F398280

General Info

Members Datasets Scaffolds Average Seq Length
305 209 283 290

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0000408|Ga0495610_0000408_3761_4816
Length 351
Sequence MNRQSHKTKKPFLVFFDLQESANKKCRNLPLRLSFSRHLKTSNPLHICMVNTDQKKLNRLMKNLFKTSNPLKSVLIMILMLFTATQSKGQQTKPAASGYAPVKGTKVYYEVYGEGKPLILLHGAFMTIETNWGQLIPELSKTRKVIAIELQGHGHSPYSDRKLELPTLASDVEAVMSQLKVDSADVVGYSMGGSVAYQLIVQSPKRVNKLVIISSTYKTTGWMPAVTSAFKGMKPEFLANTPMKTAYDAIAPDKTKWNSFLEQMIDFVKVPFDMGDANIAKITSPVLLIAGDNDGLDKIELIKTYQLLGGAVFADMGKMPKSQLAVVPAQGHVSLMMQTKTILGYLDGFLK

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
3 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541278 Niastella sp. CF465 Isolate Unclassified
6 2738541283 Pedobacter sp. OK701 Isolate Unclassified
7 2739367651 Pedobacter sp. OK291 Isolate Unclassified
8 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
9 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
10 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
11 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
12 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
13 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
14 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
15 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
16 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
17 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
18 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
19 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
20 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
21 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
22 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
195 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
196 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
197 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
198 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
199 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
209 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 0
Rhizoplane 0.33
Rhizosphere 75.08
Stem 0
Stem Tuber 0
Unclassified 9.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000062 3300001979 Bacteria 34499
2 JGI25152J39213_1000135 3300002773 Bacteria 50172
3 JGI25150J39212_1000001 3300002774 Bacteria 1318726
4 JGI25151J46595_10000005 3300003187 Bacteria 431598
5 JGI25406J46586_10025543 3300003203 Bacteria 2292
6 JGI25153J46596_10000018 3300003215 Bacteria 269774
7 JGI25153J46596_10000435 3300003215 Bacteria 26902
8 rootH2_10000040 3300003320 Bacteria 68084
9 rootH2_10025005 3300003320 Bacteria 33515
10 rootH1_10014287 3300003323 Bacteria 22862
11 rootH1_10206465 3300003323 Bacteria 3977
12 JGI25160J50197_1000886 3300003354 Bacteria 15763
13 JGI25160J50197_1010512 3300003354 Bacteria 3340
14 Ga0055531_10000118 3300003794 Bacteria 88104
15 Ga0065165_1043863 3300005262 Bacteria 1311
16 Ga0065714_10004848 3300005288 Bacteria 5141
17 Ga0065714_10069817 3300005288 Bacteria 4078
18 Ga0070658_10000016 3300005327 Bacteria 228551
19 Ga0070658_10246815 3300005327 Bacteria 1514
20 Ga0070670_100137349 3300005331 Bacteria 2113
21 Ga0070666_10000071 3300005335 Bacteria 75539
22 Ga0070680_100004385 3300005336 Bacteria 10624
23 Ga0070682_100003149 3300005337 Bacteria 9135
24 Ga0070660_100037747 3300005339 Bacteria 3663
25 Ga0070691_10051303 3300005341 Bacteria 1970
26 Ga0070671_100003575 3300005355 Bacteria 12159
27 Ga0070671_100062215 3300005355 Bacteria 3109
28 Ga0070671_100208604 3300005355 Bacteria 1657
29 Ga0070674_100010305 3300005356 Bacteria 5645
30 Ga0070674_100202194 3300005356 Bacteria 1535
31 Ga0070667_100121558 3300005367 Bacteria 2271
32 Ga0070667_100131488 3300005367 Bacteria 2185
33 Ga0070667_100208889 3300005367 Bacteria 1735
34 Ga0070711_100275058 3300005439 Bacteria 1330
35 Ga0070711_100364172 3300005439 Bacteria 1165
36 Ga0070663_100134266 3300005455 Bacteria 1883
37 Ga0070681_10034462 3300005458 Bacteria 5083
38 Ga0068867_100137172 3300005459 Bacteria 1908
39 Ga0070707_100253222 3300005468 Bacteria 1714
40 Ga0070679_100016964 3300005530 Bacteria 7039
41 Ga0070679_100258304 3300005530 Bacteria 1697
42 Ga0070684_100278453 3300005535 Bacteria 1532
43 Ga0068853_100084998 3300005539 Bacteria 2773
44 Ga0070665_100000014 3300005548 Bacteria 484881
45 Ga0070665_100000147 3300005548 Bacteria 129683
46 Ga0068855_100000093 3300005563 Bacteria 106968
47 Ga0068855_100015217 3300005563 Bacteria 9262
48 Ga0068855_100032611 3300005563 Bacteria 6218
49 Ga0068855_100061139 3300005563 Bacteria 4402
50 Ga0068857_100029515 3300005577 Bacteria 4840
51 Ga0068856_100021785 3300005614 Bacteria 6228
52 Ga0068856_100027276 3300005614 Bacteria 5573
53 Ga0068856_100036548 3300005614 Bacteria 4815
54 Ga0068856_100165505 3300005614 Bacteria 2222
55 Ga0068852_100002246 3300005616 Bacteria 13261
56 Ga0068859_100000029 3300005617 Bacteria 178422
57 Ga0068864_100193464 3300005618 Bacteria 1865
58 Ga0068863_100002616 3300005841 Bacteria 17843
59 Ga0068863_100470814 3300005841 Bacteria 1235
60 Ga0068858_100556898 3300005842 Bacteria 1110
61 Ga0068860_100000003 3300005843 Bacteria 575741
62 Ga0068860_100001496 3300005843 Bacteria 25223
63 Ga0081539_10012526 3300005985 Bacteria 6519
64 Ga0075366_10000531 3300006195 Bacteria 17683
65 Ga0075366_10001256 3300006195 Bacteria 12596
66 Ga0097621_100109898 3300006237 Bacteria 2329
67 Ga0068871_100146199 3300006358 Bacteria 2013
68 Ga0075429_100013777 3300006880 Bacteria 7011
69 Ga0068865_100034202 3300006881 Bacteria 3409
70 Ga0097620_100000029 3300006931 Bacteria 178422
71 Ga0105244_10000080 3300009036 Bacteria 106764
72 Ga0105240_10031451 3300009093 Bacteria 6883
73 Ga0105240_10039076 3300009093 Bacteria 6080
74 Ga0105240_10065352 3300009093 Bacteria 4516
75 Ga0105240_10067907 3300009093 Bacteria 4417
76 Ga0105240_10296605 3300009093 Bacteria 1851
77 Ga0105240_10484351 3300009093 Bacteria 1378
78 Ga0111539_10012072 3300009094 Bacteria 10835
79 Ga0105247_10138354 3300009101 Bacteria 1593
80 Ga0105241_10000547 3300009174 Bacteria 28379
81 Ga0105241_10016964 3300009174 Bacteria 5345
82 Ga0105242_10059337 3300009176 Bacteria 3139
83 Ga0105237_10001790 3300009545 Bacteria 27800
84 Ga0105237_10005439 3300009545 Bacteria 14381
85 Ga0105237_10044026 3300009545 Bacteria 4495
86 Ga0105237_10073930 3300009545 Bacteria 3400
87 Ga0105249_10020916 3300009553 Bacteria 5851
88 Ga0105239_10099692 3300010375 Bacteria 3212
89 Ga0105239_10160192 3300010375 Bacteria 2514
90 Ga0105246_10006849 3300011119 Bacteria 6970
91 Ga0157370_10033764 3300013104 Bacteria 4986
92 Ga0157370_10104866 3300013104 Bacteria 2646
93 Ga0157369_10000117 3300013105 Bacteria 111900
94 Ga0157369_10065089 3300013105 Bacteria 3925
95 Ga0157374_10299040 3300013296 Bacteria 1592
96 Ga0157378_10029400 3300013297 Bacteria 4850
97 Ga0157378_10035390 3300013297 Bacteria 4416
98 Ga0157378_10203906 3300013297 Bacteria 1872
99 Ga0163162_10000914 3300013306 Bacteria 27441
100 Ga0163162_10001406 3300013306 Bacteria 22404
101 Ga0157375_10050067 3300013308 Bacteria 4097
102 Ga0157375_10163794 3300013308 Bacteria 2367
103 Ga0163163_10205207 3300014325 Bacteria 2019
104 Ga0157376_10033913 3300014969 Bacteria 4116
105 Ga0157376_10056582 3300014969 Bacteria 3277
106 Ga0182006_1000202 3300015261 Bacteria 61447
107 Ga0182006_1000286 3300015261 Bacteria 44565
108 Ga0182007_10000007 3300015262 Bacteria 376596
109 Ga0183373_1001 3300015682 Bacteria 1410374
110 Ga0163161_10000498 3300017792 Bacteria 32292
111 Ga0163161_10001976 3300017792 Bacteria 14880
112 Ga0207425_1000002 3300025245 Bacteria 1362590
113 Ga0209646_1000003 3300025246 Bacteria 1160860
114 Ga0209026_1000334 3300025250 Bacteria 45711
115 Ga0209129_1000002 3300025258 Bacteria 1359086
116 Ga0209129_1006306 3300025258 Bacteria 3884
117 Ga0209130_1001631 3300025284 Bacteria 13815
118 Ga0209025_1000004 3300025294 Bacteria 1361782
119 Ga0209758_1000006 3300025297 Bacteria 1359562
120 Ga0209758_1002380 3300025297 Bacteria 19358
121 Ga0209050_1001044 3300025298 Bacteria 34198
122 Ga0207426_1000032 3300025302 Bacteria 457997
123 Ga0207426_1000310 3300025302 Bacteria 96036
124 Ga0207426_1000364 3300025302 Bacteria 80671
125 Ga0209257_1000007 3300025304 Bacteria 1564415
126 Ga0207656_10043384 3300025321 Bacteria 1918
127 Ga0207655_1000623 3300025728 Bacteria 42520
128 Ga0207680_10000420 3300025903 Bacteria 20179
129 Ga0207647_10029599 3300025904 Bacteria 3541
130 Ga0207705_10000031 3300025909 Bacteria 228571
131 Ga0207705_10021188 3300025909 Bacteria 4635
132 Ga0207654_10000506 3300025911 Bacteria 22265
133 Ga0207654_10074452 3300025911 Bacteria 2027
134 Ga0207707_10019937 3300025912 Bacteria 5853
135 Ga0207707_10134322 3300025912 Bacteria 2163
136 Ga0207695_10008096 3300025913 Bacteria 13223
137 Ga0207695_10054586 3300025913 Bacteria 4170
138 Ga0207695_10542102 3300025913 Bacteria 1045
139 Ga0207671_10006759 3300025914 Bacteria 10146
140 Ga0207671_10025732 3300025914 Bacteria 4417
141 Ga0207671_10329783 3300025914 Bacteria 1208
142 Ga0207663_10181915 3300025916 Bacteria 1502
143 Ga0207660_10002440 3300025917 Bacteria 12212
144 Ga0207660_10036170 3300025917 Bacteria 3432
145 Ga0207657_10028886 3300025919 Bacteria 5052
146 Ga0207652_10000077 3300025921 Bacteria 106573
147 Ga0207650_10168026 3300025925 Bacteria 1742
148 Ga0207644_10007249 3300025931 Bacteria 7219
149 Ga0207644_10408339 3300025931 Bacteria 1111
150 Ga0207686_10000793 3300025934 Bacteria 19399
151 Ga0207669_10172712 3300025937 Bacteria 1540
152 Ga0207669_10186809 3300025937 Bacteria 1491
153 Ga0207704_10101727 3300025938 Bacteria 1917
154 Ga0207689_10005928 3300025942 Bacteria 10820
155 Ga0207689_10320378 3300025942 Bacteria 1286
156 Ga0207667_10000939 3300025949 Bacteria 37174
157 Ga0207667_10012256 3300025949 Bacteria 9898
158 Ga0207712_10063989 3300025961 Bacteria 2620
159 Ga0207640_10348490 3300025981 Bacteria 1189
160 Ga0207640_10382196 3300025981 Bacteria 1141
161 Ga0207640_10499909 3300025981 Bacteria 1012
162 Ga0207658_10120184 3300025986 Bacteria 2093
163 Ga0207639_10011786 3300026041 Bacteria 6079
164 Ga0207639_10027874 3300026041 Bacteria 4119
165 Ga0207639_10676032 3300026041 Bacteria 956
166 Ga0207678_10030514 3300026067 Bacteria 4705
167 Ga0207678_10472389 3300026067 Bacteria 1091
168 Ga0207702_10298160 3300026078 Bacteria 1529
169 Ga0207641_10001396 3300026088 Bacteria 23778
170 Ga0207641_10046727 3300026088 Bacteria 3650
171 Ga0207648_10067043 3300026089 Unclassified 3130
172 Ga0207676_10066724 3300026095 Bacteria 2871
173 Ga0207676_10093382 3300026095 Bacteria 2477
174 Ga0207676_10301857 3300026095 Bacteria 1462
175 Ga0207674_10007593 3300026116 Bacteria 12635
176 Ga0207698_10005444 3300026142 Bacteria 7870
177 Ga0268266_10000030 3300028379 Bacteria 417120
178 Ga0268266_10000048 3300028379 Bacteria 310336
179 Ga0268264_10000028 3300028381 Bacteria 426662
180 Ga0268264_10004114 3300028381 Bacteria 12444
181 Ga0268264_10043119 3300028381 Bacteria 3737
182 Ga0307517_10003455 3300028786 Bacteria 24570
183 Ga0307515_10000001 3300028794 Bacteria 4259510
184 Ga0307515_10000300 3300028794 Bacteria 122040
185 Ga0307515_10002851 3300028794 Bacteria 36796
186 Ga0307515_10178797 3300028794 Bacteria 2081
187 Ga0307515_10287880 3300028794 Bacteria 1342
188 Ga0307511_10000429 3300030521 Bacteria 44853
189 Ga0265327_10000031 3300031251 Bacteria 325718
190 Ga0307513_10039126 3300031456 Bacteria 5259
191 Ga0307513_10404958 3300031456 Bacteria 1098
192 Ga0307509_10023681 3300031507 Bacteria 6885
193 Ga0307509_10238588 3300031507 Bacteria 1613
194 Ga0307405_10000047 3300031731 Bacteria 68371
195 Ga0307412_10000009 3300031911 Bacteria 445987
196 Ga0307412_10502388 3300031911 Bacteria 1010
197 Ga0307416_100000033 3300032002 Bacteria 156736
198 Ga0307414_10000697 3300032004 Bacteria 17211
199 Ga0307510_10000197 3300033180 Bacteria 52492
200 Ga0373941_0026686 3300035115 Bacteria 1679
201 Ga0373924_0178024 3300035410 Bacteria 936
202 Ga0373925_0212645 3300037068 Bacteria 1541
203 Ga0395899_0000001 3300037312 Bacteria 1750322
204 Ga0395899_0032325 3300037312 Bacteria 3930
205 Ga0395898_0009160 3300037466 Bacteria 10428
206 Ga0436361_0499494 3300039447 Bacteria 12745
207 Ga0439462_0002669 3300042015 Bacteria 4186
208 Ga0466972_0000057 3300044658 Bacteria 110775
209 Ga0466972_0010772 3300044658 Bacteria 4589
210 Ga0466972_0042808 3300044658 Bacteria 2200
211 Ga0466966_0000276 3300044684 Bacteria 33634
212 Ga0466970_0043144 3300044765 Bacteria 2399
213 Ga0466957_0004385 3300044842 Bacteria 7849
214 Ga0466959_0000010 3300045049 Bacteria 176306
215 Ga0466959_0225972 3300045049 Bacteria 1297
216 Ga0495627_027071 3300046453 Bacteria 1843
217 Ga0495638_0051974 3300046460 Bacteria 2554
218 Ga0495650_0000349 3300046471 Bacteria 81735
219 Ga0495580_0238314 3300046472 Bacteria 1248
220 Ga0495664_0266833 3300046477 Bacteria 1035
221 Ga0495585_0000194 3300046492 Bacteria 62923
222 Ga0495583_0011520 3300046506 Bacteria 5072
223 Ga0495606_0000009 3300046507 Bacteria 306313
224 Ga0495606_0008651 3300046507 Bacteria 8790
225 Ga0495606_0021440 3300046507 Bacteria 4733
226 Ga0495606_0220692 3300046507 Bacteria 1068
227 Ga0495610_0000408 3300046512 Bacteria 44066
228 Ga0495610_0044252 3300046512 Bacteria 2211
229 Ga0495616_0000760 3300046513 Bacteria 23568
230 Ga0495631_0001050 3300046518 Bacteria 17149
231 Ga0495632_0001589 3300046519 Bacteria 18738
232 Ga0495632_0079015 3300046519 Bacteria 1571
233 Ga0495637_0021258 3300046520 Bacteria 2978
234 Ga0495648_0026231 3300046524 Bacteria 3927
235 Ga0495663_0039830 3300046525 Bacteria 1425
236 Ga0495609_0017170 3300046538 Bacteria 3363
237 Ga0495597_0145285 3300046542 Bacteria 976
238 Ga0495633_0001092 3300046558 Bacteria 21904
239 Ga0495633_0126533 3300046558 Bacteria 1182
240 Ga0495668_0000114 3300046616 Bacteria 127503
241 Ga0495611_0065647 3300046648 Bacteria 1654
242 Ga0495625_0000007 3300046660 Bacteria 565749
243 Ga0495625_0001321 3300046660 Bacteria 30823
244 Ga0495625_0005427 3300046660 Bacteria 11639
245 Ga0495625_0191575 3300046660 Bacteria 1354
246 Ga0495635_0283493 3300046663 Bacteria 1113
247 Ga0495661_0006546 3300046665 Bacteria 8183
248 Ga0495661_0008575 3300046665 Bacteria 7067
249 Ga0495646_0161936 3300046680 Bacteria 1238
250 Ga0495649_0000007 3300046694 Bacteria 518037
251 Ga0495672_0014589 3300047320 Bacteria 5373
252 Ga0495672_0052123 3300047320 Bacteria 2405
253 Ga0495687_000278 3300047443 Bacteria 67787
254 Ga0495677_0025944 3300047445 Bacteria 2126
255 Ga0495681_0023324 3300047470 Bacteria 3291
256 Ga0495686_0000402 3300047472 Bacteria 68501
257 Ga0496122_0002276 3300048925 Bacteria 27777
258 Ga0496125_0118544 3300048928 Bacteria 1895
259 Ga0501221_017130 3300049704 Bacteria 1380
260 Ga0501080_0538270 3300049742 Bacteria 1041
261 nmdc:mga0k408_433_c1 3300050493 Bacteria 17055
262 nmdc:mga0k408_807_c1 3300050493 Bacteria 17256
263 Ga0500578_0000009 3300053086 Bacteria 219807
264 Ga0500646_0024349 3300053090 Bacteria 1630
265 Ga0500583_0000050 3300053092 Bacteria 77416
266 Ga0500583_0000764 3300053092 Bacteria 9334
267 Ga0500583_0001356 3300053092 Bacteria 7015
268 Ga0500650_0093557 3300053098 Bacteria 1407
269 Ga0500569_000103 3300053109 Bacteria 13276
270 Ga0500608_002264 3300053122 Bacteria 6956
271 Ga0500618_000020 3300053125 Bacteria 161356
272 Ga0500618_018493 3300053125 Bacteria 1723
273 Ga0500642_0068065 3300053130 Bacteria 1615
274 Ga0500652_031963 3300053131 Bacteria 2069
275 Ga0500658_0036175 3300053134 Bacteria 1958
276 Ga0500559_0008989 3300053136 Bacteria 4346
277 Ga0500577_0002367 3300053142 Bacteria 4811
278 Ga0500589_034543 3300053147 Bacteria 2360
279 Ga0500604_0006941 3300053151 Bacteria 2998
280 Ga0500616_0000044 3300053153 Bacteria 339611
281 Ga0500622_0000177 3300053156 Bacteria 69046
282 Ga0500622_0040986 3300053156 Bacteria 2410
283 Ga0500611_000004 3300053727 Bacteria 253326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0538270 Ga0501080_0538270_150_1004 277
2 3300053153 Ga0500616_0000044 Ga0500616_0000044_57438_58346 277
3 3300003320 rootH2_10000040 rootH2_1000004014 281
4 3300005842 Ga0068858_100556898 Ga0068858_1005568981 281
5 3300005843 Ga0068860_100000003 Ga0068860_100000003456 281
6 3300006237 Ga0097621_100109898 Ga0097621_1001098982 281
7 3300013306 Ga0163162_10001406 Ga0163162_1000140621 281
8 3300025981 Ga0207640_10348490 Ga0207640_103484902 281
9 3300028381 Ga0268264_10000028 Ga0268264_10000028100 281
10 3300031507 Ga0307509_10023681 Ga0307509_100236819 281
11 3300033180 Ga0307510_10000197 Ga0307510_100001979 281
12 3300035410 Ga0373924_0178024 Ga0373924_0178024_71_916 281
13 3300037068 Ga0373925_0212645 Ga0373925_0212645_433_1278 281
14 3300037312 Ga0395899_0000001 Ga0395899_0000001_69067_69912 281
15 3300046472 Ga0495580_0238314 Ga0495580_0238314_143_988 281
16 3300046477 Ga0495664_0266833 Ga0495664_0266833_141_986 281
17 3300046663 Ga0495635_0283493 Ga0495635_0283493_91_936 281
18 3300053151 Ga0500604_0006941 Ga0500604_0006941_971_1816 281
19 3300005288 Ga0065714_10004848 Ga0065714_100048488 282
20 iso_pu_bacteria 2889290771 2889292084 282
21 3300003320 rootH2_10025005 rootH2_1002500519 283
22 3300015261 Ga0182006_1000286 Ga0182006_100028634 283
23 3300005356 Ga0070674_100202194 Ga0070674_1002021941 285
24 3300006880 Ga0075429_100013777 Ga0075429_1000137774 285
25 3300009094 Ga0111539_10012072 Ga0111539_100120726 285
26 3300025937 Ga0207669_10186809 Ga0207669_101868092 285
27 3300009036 Ga0105244_10000080 Ga0105244_1000008049 286
28 3300009093 Ga0105240_10484351 Ga0105240_104843513 286
29 3300025728 Ga0207655_1000623 Ga0207655_100062338 286
30 iso_pu_bacteria 2585428183 2588212897 286
31 iso_pu_bacteria 2585428187 2588231920 286
32 iso_pu_bacteria 2599185184 2599478437 286
33 iso_pu_bacteria 2738541278 2738728068 286
34 iso_pu_bacteria 2919437846 2919437875 286
35 iso_pu_bacteria 2928078545 2928080511 286
36 iso_pu_bacteria 2928147474 2928150699 286
37 iso_pu_bacteria 2929177148 2929179846 286
38 iso_pu_bacteria 2945977869 2945982272 286
39 iso_pu_bacteria 2946013367 2946018340 286
40 iso_pu_bacteria 2946019816 2946021162 286
41 3300045049 Ga0466959_0225972 Ga0466959_0225972_164_1027 287
42 iso_pu_bacteria 2585427687 2586210735 287
43 iso_pu_bacteria 2738541283 2738754963 287
44 iso_pu_bacteria 2739367651 2739589183 287
45 iso_pu_bacteria 2842722452 2842727804 287
46 iso_pu_bacteria 2842909656 2842914793 287
47 iso_pu_bacteria 2852623160 2852626236 287
48 iso_pu_bacteria 2884933994 2884934690 287
49 iso_pu_bacteria 2929921140 2929926482 287
50 iso_pu_bacteria 2945924605 2945925539 287
51 iso_pu_bacteria 2954016120 2954019538 287
52 3300028794 Ga0307515_10178797 Ga0307515_101787973 288
53 3300053086 Ga0500578_0000009 Ga0500578_0000009_104751_105659 288
54 3300003323 rootH1_10014287 rootH1_100142875 289
55 3300005355 Ga0070671_100062215 Ga0070671_1000622154 289
56 3300005535 Ga0070684_100278453 Ga0070684_1002784532 289
57 3300005841 Ga0068863_100470814 Ga0068863_1004708142 289
58 3300006358 Ga0068871_100146199 Ga0068871_1001461992 289
59 3300009174 Ga0105241_10016964 Ga0105241_100169643 289
60 3300025321 Ga0207656_10043384 Ga0207656_100433842 289
61 3300025911 Ga0207654_10074452 Ga0207654_100744521 289
62 3300025931 Ga0207644_10408339 Ga0207644_104083391 289
63 3300026088 Ga0207641_10046727 Ga0207641_100467275 289
64 3300044658 Ga0466972_0042808 Ga0466972_0042808_336_1232 289
65 3300044684 Ga0466966_0000276 Ga0466966_0000276_26818_27687 289
66 3300045049 Ga0466959_0000010 Ga0466959_0000010_75228_76097 289
67 3300005327 Ga0070658_10246815 Ga0070658_102468151 290
68 3300005331 Ga0070670_100137349 Ga0070670_1001373492 290
69 3300005335 Ga0070666_10000071 Ga0070666_1000007117 290
70 3300005336 Ga0070680_100004385 Ga0070680_1000043853 290
71 3300005337 Ga0070682_100003149 Ga0070682_1000031492 290
72 3300005341 Ga0070691_10051303 Ga0070691_100513032 290
73 3300005355 Ga0070671_100208604 Ga0070671_1002086041 290
74 3300005367 Ga0070667_100121558 Ga0070667_1001215582 290
75 3300005455 Ga0070663_100134266 Ga0070663_1001342662 290
76 3300005458 Ga0070681_10034462 Ga0070681_100344626 290
77 3300005530 Ga0070679_100258304 Ga0070679_1002583041 290
78 3300005539 Ga0068853_100084998 Ga0068853_1000849983 290
79 3300005563 Ga0068855_100015217 Ga0068855_1000152176 290
80 3300005563 Ga0068855_100032611 Ga0068855_1000326112 290
81 3300005577 Ga0068857_100029515 Ga0068857_1000295155 290
82 3300005614 Ga0068856_100021785 Ga0068856_1000217857 290
83 3300005614 Ga0068856_100027276 Ga0068856_1000272767 290
84 3300005614 Ga0068856_100036548 Ga0068856_1000365482 290
85 3300005616 Ga0068852_100002246 Ga0068852_1000022465 290
86 3300005617 Ga0068859_100000029 Ga0068859_100000029148 290
87 3300005618 Ga0068864_100193464 Ga0068864_1001934642 290
88 3300005841 Ga0068863_100002616 Ga0068863_1000026166 290
89 3300005843 Ga0068860_100001496 Ga0068860_10000149614 290
90 3300006931 Ga0097620_100000029 Ga0097620_100000029148 290
91 3300009101 Ga0105247_10138354 Ga0105247_101383541 290
92 3300009174 Ga0105241_10000547 Ga0105241_1000054713 290
93 3300009545 Ga0105237_10044026 Ga0105237_100440263 290
94 3300009553 Ga0105249_10020916 Ga0105249_100209163 290
95 3300011119 Ga0105246_10006849 Ga0105246_100068493 290
96 3300013104 Ga0157370_10033764 Ga0157370_100337642 290
97 3300013105 Ga0157369_10065089 Ga0157369_100650896 290
98 3300013296 Ga0157374_10299040 Ga0157374_102990401 290
99 3300013306 Ga0163162_10000914 Ga0163162_1000091414 290
100 3300014325 Ga0163163_10205207 Ga0163163_102052072 290
101 3300014969 Ga0157376_10033913 Ga0157376_100339133 290
102 3300015682 Ga0183373_1001 Ga0183373_1001975 290
103 3300017792 Ga0163161_10000498 Ga0163161_100004989 290
104 3300025903 Ga0207680_10000420 Ga0207680_100004202 290
105 3300025904 Ga0207647_10029599 Ga0207647_100295993 290
106 3300025909 Ga0207705_10021188 Ga0207705_100211883 290
107 3300025911 Ga0207654_10000506 Ga0207654_1000050610 290
108 3300025912 Ga0207707_10019937 Ga0207707_100199372 290
109 3300025912 Ga0207707_10134322 Ga0207707_101343223 290
110 3300025913 Ga0207695_10008096 Ga0207695_100080968 290
111 3300025914 Ga0207671_10006759 Ga0207671_1000675911 290
112 3300025914 Ga0207671_10025732 Ga0207671_100257326 290
113 3300025917 Ga0207660_10002440 Ga0207660_100024402 290
114 3300025917 Ga0207660_10036170 Ga0207660_100361701 290
115 3300025921 Ga0207652_10000077 Ga0207652_1000007796 290
116 3300025925 Ga0207650_10168026 Ga0207650_101680261 290
117 3300025934 Ga0207686_10000793 Ga0207686_100007933 290
118 3300025942 Ga0207689_10005928 Ga0207689_100059286 290
119 3300025949 Ga0207667_10012256 Ga0207667_100122566 290
120 3300025961 Ga0207712_10063989 Ga0207712_100639893 290
121 3300025981 Ga0207640_10382196 Ga0207640_103821961 290
122 3300025981 Ga0207640_10499909 Ga0207640_104999091 290
123 3300026041 Ga0207639_10027874 Ga0207639_100278743 290
124 3300026067 Ga0207678_10030514 Ga0207678_100305146 290
125 3300026088 Ga0207641_10001396 Ga0207641_100013964 290
126 3300026095 Ga0207676_10066724 Ga0207676_100667243 290
127 3300026095 Ga0207676_10301857 Ga0207676_103018571 290
128 3300026116 Ga0207674_10007593 Ga0207674_100075938 290
129 3300026142 Ga0207698_10005444 Ga0207698_100054445 290
130 3300028381 Ga0268264_10004114 Ga0268264_1000411414 290
131 3300031251 Ga0265327_10000031 Ga0265327_1000003120 290
132 3300031507 Ga0307509_10238588 Ga0307509_102385882 290
133 3300037312 Ga0395899_0032325 Ga0395899_0032325_1610_2482 290
134 3300037466 Ga0395898_0009160 Ga0395898_0009160_2396_3268 290
135 3300044658 Ga0466972_0000057 Ga0466972_0000057_38368_39240 290
136 3300044658 Ga0466972_0010772 Ga0466972_0010772_2390_3262 290
137 3300044765 Ga0466970_0043144 Ga0466970_0043144_259_1131 290
138 3300044842 Ga0466957_0004385 Ga0466957_0004385_3554_4426 290
139 3300046518 Ga0495631_0001050 Ga0495631_0001050_14391_15263 290
140 3300046519 Ga0495632_0001589 Ga0495632_0001589_14281_15153 290
141 3300046558 Ga0495633_0001092 Ga0495633_0001092_6629_7501 290
142 3300046660 Ga0495625_0001321 Ga0495625_0001321_16829_17701 290
143 3300053092 Ga0500583_0000764 Ga0500583_0000764_3952_4824 290
144 3300053098 Ga0500650_0093557 Ga0500650_0093557_53_925 290
145 3300053130 Ga0500642_0068065 Ga0500642_0068065_454_1326 290
146 3300053147 Ga0500589_034543 Ga0500589_034543_173_1045 290
147 3300053156 Ga0500622_0040986 Ga0500622_0040986_1296_2168 290
148 3300001979 JGI24740J21852_10000062 JGI24740J21852_1000006221 291
149 3300002773 JGI25152J39213_1000135 JGI25152J39213_100013539 291
150 3300002774 JGI25150J39212_1000001 JGI25150J39212_10000011085 291
151 3300003187 JGI25151J46595_10000005 JGI25151J46595_10000005116 291
152 3300003203 JGI25406J46586_10025543 JGI25406J46586_100255432 291
153 3300003215 JGI25153J46596_10000018 JGI25153J46596_10000018118 291
154 3300003215 JGI25153J46596_10000435 JGI25153J46596_1000043510 291
155 3300003323 rootH1_10206465 rootH1_102064652 291
156 3300003354 JGI25160J50197_1000886 JGI25160J50197_100088612 291
157 3300003354 JGI25160J50197_1010512 JGI25160J50197_10105124 291
158 3300003794 Ga0055531_10000118 Ga0055531_1000011865 291
159 3300005262 Ga0065165_1043863 Ga0065165_10438632 291
160 3300005288 Ga0065714_10069817 Ga0065714_100698172 291
161 3300005327 Ga0070658_10000016 Ga0070658_100000168 291
162 3300005339 Ga0070660_100037747 Ga0070660_1000377472 291
163 3300005355 Ga0070671_100003575 Ga0070671_1000035755 291
164 3300005356 Ga0070674_100010305 Ga0070674_1000103052 291
165 3300005367 Ga0070667_100131488 Ga0070667_1001314883 291
166 3300005367 Ga0070667_100208889 Ga0070667_1002088892 291
167 3300005439 Ga0070711_100275058 Ga0070711_1002750582 291
168 3300005439 Ga0070711_100364172 Ga0070711_1003641722 291
169 3300005459 Ga0068867_100137172 Ga0068867_1001371721 291
170 3300005468 Ga0070707_100253222 Ga0070707_1002532222 291
171 3300005530 Ga0070679_100016964 Ga0070679_1000169646 291
172 3300005548 Ga0070665_100000014 Ga0070665_1000000143 291
173 3300005548 Ga0070665_100000147 Ga0070665_100000147114 291
174 3300005563 Ga0068855_100000093 Ga0068855_10000009364 291
175 3300005563 Ga0068855_100061139 Ga0068855_1000611393 291
176 3300005614 Ga0068856_100165505 Ga0068856_1001655053 291
177 3300005985 Ga0081539_10012526 Ga0081539_100125263 291
178 3300006195 Ga0075366_10000531 Ga0075366_1000053113 291
179 3300006195 Ga0075366_10001256 Ga0075366_100012565 291
180 3300006881 Ga0068865_100034202 Ga0068865_1000342022 291
181 3300009093 Ga0105240_10031451 Ga0105240_100314512 291
182 3300009093 Ga0105240_10039076 Ga0105240_100390764 291
183 3300009093 Ga0105240_10065352 Ga0105240_100653526 291
184 3300009093 Ga0105240_10067907 Ga0105240_100679071 291
185 3300009093 Ga0105240_10296605 Ga0105240_102966052 291
186 3300009176 Ga0105242_10059337 Ga0105242_100593374 291
187 3300009545 Ga0105237_10001790 Ga0105237_1000179012 291
188 3300009545 Ga0105237_10005439 Ga0105237_100054398 291
189 3300009545 Ga0105237_10073930 Ga0105237_100739303 291
190 3300010375 Ga0105239_10099692 Ga0105239_100996922 291
191 3300010375 Ga0105239_10160192 Ga0105239_101601921 291
192 3300013104 Ga0157370_10104866 Ga0157370_101048662 291
193 3300013105 Ga0157369_10000117 Ga0157369_1000011764 291
194 3300013297 Ga0157378_10029400 Ga0157378_100294004 291
195 3300013297 Ga0157378_10035390 Ga0157378_100353904 291
196 3300013297 Ga0157378_10203906 Ga0157378_102039061 291
197 3300013308 Ga0157375_10050067 Ga0157375_100500674 291
198 3300013308 Ga0157375_10163794 Ga0157375_101637942 291
199 3300014969 Ga0157376_10056582 Ga0157376_100565825 291
200 3300015261 Ga0182006_1000202 Ga0182006_100020239 291
201 3300015262 Ga0182007_10000007 Ga0182007_10000007262 291
202 3300017792 Ga0163161_10001976 Ga0163161_100019762 291
203 3300025245 Ga0207425_1000002 Ga0207425_1000002113 291
204 3300025246 Ga0209646_1000003 Ga0209646_100000320 291
205 3300025250 Ga0209026_1000334 Ga0209026_100033420 291
206 3300025258 Ga0209129_1000002 Ga0209129_1000002113 291
207 3300025258 Ga0209129_1006306 Ga0209129_10063062 291
208 3300025284 Ga0209130_1001631 Ga0209130_10016317 291
209 3300025294 Ga0209025_1000004 Ga0209025_10000041076 291
210 3300025297 Ga0209758_1000006 Ga0209758_10000061076 291
211 3300025297 Ga0209758_1002380 Ga0209758_10023809 291
212 3300025298 Ga0209050_1001044 Ga0209050_100104412 291
213 3300025302 Ga0207426_1000032 Ga0207426_1000032314 291
214 3300025302 Ga0207426_1000310 Ga0207426_100031019 291
215 3300025302 Ga0207426_1000364 Ga0207426_100036412 291
216 3300025304 Ga0209257_1000007 Ga0209257_1000007125 291
217 3300025909 Ga0207705_10000031 Ga0207705_100000318 291
218 3300025913 Ga0207695_10054586 Ga0207695_100545865 291
219 3300025913 Ga0207695_10542102 Ga0207695_105421021 291
220 3300025914 Ga0207671_10329783 Ga0207671_103297832 291
221 3300025916 Ga0207663_10181915 Ga0207663_101819151 291
222 3300025919 Ga0207657_10028886 Ga0207657_100288863 291
223 3300025931 Ga0207644_10007249 Ga0207644_100072495 291
224 3300025937 Ga0207669_10172712 Ga0207669_101727122 291
225 3300025938 Ga0207704_10101727 Ga0207704_101017273 291
226 3300025942 Ga0207689_10320378 Ga0207689_103203782 291
227 3300025949 Ga0207667_10000939 Ga0207667_1000093922 291
228 3300025986 Ga0207658_10120184 Ga0207658_101201842 291
229 3300026041 Ga0207639_10011786 Ga0207639_100117866 291
230 3300026041 Ga0207639_10676032 Ga0207639_106760321 291
231 3300026067 Ga0207678_10472389 Ga0207678_104723891 291
232 3300026078 Ga0207702_10298160 Ga0207702_102981602 291
233 3300026089 Ga0207648_10067043 Ga0207648_100670433 291
234 3300026095 Ga0207676_10093382 Ga0207676_100933822 291
235 3300028379 Ga0268266_10000030 Ga0268266_10000030325 291
236 3300028379 Ga0268266_10000048 Ga0268266_1000004883 291
237 3300028381 Ga0268264_10043119 Ga0268264_100431192 291
238 3300028786 Ga0307517_10003455 Ga0307517_1000345516 291
239 3300028794 Ga0307515_10000001 Ga0307515_10000001591 291
240 3300028794 Ga0307515_10000300 Ga0307515_1000030017 291
241 3300028794 Ga0307515_10002851 Ga0307515_1000285123 291
242 3300028794 Ga0307515_10287880 Ga0307515_102878802 291
243 3300030521 Ga0307511_10000429 Ga0307511_1000042930 291
244 3300031456 Ga0307513_10039126 Ga0307513_100391262 291
245 3300031456 Ga0307513_10404958 Ga0307513_104049581 291
246 3300031731 Ga0307405_10000047 Ga0307405_1000004746 291
247 3300031911 Ga0307412_10000009 Ga0307412_1000000951 291
248 3300031911 Ga0307412_10502388 Ga0307412_105023881 291
249 3300032002 Ga0307416_100000033 Ga0307416_10000003359 291
250 3300032004 Ga0307414_10000697 Ga0307414_100006976 291
251 3300035115 Ga0373941_0026686 Ga0373941_0026686_406_1281 291
252 3300039447 Ga0436361_0499494 Ga0436361_0499494_4471_5346 291
253 3300042015 Ga0439462_0002669 Ga0439462_0002669_449_1324 291
254 3300046453 Ga0495627_027071 Ga0495627_027071_274_1149 291
255 3300046460 Ga0495638_0051974 Ga0495638_0051974_973_1848 291
256 3300046471 Ga0495650_0000349 Ga0495650_0000349_37658_38533 291
257 3300046492 Ga0495585_0000194 Ga0495585_0000194_36713_37588 291
258 3300046506 Ga0495583_0011520 Ga0495583_0011520_3909_4784 291
259 3300046507 Ga0495606_0000009 Ga0495606_0000009_292415_293290 291
260 3300046507 Ga0495606_0008651 Ga0495606_0008651_7770_8645 291
261 3300046507 Ga0495606_0021440 Ga0495606_0021440_1554_2429 291
262 3300046507 Ga0495606_0220692 Ga0495606_0220692_33_908 291
263 3300046512 Ga0495610_0000408 Ga0495610_0000408_3761_4816 291
264 3300046512 Ga0495610_0044252 Ga0495610_0044252_269_1144 291
265 3300046513 Ga0495616_0000760 Ga0495616_0000760_1845_2720 291
266 3300046519 Ga0495632_0079015 Ga0495632_0079015_429_1304 291
267 3300046520 Ga0495637_0021258 Ga0495637_0021258_1327_2202 291
268 3300046524 Ga0495648_0026231 Ga0495648_0026231_1511_2386 291
269 3300046525 Ga0495663_0039830 Ga0495663_0039830_73_948 291
270 3300046538 Ga0495609_0017170 Ga0495609_0017170_1814_2689 291
271 3300046542 Ga0495597_0145285 Ga0495597_0145285_77_952 291
272 3300046558 Ga0495633_0126533 Ga0495633_0126533_257_1132 291
273 3300046616 Ga0495668_0000114 Ga0495668_0000114_121839_122714 291
274 3300046648 Ga0495611_0065647 Ga0495611_0065647_157_1032 291
275 3300046660 Ga0495625_0000007 Ga0495625_0000007_40950_41825 291
276 3300046660 Ga0495625_0005427 Ga0495625_0005427_1025_1900 291
277 3300046660 Ga0495625_0191575 Ga0495625_0191575_118_993 291
278 3300046665 Ga0495661_0006546 Ga0495661_0006546_1543_2418 291
279 3300046665 Ga0495661_0008575 Ga0495661_0008575_4933_5808 291
280 3300046680 Ga0495646_0161936 Ga0495646_0161936_224_1099 291
281 3300046694 Ga0495649_0000007 Ga0495649_0000007_393799_394674 291
282 3300047320 Ga0495672_0014589 Ga0495672_0014589_4348_5223 291
283 3300047320 Ga0495672_0052123 Ga0495672_0052123_311_1186 291
284 3300047443 Ga0495687_000278 Ga0495687_000278_36759_37634 291
285 3300047445 Ga0495677_0025944 Ga0495677_0025944_85_960 291
286 3300047470 Ga0495681_0023324 Ga0495681_0023324_750_1625 291
287 3300047472 Ga0495686_0000402 Ga0495686_0000402_53307_54182 291
288 3300048925 Ga0496122_0002276 Ga0496122_0002276_8323_9198 291
289 3300048928 Ga0496125_0118544 Ga0496125_0118544_22_897 291
290 3300049704 Ga0501221_017130 Ga0501221_017130_13_888 291
291 3300050493 nmdc:mga0k408_433_c1 nmdc:mga0k408_433_c1_4424_5299 291
292 3300050493 nmdc:mga0k408_807_c1 nmdc:mga0k408_807_c1_7320_8195 291
293 3300053090 Ga0500646_0024349 Ga0500646_0024349_116_1060 291
294 3300053092 Ga0500583_0000050 Ga0500583_0000050_72101_72976 291
295 3300053092 Ga0500583_0001356 Ga0500583_0001356_5165_6046 291
296 3300053109 Ga0500569_000103 Ga0500569_000103_4253_5134 291
297 3300053122 Ga0500608_002264 Ga0500608_002264_3539_4414 291
298 3300053125 Ga0500618_000020 Ga0500618_000020_49500_50375 291
299 3300053125 Ga0500618_018493 Ga0500618_018493_629_1504 291
300 3300053131 Ga0500652_031963 Ga0500652_031963_80_955 291
301 3300053134 Ga0500658_0036175 Ga0500658_0036175_702_1583 291
302 3300053136 Ga0500559_0008989 Ga0500559_0008989_2756_3631 291
303 3300053142 Ga0500577_0002367 Ga0500577_0002367_3355_4236 291
304 3300053156 Ga0500622_0000177 Ga0500622_0000177_5190_6065 291
305 3300053727 Ga0500611_000004 Ga0500611_000004_164678_165553 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

116

262

0.84

PF12146

Hydrolase_4

Serine aminopeptidase, S33

116

304

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

118

341

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8833 36 155
2dst-assembly1.cif.gz_B crystal structure analysis of tt1977 0.8498 36 155
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8371 36 290
5ie5-assembly2.cif.gz_C-2 crystal structure of a lactonase double mutant in complex with substrate a 0.8251 40 152
2ock-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase d123n mutant 0.8141 36 291
ID Description Score Start End Superfamily
af_A0A0R0EQP0_201_384_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9159 55 156 3.40.50.1820
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8785 49 156 3.40.50.1820
af_A0A1D6M0A7_18_159_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8761 36 141 3.40.50.1820
af_I1KMX1_1_216_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8659 32 152 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.865 36 159 3.40.50.1820
ID Description Score Start End GO Terms
AF-X0YD31-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9695 38 156
AF-A0A534UXY9-F1-model_v4 Alpha/beta hydrolase 0.9645 47 156 GO:0016787
AF-A0A7J2IRY7-F1-model_v4 Alpha/beta hydrolase 0.9641 39 152 GO:0016020
GO:0016787
AF-A0A540WT41-F1-model_v4 Alpha/beta hydrolase 0.9632 48 290 GO:0016787
AF-A0A521QN02-F1-model_v4 Alpha/beta hydrolase 0.9604 36 290 GO:0016787

Feature Viewer

pLDDT pTM Quality
90.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map