0068859_1000028318 | 141 |
| 41 | 3300005618 | Ga0068864_100040933 | Ga0068864_1000409332 | 141 |
| 42 | 3300005618 | Ga0068864_100137191 | Ga0068864_1001371913 | 141 |
| 43 | 3300005841 | Ga0068863_100102025 | Ga0068863_1001020253 | 141 |
| 44 | 3300005842 | Ga0068858_100049974 | Ga0068858_1000499744 | 141 |
| 45 | 3300005983 | Ga0081540_1000396 | Ga0081540_10003969 | 141 |
| 46 | 3300005983 | Ga0081540_1000454 | Ga0081540_100045421 | 141 |
| 47 | 3300006871 | Ga0075434_100597802 | Ga0075434_1005978022 | 141 |
| 48 | 3300006931 | Ga0097620_100002831 | Ga0097620_1000028314 | 141 |
| 49 | 3300009094 | Ga0111539_10006951 | Ga0111539_100069519 | 141 |
| 50 | 3300009174 | Ga0105241_10796186 | Ga0105241_107961862 | 141 |
| 51 | 3300009177 | Ga0105248_10343591 | Ga0105248_103435913 | 141 |
| 52 | 3300013308 | Ga0157375_10090623 | Ga0157375_100906233 | 141 |
| 53 | 3300013308 | Ga0157375_11976709 | Ga0157375_119767091 | 141 |
| 54 | 3300014745 | Ga0157377_10024786 | Ga0157377_100247863 | 141 |
| 55 | 3300014968 | Ga0157379_10174039 | Ga0157379_101740394 | 141 |
| 56 | 3300025911 | Ga0207654_10541188 | Ga0207654_105411882 | 141 |
| 57 | 3300025917 | Ga0207660_10271389 | Ga0207660_102713892 | 141 |
| 58 | 3300025918 | Ga0207662_10094188 | Ga0207662_100941883 | 141 |
| 59 | 3300025920 | Ga0207649_10136021 | Ga0207649_101360211 | 141 |
| 60 | 3300025931 | Ga0207644_10288651 | Ga0207644_102886513 | 141 |
| 61 | 3300025936 | Ga0207670_10025316 | Ga0207670_100253163 | 141 |
| 62 | 3300025940 | Ga0207691_10034436 | Ga0207691_100344364 | 141 |
| 63 | 3300025941 | Ga0207711_10238933 | Ga0207711_102389333 | 141 |
| 64 | 3300025944 | Ga0207661_11319458 | Ga0207661_113194581 | 141 |
| 65 | 3300026023 | Ga0207677_11548632 | Ga0207677_115486321 | 141 |
| 66 | 3300026088 | Ga0207641_10319418 | Ga0207641_103194183 | 141 |
| 67 | 3300026088 | Ga0207641_10500988 | Ga0207641_105009882 | 141 |
| 68 | 3300026116 | Ga0207674_10044071 | Ga0207674_100440714 | 141 |
| 69 | 3300027907 | Ga0207428_10032026 | Ga0207428_100320263 | 141 |
| 70 | 3300031616 | Ga0307508_10143572 | Ga0307508_101435722 | 141 |
| 71 | 3300031852 | Ga0307410_10005636 | Ga0307410_100056363 | 141 |
| 72 | 3300031903 | Ga0307407_10082130 | Ga0307407_100821302 | 141 |
| 73 | 3300031911 | Ga0307412_10866063 | Ga0307412_108660632 | 141 |
| 74 | 3300031995 | Ga0307409_100352461 | Ga0307409_1003524612 | 141 |
| 75 | 3300032002 | Ga0307416_100501719 | Ga0307416_1005017192 | 141 |
| 76 | 3300032004 | Ga0307414_10161959 | Ga0307414_101619592 | 141 |
| 77 | 3300032005 | Ga0307411_10071391 | Ga0307411_100713912 | 141 |
| 78 | 3300035691 | Ga0373931_0078741 | Ga0373931_0078741_1112_1543 | 141 |
| 79 | 3300035692 | Ga0373935_0010412 | Ga0373935_0010412_3810_4235 | 141 |
| 80 | 3300036401 | Ga0373937_0612220 | Ga0373937_0612220_541_978 | 141 |
| 81 | 3300037068 | Ga0373925_0997404 | Ga0373925_0997404_117_554 | 141 |
| 82 | 3300042008 | Ga0439450_035353 | Ga0439450_035353_581_1018 | 141 |
| 83 | 3300045051 | Ga0451576_0217163 | Ga0451576_0217163_926_1363 | 141 |
| 84 | 3300045051 | Ga0451576_0461223 | Ga0451576_0461223_622_1059 | 141 |
| 85 | 3300046472 | Ga0495580_0122021 | Ga0495580_0122021_676_1113 | 141 |
| 86 | 3300046683 | Ga0495658_0011186 | Ga0495658_0011186_3201_3638 | 141 |
| 87 | 3300048907 | Ga0496104_1718432 | Ga0496104_1718432_38_463 | 141 |
| 88 | 3300048917 | Ga0496114_0000137 | Ga0496114_0000137_1834_2259 | 141 |
| 89 | 3300050511 | nmdc:mga08y16_32842_c1 | nmdc:mga08y16_32842_c1_1681_2115 | 141 |
| 90 | 3300050512 | nmdc:mga0n895_1767297_c1 | nmdc:mga0n895_1767297_c1_120_557 | 141 |
| 91 | 3300002076 | JGI24749J21850_1018909 | JGI24749J21850_10189092 | 142 |
| 92 | 3300003316 | rootH1_10009429 | rootH1_100094294 | 142 |
| 93 | 3300003322 | rootL2_10282619 | rootL2_102826192 | 142 |
| 94 | 3300005295 | Ga0065707_10402365 | Ga0065707_104023652 | 142 |
| 95 | 3300005330 | Ga0070690_100000422 | Ga0070690_10000042213 | 142 |
| 96 | 3300005335 | Ga0070666_10003091 | Ga0070666_100030915 | 142 |
| 97 | 3300005340 | Ga0070689_100007513 | Ga0070689_1000075131 | 142 |
| 98 | 3300005343 | Ga0070687_100420725 | Ga0070687_1004207252 | 142 |
| 99 | 3300005356 | Ga0070674_100020416 | Ga0070674_1000204163 | 142 |
| 100 | 3300005364 | Ga0070673_100166956 | Ga0070673_1001669563 | 142 |
| 101 | 3300005365 | Ga0070688_100060633 | Ga0070688_1000606331 | 142 |
| 102 | 3300005367 | Ga0070667_100003766 | Ga0070667_10000376614 | 142 |
| 103 | 3300005367 | Ga0070667_100105946 | Ga0070667_1001059462 | 142 |
| 104 | 3300005434 | Ga0070709_10000058 | Ga0070709_1000005813 | 142 |
| 105 | 3300005436 | Ga0070713_101436371 | Ga0070713_1014363711 | 142 |
| 106 | 3300005437 | Ga0070710_10049717 | Ga0070710_100497172 | 142 |
| 107 | 3300005438 | Ga0070701_10007123 | Ga0070701_100071232 | 142 |
| 108 | 3300005440 | Ga0070705_100009025 | Ga0070705_1000090252 | 142 |
| 109 | 3300005445 | Ga0070708_100017048 | Ga0070708_1000170482 | 142 |
| 110 | 3300005445 | Ga0070708_100134924 | Ga0070708_1001349243 | 142 |
| 111 | 3300005445 | Ga0070708_100297055 | Ga0070708_1002970552 | 142 |
| 112 | 3300005445 | Ga0070708_100607131 | Ga0070708_1006071312 | 142 |
| 113 | 3300005445 | Ga0070708_100738303 | Ga0070708_1007383032 | 142 |
| 114 | 3300005455 | Ga0070663_100001221 | Ga0070663_1000012218 | 142 |
| 115 | 3300005459 | Ga0068867_100041262 | Ga0068867_1000412623 | 142 |
| 116 | 3300005467 | Ga0070706_100003954 | Ga0070706_1000039546 | 142 |
| 117 | 3300005467 | Ga0070706_100050153 | Ga0070706_1000501531 | 142 |
| 118 | 3300005467 | Ga0070706_100074185 | Ga0070706_1000741853 | 142 |
| 119 | 3300005467 | Ga0070706_100174254 | Ga0070706_1001742543 | 142 |
| 120 | 3300005467 | Ga0070706_100236849 | Ga0070706_1002368492 | 142 |
| 121 | 3300005467 | Ga0070706_100257060 | Ga0070706_1002570602 | 142 |
| 122 | 3300005467 | Ga0070706_100416940 | Ga0070706_1004169402 | 142 |
| 123 | 3300005468 | Ga0070707_100006209 | Ga0070707_10000620910 | 142 |
| 124 | 3300005468 | Ga0070707_100027249 | Ga0070707_1000272494 | 142 |
| 125 | 3300005468 | Ga0070707_100371909 | Ga0070707_1003719092 | 142 |
| 126 | 3300005468 | Ga0070707_100631492 | Ga0070707_1006314921 | 142 |
| 127 | 3300005471 | Ga0070698_100037075 | Ga0070698_1000370752 | 142 |
| 128 | 3300005471 | Ga0070698_100081375 | Ga0070698_1000813753 | 142 |
| 129 | 3300005471 | Ga0070698_100123624 | Ga0070698_1001236242 | 142 |
| 130 | 3300005471 | Ga0070698_100131840 | Ga0070698_1001318403 | 142 |
| 131 | 3300005471 | Ga0070698_100174597 | Ga0070698_1001745973 | 142 |
| 132 | 3300005471 | Ga0070698_100389301 | Ga0070698_1003893012 | 142 |
| 133 | 3300005518 | Ga0070699_100013714 | Ga0070699_1000137147 | 142 |
| 134 | 3300005518 | Ga0070699_100052857 | Ga0070699_1000528571 | 142 |
| 135 | 3300005518 | Ga0070699_100304066 | Ga0070699_1003040662 | 142 |
| 136 | 3300005518 | Ga0070699_100460697 | Ga0070699_1004606971 | 142 |
| 137 | 3300005518 | Ga0070699_100565205 | Ga0070699_1005652052 | 142 |
| 138 | 3300005518 | Ga0070699_100654006 | Ga0070699_1006540062 | 142 |
| 139 | 3300005518 | Ga0070699_101077383 | Ga0070699_1010773831 | 142 |
| 140 | 3300005536 | Ga0070697_100001229 | Ga0070697_10000122911 | 142 |
| 141 | 3300005536 | Ga0070697_100022807 | Ga0070697_1000228071 | 142 |
| 142 | 3300005536 | Ga0070697_100187192 | Ga0070697_1001871923 | 142 |
| 143 | 3300005536 | Ga0070697_100854893 | Ga0070697_1008548932 | 142 |
| 144 | 3300005536 | Ga0070697_100953223 | Ga0070697_1009532232 | 142 |
| 145 | 3300005543 | Ga0070672_100087238 | Ga0070672_1000872382 | 142 |
| 146 | 3300005544 | Ga0070686_100216076 | Ga0070686_1002160762 | 142 |
| 147 | 3300005544 | Ga0070686_100231248 | Ga0070686_1002312482 | 142 |
| 148 | 3300005546 | Ga0070696_100895271 | Ga0070696_1008952711 | 142 |
| 149 | 3300005548 | Ga0070665_100016810 | Ga0070665_1000168107 | 142 |
| 150 | 3300005549 | Ga0070704_100020192 | Ga0070704_1000201923 | 142 |
| 151 | 3300005549 | Ga0070704_100133475 | Ga0070704_1001334754 | 142 |
| 152 | 3300005564 | Ga0070664_100677201 | Ga0070664_1006772012 | 142 |
| 153 | 3300005614 | Ga0068856_100001489 | Ga0068856_1000014897 | 142 |
| 154 | 3300005617 | Ga0068859_100000008 | Ga0068859_100000008241 | 142 |
| 155 | 3300005617 | Ga0068859_100005328 | Ga0068859_1000053287 | 142 |
| 156 | 3300005618 | Ga0068864_100082215 | Ga0068864_1000822154 | 142 |
| 157 | 3300005718 | Ga0068866_10035116 | Ga0068866_100351162 | 142 |
| 158 | 3300005841 | Ga0068863_100059491 | Ga0068863_1000594912 | 142 |
| 159 | 3300005841 | Ga0068863_100215707 | Ga0068863_1002157072 | 142 |
| 160 | 3300005841 | Ga0068863_100315926 | Ga0068863_1003159262 | 142 |
| 161 | 3300005842 | Ga0068858_100001323 | Ga0068858_1000013239 | 142 |
| 162 | 3300005842 | Ga0068858_100097596 | Ga0068858_1000975962 | 142 |
| 163 | 3300005843 | Ga0068860_100010880 | Ga0068860_1000108804 | 142 |
| 164 | 3300005843 | Ga0068860_100345700 | Ga0068860_1003457002 | 142 |
| 165 | 3300006173 | Ga0070716_100019183 | Ga0070716_1000191833 | 142 |
| 166 | 3300006173 | Ga0070716_100133900 | Ga0070716_1001339002 | 142 |
| 167 | 3300006173 | Ga0070716_100438857 | Ga0070716_1004388573 | 142 |
| 168 | 3300006237 | Ga0097621_100094038 | Ga0097621_1000940383 | 142 |
| 169 | 3300006358 | Ga0068871_100102289 | Ga0068871_1001022893 | 142 |
| 170 | 3300006844 | Ga0075428_100039902 | Ga0075428_1000399025 | 142 |
| 171 | 3300006844 | Ga0075428_102022989 | Ga0075428_1020229891 | 142 |
| 172 | 3300006844 | Ga0075428_102025075 | Ga0075428_1020250752 | 142 |
| 173 | 3300006847 | Ga0075431_100493000 | Ga0075431_1004930002 | 142 |
| 174 | 3300006847 | Ga0075431_100582935 | Ga0075431_1005829352 | 142 |
| 175 | 3300006852 | Ga0075433_10093488 | Ga0075433_100934883 | 142 |
| 176 | 3300006852 | Ga0075433_10108470 | Ga0075433_101084702 | 142 |
| 177 | 3300006852 | Ga0075433_11213855 | Ga0075433_112138552 | 142 |
| 178 | 3300006871 | Ga0075434_100006895 | Ga0075434_10000689512 | 142 |
| 179 | 3300006871 | Ga0075434_101078540 | Ga0075434_1010785402 | 142 |
| 180 | 3300006881 | Ga0068865_100002374 | Ga0068865_1000023748 | 142 |
| 181 | 3300006881 | Ga0068865_101185791 | Ga0068865_1011857912 | 142 |
| 182 | 3300006914 | Ga0075436_100000059 | Ga0075436_10000005949 | 142 |
| 183 | 3300006914 | Ga0075436_100034914 | Ga0075436_1000349142 | 142 |
| 184 | 3300006914 | Ga0075436_100525465 | Ga0075436_1005254652 | 142 |
| 185 | 3300006914 | Ga0075436_101121629 | Ga0075436_1011216292 | 142 |
| 186 | 3300006931 | Ga0097620_100000008 | Ga0097620_100000008241 | 142 |
| 187 | 3300006931 | Ga0097620_100005328 | Ga0097620_1000053287 | 142 |
| 188 | 3300007076 | Ga0075435_100005252 | Ga0075435_1000052522 | 142 |
| 189 | 3300007076 | Ga0075435_101363064 | Ga0075435_1013630641 | 142 |
| 190 | 3300009094 | Ga0111539_11737811 | Ga0111539_117378112 | 142 |
| 191 | 3300009101 | Ga0105247_10106300 | Ga0105247_101063002 | 142 |
| 192 | 3300009147 | Ga0114129_10017906 | Ga0114129_1001790612 | 142 |
| 193 | 3300009147 | Ga0114129_10020219 | Ga0114129_100202193 | 142 |
| 194 | 3300009147 | Ga0114129_10047146 | Ga0114129_100471464 | 142 |
| 195 | 3300009147 | Ga0114129_11219609 | Ga0114129_112196092 | 142 |
| 196 | 3300009147 | Ga0114129_11378459 | Ga0114129_113784591 | 142 |
| 197 | 3300009147 | Ga0114129_11544078 | Ga0114129_115440781 | 142 |
| 198 | 3300009147 | Ga0114129_12066378 | Ga0114129_120663781 | 142 |
| 199 | 3300009147 | Ga0114129_12292695 | Ga0114129_122926951 | 142 |
| 200 | 3300009148 | Ga0105243_10660272 | Ga0105243_106602721 | 142 |
| 201 | 3300009176 | Ga0105242_10120353 | Ga0105242_101203532 | 142 |
| 202 | 3300009177 | Ga0105248_10016816 | Ga0105248_100168164 | 142 |
| 203 | 3300010159 | Ga0099796_10018424 | Ga0099796_100184242 | 142 |
| 204 | 3300013100 | Ga0157373_10219713 | Ga0157373_102197131 | 142 |
| 205 | 3300013297 | Ga0157378_10002910 | Ga0157378_1000291015 | 142 |
| 206 | 3300013308 | Ga0157375_10000351 | Ga0157375_1000035124 | 142 |
| 207 | 3300014325 | Ga0163163_10387366 | Ga0163163_103873662 | 142 |
| 208 | 3300014326 | Ga0157380_10158760 | Ga0157380_101587604 | 142 |
| 209 | 3300014968 | Ga0157379_10003272 | Ga0157379_100032727 | 142 |
| 210 | 3300014969 | Ga0157376_10004421 | Ga0157376_100044215 | 142 |
| 211 | 3300014969 | Ga0157376_10627599 | Ga0157376_106275992 | 142 |
| 212 | 3300025898 | Ga0207692_10178096 | Ga0207692_101780961 | 142 |
| 213 | 3300025900 | Ga0207710_10147696 | Ga0207710_101476962 | 142 |
| 214 | 3300025903 | Ga0207680_10000711 | Ga0207680_100007115 | 142 |
| 215 | 3300025906 | Ga0207699_10000065 | Ga0207699_1000006558 | 142 |
| 216 | 3300025906 | Ga0207699_10750672 | Ga0207699_107506722 | 142 |
| 217 | 3300025910 | Ga0207684_10021094 | Ga0207684_100210942 | 142 |
| 218 | 3300025910 | Ga0207684_10102429 | Ga0207684_101024292 | 142 |
| 219 | 3300025910 | Ga0207684_10108684 | Ga0207684_101086842 | 142 |
| 220 | 3300025910 | Ga0207684_10133686 | Ga0207684_101336863 | 142 |
| 221 | 3300025910 | Ga0207684_10145669 | Ga0207684_101456693 | 142 |
| 222 | 3300025910 | Ga0207684_10599139 | Ga0207684_105991392 | 142 |
| 223 | 3300025910 | Ga0207684_11263504 | Ga0207684_112635042 | 142 |
| 224 | 3300025922 | Ga0207646_10011284 | Ga0207646_100112848 | 142 |
| 225 | 3300025922 | Ga0207646_10146963 | Ga0207646_101469632 | 142 |
| 226 | 3300025922 | Ga0207646_10149985 | Ga0207646_101499852 | 142 |
| 227 | 3300025922 | Ga0207646_10229935 | Ga0207646_102299352 | 142 |
| 228 | 3300025922 | Ga0207646_10283540 | Ga0207646_102835402 | 142 |
| 229 | 3300025928 | Ga0207700_11525364 | Ga0207700_115253641 | 142 |
| 230 | 3300025935 | Ga0207709_10506061 | Ga0207709_105060611 | 142 |
| 231 | 3300025936 | Ga0207670_10009473 | Ga0207670_100094735 | 142 |
| 232 | 3300025938 | Ga0207704_10005879 | Ga0207704_100058795 | 142 |
| 233 | 3300025940 | Ga0207691_10002450 | Ga0207691_1000245016 | 142 |
| 234 | 3300025941 | Ga0207711_10080898 | Ga0207711_100808983 | 142 |
| 235 | 3300025960 | Ga0207651_10012037 | Ga0207651_100120375 | 142 |
| 236 | 3300025986 | Ga0207658_10010739 | Ga0207658_100107395 | 142 |
| 237 | 3300025986 | Ga0207658_10103912 | Ga0207658_101039122 | 142 |
| 238 | 3300026035 | Ga0207703_10013181 | Ga0207703_100131813 | 142 |
| 239 | 3300026067 | Ga0207678_10004342 | Ga0207678_100043426 | 142 |
| 240 | 3300026078 | Ga0207702_10054466 | Ga0207702_100544663 | 142 |
| 241 | 3300026088 | Ga0207641_10087824 | Ga0207641_100878243 | 142 |
| 242 | 3300026088 | Ga0207641_10139085 | Ga0207641_101390852 | 142 |
| 243 | 3300026088 | Ga0207641_10366306 | Ga0207641_103663062 | 142 |
| 244 | 3300026089 | Ga0207648_10006975 | Ga0207648_100069758 | 142 |
| 245 | 3300026089 | Ga0207648_11520780 | Ga0207648_115207802 | 142 |
| 246 | 3300026095 | Ga0207676_10021773 | Ga0207676_100217733 | 142 |
| 247 | 3300028379 | Ga0268266_10009737 | Ga0268266_100097378 | 142 |
| 248 | 3300028381 | Ga0268264_10001503 | Ga0268264_1000150314 | 142 |
| 249 | 3300028381 | Ga0268264_10896549 | Ga0268264_108965492 | 142 |
| 250 | 3300028577 | Ga0265318_10029006 | Ga0265318_100290062 | 142 |
| 251 | 3300031241 | Ga0265325_10158728 | Ga0265325_101587282 | 142 |
| 252 | 3300031249 | Ga0265339_10097146 | Ga0265339_100971463 | 142 |
| 253 | 3300031548 | Ga0307408_100333915 | Ga0307408_1003339152 | 142 |
| 254 | 3300031901 | Ga0307406_10186676 | Ga0307406_101866762 | 142 |
| 255 | 3300031911 | Ga0307412_10046197 | Ga0307412_100461973 | 142 |
| 256 | 3300032002 | Ga0307416_100006882 | Ga0307416_1000068822 | 142 |
| 257 | 3300032002 | Ga0307416_100026616 | Ga0307416_1000266163 | 142 |
| 258 | 3300032126 | Ga0307415_100266146 | Ga0307415_1002661462 | 142 |
| 259 | 3300035695 | Ga0373927_0081768 | Ga0373927_0081768_1415_1849 | 142 |
| 260 | 3300035724 | Ga0373933_0856959 | Ga0373933_0856959_34_468 | 142 |
| 261 | 3300036401 | Ga0373937_0006880 | Ga0373937_0006880_8711_9160 | 142 |
| 262 | 3300036401 | Ga0373937_0125677 | Ga0373937_0125677_618_1085 | 142 |
| 263 | 3300036401 | Ga0373937_1130392 | Ga0373937_1130392_125_568 | 142 |
| 264 | 3300037068 | Ga0373925_0062020 | Ga0373925_0062020_2271_2705 | 142 |
| 265 | 3300042437 | Ga0439444_0072974 | Ga0439444_0072974_57_497 | 142 |
| 266 | 3300044673 | Ga0453683_0055521 | Ga0453683_0055521_224_655 | 142 |
| 267 | 3300044673 | Ga0453683_0151118 | Ga0453683_0151118_993_1427 | 142 |
| 268 | 3300044673 | Ga0453683_0235799 | Ga0453683_0235799_661_1092 | 142 |
| 269 | 3300045976 | Ga0466967_2304397 | Ga0466967_2304397_43_501 | 142 |
| 270 | 3300046462 | Ga0495651_0578393 | Ga0495651_0578393_105_536 | 142 |
| 271 | 3300046472 | Ga0495580_0112552 | Ga0495580_0112552_413_850 | 142 |
| 272 | 3300046473 | Ga0495582_0062388 | Ga0495582_0062388_51_494 | 142 |
| 273 | 3300047318 | Ga0495636_0196768 | Ga0495636_0196768_341_778 | 142 |
| 274 | 3300048090 | Ga0495615_0011546 | Ga0495615_0011546_328_768 | 142 |
| 275 | 3300048903 | Ga0496100_0168374 | Ga0496100_0168374_590_1018 | 142 |
| 276 | 3300048905 | Ga0496102_0002239 | Ga0496102_0002239_10692_11120 | 142 |
| 277 | 3300048906 | Ga0496103_0005032 | Ga0496103_0005032_52_480 | 142 |
| 278 | 3300048907 | Ga0496104_0204556 | Ga0496104_0204556_1054_1575 | 142 |
| 279 | 3300048907 | Ga0496104_1646774 | Ga0496104_1646774_39_467 | 142 |
| 280 | 3300048908 | Ga0496105_0310586 | Ga0496105_0310586_475_903 | 142 |
| 281 | 3300048909 | Ga0496106_0006552 | Ga0496106_0006552_7492_7920 | 142 |
| 282 | 3300048910 | Ga0496107_0004879 | Ga0496107_0004879_4994_5422 | 142 |
| 283 | 3300048911 | Ga0496108_0003756 | Ga0496108_0003756_3568_4089 | 142 |
| 284 | 3300048912 | Ga0496109_0058863 | Ga0496109_0058863_1790_2218 | 142 |
| 285 | 3300048913 | Ga0496110_0046132 | Ga0496110_0046132_1113_1541 | 142 |
| 286 | 3300048914 | Ga0496111_0039796 | Ga0496111_0039796_1903_2424 | 142 |
| 287 | 3300048914 | Ga0496111_0080007 | Ga0496111_0080007_646_1074 | 142 |
| 288 | 3300048914 | Ga0496111_0106183 | Ga0496111_0106183_734_1165 | 142 |
| 289 | 3300048915 | Ga0496112_0028412 | Ga0496112_0028412_2669_3190 | 142 |
| 290 | 3300048918 | Ga0496115_0100740 | Ga0496115_0100740_462_890 | 142 |
| 291 | 3300049574 | Ga0501038_0342493 | Ga0501038_0342493_179_670 | 142 |
| 292 | 3300049585 | Ga0501069_0113329 | Ga0501069_0113329_891_1397 | 142 |
| 293 | 3300049668 | Ga0501233_035109 | Ga0501233_035109_151_600 | 142 |
| 294 | 3300050507 | nmdc:mga05p37_1659412_c1 | nmdc:mga05p37_1659412_c1_77_523 | 142 |
| 295 | 3300050509 | nmdc:mga0qj67_489294_c1 | nmdc:mga0qj67_489294_c1_489_929 | 142 |
| 296 | 3300050510 | nmdc:mga06r32_605265_c1 | nmdc:mga06r32_605265_c1_72_512 | 142 |
| 297 | 3300050511 | nmdc:mga08y16_1369454_c1 | nmdc:mga08y16_1369454_c1_211_657 | 142 |
| 298 | 3300050512 | nmdc:mga0n895_1022126_c1 | nmdc:mga0n895_1022126_c1_127_561 | 142 |
| 299 | 3300050512 | nmdc:mga0n895_75769_c1 | nmdc:mga0n895_75769_c1_1423_1869 | 142 |
| 300 | 3300050512 | nmdc:mga0n895_87649_c1 | nmdc:mga0n895_87649_c1_588_1031 | 142 |
| 301 | 3300050513 | nmdc:mga0rr50_34478_c1 | nmdc:mga0rr50_34478_c1_2462_2905 | 142 |
| 302 | 3300050513 | nmdc:mga0rr50_796341_c1 | nmdc:mga0rr50_796341_c1_161_592 | 142 |
| 303 | 3300050514 | nmdc:mga08x19_1037553_c1 | nmdc:mga08x19_1037553_c1_16_459 | 142 |
| 304 | 3300050514 | nmdc:mga08x19_15020_c1 | nmdc:mga08x19_15020_c1_3589_4041 | 142 |
| 305 | 3300050514 | nmdc:mga08x19_91198_c1 | nmdc:mga08x19_91198_c1_633_1079 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hy5-assembly1.cif.gz_A | structure of d-amino acid oxidase mutant r38h | 0.695 | 1 | 33 |
| 1ib6-assembly1.cif.gz_B | crystal structure of r153c e. coli malate dehydrogenase | 0.6337 | 1 | 32 |
| 3tmg-assembly4.cif.gz_D | crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi | 0.6331 | 1 | 48 |
| 3uki-assembly2.cif.gz_D | crystal structure of reduced oxyr from porphyromonas gingivalis | 0.6221 | 1 | 48 |
| 3onm-assembly1.cif.gz_B | effector binding domain of lysr-type transcription factor rovm from y. pseudotuberculosis | 0.6194 | 1 | 49 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3b8bA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.7114 | 1 | 48 | 3.40.190.80 |
| af_Q76KC5_1_143_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6339 | 1 | 50 | 3.40.50.2300 |
| af_Q2FV83_76_274_3.40.190.290 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.6232 | 1 | 49 | 3.40.190.290 |
| 3onmB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6194 | 1 | 49 | 3.40.190.10 |
| 2v25B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.6169 | 1 | 48 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838PGD4-F1-model_v4 | Chromate resistance protein | 0.9955 | 1 | 94 |
|
| AF-A0A317HYA3-F1-model_v4 | Chromate resistance protein | 0.9952 | 1 | 73 |
|
| AF-A0A534T345-F1-model_v4 | Chromate resistance protein | 0.995 | 2 | 141 |
|
| AF-A0A534QE41-F1-model_v4 | Chromate resistance protein | 0.9949 | 1 | 141 |
|
| AF-A0A535A594-F1-model_v4 | Chromate resistance protein | 0.9912 | 1 | 141 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar