F398254

General Info

Members Datasets Scaffolds Average Seq Length
305 181 306 250

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0202584|Ga0453684_0202584_1293_2147
Length 284
Sequence MYINSFLLPGQPVVSVVAYLHEKPFNMLMPISDDNSDRHLTPFINYLLIILNVLVFVVLQQSGNNLYFTYSFSTVPAEILTGTDIVTQGKIVIDPYTQQQFEIPGLQITPIPVYFTLLTSMFMHGGWGHLLGNMLYLYIFGDNLENRMGHGRYLAFYLLTGVLASMAHVFSSLMVPGQELIPSLGASGAISGVLGGNLILFPSRKVNALLGWFVVQVPVLVALGLWIVFQVVSGLGMLGGGSDGVAYAAHIGGFVAGMLLVKFFDKGLRKPPGRWQSRRFEYRE

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
123 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
124 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
125 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
147 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
148 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
149 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
150 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
151 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
152 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
153 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
157 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
158 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
159 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
160 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
161 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
162 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
163 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
167 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
171 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
172 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
173 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
174 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
175 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000013 3300002459 Bacteria 113565
2 JGI25406J46586_10002162 3300003203 Bacteria 9293
3 JGI25406J46586_10004689 3300003203 Bacteria 6362
4 rootH1_10045760 3300003316 Bacteria 11183
5 rootH1_10045760 3300003323 Bacteria 5061
6 Ga0065712_10002668 3300005290 Bacteria 6597
7 Ga0065712_10017142 3300005290 Bacteria 2179
8 Ga0065712_10076587 3300005290 Unclassified 3599
9 Ga0065715_10005754 3300005293 Bacteria 4856
10 Ga0070690_100031553 3300005330 Unclassified 3302
11 Ga0070670_100000129 3300005331 Bacteria 71325
12 Ga0070670_100054918 3300005331 Unclassified 3419
13 Ga0070670_100226113 3300005331 Bacteria 1628
14 Ga0068869_100305900 3300005334 Bacteria 1285
15 Ga0070660_100735677 3300005339 Bacteria 828
16 Ga0070689_100307162 3300005340 Bacteria 1322
17 Ga0070692_10232717 3300005345 Bacteria 1095
18 Ga0070668_100027625 3300005347 Bacteria 4308
19 Ga0070669_100001596 3300005353 Bacteria 16395
20 Ga0070675_100021198 3300005354 Bacteria 5190
21 Ga0070675_100627825 3300005354 Bacteria 976
22 Ga0070673_100075298 3300005364 Bacteria 2722
23 Ga0070673_100216336 3300005364 Bacteria 1657
24 Ga0070688_100063014 3300005365 Bacteria 2348
25 Ga0070659_100342418 3300005366 Bacteria 1253
26 Ga0070667_100022995 3300005367 Bacteria 5169
27 Ga0070700_100000070 3300005441 Bacteria 72718
28 Ga0070700_100014022 3300005441 Bacteria 4518
29 Ga0070694_100030369 3300005444 Bacteria 3534
30 Ga0070694_100152741 3300005444 Bacteria 1687
31 Ga0070694_100390083 3300005444 Bacteria 1088
32 Ga0070678_100097374 3300005456 Bacteria 2272
33 Ga0070662_100151820 3300005457 Bacteria 1804
34 Ga0068867_100095661 3300005459 Bacteria 2260
35 Ga0068867_100231464 3300005459 Bacteria 1494
36 Ga0070698_100005833 3300005471 Bacteria 13467
37 Ga0070698_100175480 3300005471 Bacteria 2083
38 Ga0070699_100063244 3300005518 Bacteria 3209
39 Ga0068853_100196488 3300005539 Bacteria 1835
40 Ga0070672_100117406 3300005543 Bacteria 2175
41 Ga0070672_100548293 3300005543 Bacteria 1004
42 Ga0070695_100007274 3300005545 Bacteria 6562
43 Ga0070696_100029654 3300005546 Bacteria 3741
44 Ga0070693_100208562 3300005547 Bacteria 1273
45 Ga0070693_100242197 3300005547 Bacteria 1192
46 Ga0070704_100021850 3300005549 Bacteria 4155
47 Ga0070664_100080721 3300005564 Bacteria 2802
48 Ga0070664_100084001 3300005564 Bacteria 2748
49 Ga0068857_100203115 3300005577 Bacteria 1807
50 Ga0068857_100489203 3300005577 Bacteria 1153
51 Ga0068854_100226107 3300005578 Bacteria 1483
52 Ga0070702_100073202 3300005615 Bacteria 2029
53 Ga0068852_100268397 3300005616 Bacteria 1641
54 Ga0068852_100509858 3300005616 Bacteria 1199
55 Ga0068859_100010508 3300005617 Bacteria 9315
56 Ga0068859_100047313 3300005617 Bacteria 4321
57 Ga0068859_100080639 3300005617 Bacteria 3295
58 Ga0068859_100090911 3300005617 Bacteria 3103
59 Ga0068859_100092704 3300005617 Bacteria 3072
60 Ga0068859_100193780 3300005617 Bacteria 2117
61 Ga0068864_100102133 3300005618 Bacteria 2544
62 Ga0068864_100201402 3300005618 Bacteria 1829
63 Ga0068864_100269689 3300005618 Bacteria 1585
64 Ga0068864_100353807 3300005618 Bacteria 1386
65 Ga0068864_100461594 3300005618 Bacteria 1216
66 Ga0068866_10130381 3300005718 Unclassified 1429
67 Ga0068861_100141350 3300005719 Bacteria 1965
68 Ga0068861_100176754 3300005719 Bacteria 1773
69 Ga0068863_100175861 3300005841 Bacteria 2054
70 Ga0068863_100196504 3300005841 Unclassified 1939
71 Ga0068863_100199756 3300005841 Bacteria 1923
72 Ga0068863_100390099 3300005841 Bacteria 1360
73 Ga0068858_100058286 3300005842 Bacteria 3570
74 Ga0068858_100108248 3300005842 Bacteria 2594
75 Ga0068858_100639769 3300005842 Bacteria 1033
76 Ga0068860_100022560 3300005843 Bacteria 6085
77 Ga0068860_100184604 3300005843 Bacteria 2016
78 Ga0068860_100585333 3300005843 Bacteria 1120
79 Ga0068860_100779588 3300005843 Bacteria 969
80 Ga0068862_100002420 3300005844 Bacteria 16571
81 Ga0068862_100009883 3300005844 Bacteria 7880
82 Ga0081539_10000360 3300005985 Bacteria 100156
83 Ga0081539_10000783 3300005985 Bacteria 61928
84 Ga0097621_100000460 3300006237 Bacteria 28549
85 Ga0097621_100182894 3300006237 Unclassified 1812
86 Ga0068871_100000251 3300006358 Bacteria 37472
87 Ga0068871_100102604 3300006358 Bacteria 2398
88 Ga0075430_100012882 3300006846 Bacteria 7126
89 Ga0075430_100051911 3300006846 Bacteria 3453
90 Ga0075430_100083983 3300006846 Bacteria 2667
91 Ga0075430_100202117 3300006846 Bacteria 1650
92 Ga0075430_100362036 3300006846 Bacteria 1198
93 Ga0075431_100014315 3300006847 Bacteria 8023
94 Ga0075431_100101979 3300006847 Bacteria 2961
95 Ga0075431_100160869 3300006847 Bacteria 2309
96 Ga0075431_100526402 3300006847 Bacteria 1171
97 Ga0075434_100216190 3300006871 Bacteria 1937
98 Ga0075429_100085830 3300006880 Bacteria 2743
99 Ga0075429_100508511 3300006880 Bacteria 1056
100 Ga0075436_100000173 3300006914 Bacteria 40359
101 Ga0097620_100010508 3300006931 Bacteria 9315
102 Ga0097620_100047313 3300006931 Bacteria 4321
103 Ga0097620_100080640 3300006931 Bacteria 3295
104 Ga0097620_100090910 3300006931 Bacteria 3103
105 Ga0097620_100092710 3300006931 Bacteria 3072
106 Ga0097620_100193772 3300006931 Bacteria 2117
107 Ga0075435_100510527 3300007076 Bacteria 1040
108 Ga0105251_10036530 3300009011 Bacteria 2417
109 Ga0105247_10048317 3300009101 Bacteria 2613
110 Ga0105247_10053337 3300009101 Bacteria 2494
111 Ga0105247_10086587 3300009101 Bacteria 1983
112 Ga0105241_10100176 3300009174 Bacteria 2302
113 Ga0105241_10849485 3300009174 Bacteria 844
114 Ga0105242_10598245 3300009176 Bacteria 1065
115 Ga0105248_10003370 3300009177 Bacteria 17750
116 Ga0105248_10091388 3300009177 Bacteria 3428
117 Ga0105248_10097744 3300009177 Bacteria 3308
118 Ga0105248_10222513 3300009177 Unclassified 2125
119 Ga0105248_10892880 3300009177 Bacteria 1003
120 Ga0105237_10471080 3300009545 Bacteria 1262
121 Ga0105238_10003652 3300009551 Bacteria 15343
122 Ga0105249_10017478 3300009553 Bacteria 6368
123 Ga0105249_10018257 3300009553 Bacteria 6236
124 Ga0105239_10397698 3300010375 Bacteria 1559
125 Ga0105246_10119306 3300011119 Unclassified 1951
126 Ga0105246_10279657 3300011119 Bacteria 1338
127 Ga0105246_10475664 3300011119 Bacteria 1056
128 Ga0157371_10033088 3300013102 Bacteria 3716
129 Ga0157374_10025860 3300013296 Bacteria 5277
130 Ga0157378_10046347 3300013297 Unclassified 3865
131 Ga0157378_10374879 3300013297 Bacteria 1396
132 Ga0163162_10000628 3300013306 Bacteria 32760
133 Ga0163162_10001072 3300013306 Bacteria 25452
134 Ga0163162_10108318 3300013306 Bacteria 2875
135 Ga0163162_10135830 3300013306 Bacteria 2570
136 Ga0157372_11137834 3300013307 Bacteria 903
137 Ga0157375_10000403 3300013308 Bacteria 39237
138 Ga0157375_10105735 3300013308 Unclassified 2906
139 Ga0163163_10000360 3300014325 Bacteria 43731
140 Ga0163163_10000536 3300014325 Bacteria 33560
141 Ga0163163_10536746 3300014325 Bacteria 1232
142 Ga0163163_10702370 3300014325 Bacteria 1075
143 Ga0157380_10035300 3300014326 Bacteria 3862
144 Ga0157379_10013524 3300014968 Bacteria 7152
145 Ga0157379_10174795 3300014968 Unclassified 1939
146 Ga0157376_10000637 3300014969 Bacteria 22720
147 Ga0163161_10003438 3300017792 Bacteria 11099
148 Ga0163161_10013957 3300017792 Bacteria 5594
149 Ga0207710_10016749 3300025900 Bacteria 3103
150 Ga0207710_10027307 3300025900 Bacteria 2471
151 Ga0207643_10043839 3300025908 Bacteria 2525
152 Ga0207684_10361051 3300025910 Bacteria 1250
153 Ga0207654_10044375 3300025911 Bacteria 2525
154 Ga0207681_10173889 3300025923 Bacteria 1634
155 Ga0207694_10009319 3300025924 Bacteria 7406
156 Ga0207650_10000001 3300025925 Bacteria 1545726
157 Ga0207650_10037860 3300025925 Unclassified 3518
158 Ga0207650_10190650 3300025925 Bacteria 1638
159 Ga0207644_10007255 3300025931 Bacteria 7214
160 Ga0207706_10016666 3300025933 Bacteria 6632
161 Ga0207706_10059734 3300025933 Bacteria 3358
162 Ga0207709_10042557 3300025935 Bacteria 2733
163 Ga0207670_10272106 3300025936 Bacteria 1317
164 Ga0207704_10075655 3300025938 Bacteria 2154
165 Ga0207711_10009004 3300025941 Bacteria 8348
166 Ga0207711_10173273 3300025941 Unclassified 1959
167 Ga0207689_10127507 3300025942 Bacteria 2093
168 Ga0207689_10619159 3300025942 Bacteria 911
169 Ga0207679_10111210 3300025945 Bacteria 2162
170 Ga0207651_10062884 3300025960 Bacteria 2589
171 Ga0207712_10000970 3300025961 Bacteria 20652
172 Ga0207712_10008719 3300025961 Bacteria 6414
173 Ga0207712_10080373 3300025961 Bacteria 2371
174 Ga0207668_10019471 3300025972 Bacteria 4292
175 Ga0207668_10851554 3300025972 Bacteria 809
176 Ga0207640_10512341 3300025981 Bacteria 1001
177 Ga0207640_10622288 3300025981 Bacteria 916
178 Ga0207703_10103590 3300026035 Bacteria 2416
179 Ga0207639_10269224 3300026041 Bacteria 1493
180 Ga0207708_10000453 3300026075 Bacteria 31845
181 Ga0207708_10020464 3300026075 Bacteria 4990
182 Ga0207641_10052886 3300026088 Unclassified 3441
183 Ga0207641_10277502 3300026088 Bacteria 1575
184 Ga0207641_10304633 3300026088 Unclassified 1506
185 Ga0207648_10165330 3300026089 Bacteria 1955
186 Ga0207648_10289337 3300026089 Bacteria 1467
187 Ga0207676_10417037 3300026095 Bacteria 1258
188 Ga0207676_10455178 3300026095 Bacteria 1207
189 Ga0207674_10056125 3300026116 Bacteria 4001
190 Ga0207674_10106999 3300026116 Bacteria 2774
191 Ga0207674_10193387 3300026116 Bacteria 1984
192 Ga0207675_100042164 3300026118 Bacteria 4260
193 Ga0207675_100097801 3300026118 Bacteria 2764
194 Ga0207683_10100333 3300026121 Bacteria 2584
195 Ga0268264_10017883 3300028381 Bacteria 5801
196 Ga0268264_10058124 3300028381 Bacteria 3237
197 Ga0268264_10529989 3300028381 Bacteria 1152
198 Ga0307408_100062555 3300031548 Bacteria 2720
199 Ga0307408_100070438 3300031548 Bacteria 2582
200 Ga0307408_100383752 3300031548 Bacteria 1202
201 Ga0307508_10019877 3300031616 Bacteria 6103
202 Ga0316576_10354702 3300031727 Bacteria 1091
203 Ga0307405_10067911 3300031731 Bacteria 2279
204 Ga0307405_10143624 3300031731 Bacteria 1668
205 Ga0307413_10605858 3300031824 Bacteria 897
206 Ga0307410_10304187 3300031852 Bacteria 1259
207 Ga0307406_10050448 3300031901 Bacteria 2638
208 Ga0307406_10162251 3300031901 Bacteria 1608
209 Ga0307406_10384284 3300031901 Bacteria 1108
210 Ga0307412_10028885 3300031911 Bacteria 3476
211 Ga0307409_100384157 3300031995 Bacteria 1336
212 Ga0307416_100000619 3300032002 Bacteria 18304
213 Ga0307416_101488052 3300032002 Bacteria 783
214 Ga0307414_10073591 3300032004 Bacteria 2472
215 Ga0307414_10638164 3300032004 Bacteria 959
216 Ga0307415_100044648 3300032126 Bacteria 2964
217 Ga0307415_100115977 3300032126 Bacteria 1997
218 Ga0373951_0070421 3300035091 Bacteria 890
219 Ga0373942_0003437 3300035207 Bacteria 3720
220 Ga0373961_0000513 3300035241 Bacteria 14851
221 Ga0316574_0005114 3300035398 Bacteria 6971
222 Ga0316582_0007197 3300036647 Bacteria 5915
223 Ga0242422_02143 3300038699 Bacteria 1344
224 Ga0400483_041340 3300039062 Bacteria 1039
225 Ga0439431_0034603 3300041997 Bacteria 1267
226 Ga0439448_0033848 3300042005 Bacteria 1631
227 Ga0439458_0005074 3300042157 Bacteria 2974
228 Ga0451577_0050025 3300042876 Bacteria 3731
229 Ga0453684_0167537 3300044712 Bacteria 2592
230 Ga0453684_0202584 3300044712 Bacteria 2312
231 Ga0453684_0919522 3300044712 Unclassified 936
232 Ga0466970_0002902 3300044765 Bacteria 8308
233 Ga0451576_0084913 3300045051 Bacteria 3293
234 Ga0495643_0010796 3300046522 Bacteria 5601
235 Ga0495613_0073792 3300046689 Bacteria 2485
236 Ga0495600_0122258 3300046809 Bacteria 1693
237 Ga0496100_0237953 3300048903 Unclassified 1342
238 Ga0496104_0259474 3300048907 Unclassified 1651
239 Ga0496106_0064870 3300048909 Bacteria 2779
240 Ga0496108_0068538 3300048911 Bacteria 2993
241 Ga0496110_0578481 3300048913 Bacteria 1020
242 Ga0496112_0491711 3300048915 Bacteria 1163
243 Ga0496114_0000004 3300048917 Bacteria 591126
244 Ga0501293_010466 3300049516 Bacteria 802
245 Ga0501298_002358 3300049521 Bacteria 2851
246 Ga0501298_006464 3300049521 Bacteria 1917
247 Ga0501068_0056726 3300049584 Bacteria 2374
248 Ga0501075_0027709 3300049591 Bacteria 4176
249 Ga0501077_0001348 3300049593 Bacteria 14786
250 Ga0501198_001045 3300049649 Bacteria 3527
251 Ga0501198_001163 3300049649 Bacteria 3372
252 Ga0501198_013132 3300049649 Bacteria 1251
253 Ga0501201_002606 3300049651 Bacteria 1652
254 Ga0501202_009920 3300049652 Bacteria 1759
255 Ga0501206_002023 3300049653 Bacteria 2558
256 Ga0501206_005472 3300049653 Bacteria 1635
257 Ga0501206_011292 3300049653 Bacteria 1204
258 Ga0501207_003680 3300049654 Bacteria 2053
259 Ga0501216_000836 3300049660 Bacteria 3877
260 Ga0501217_000031 3300049661 Bacteria 15253
261 Ga0501217_007459 3300049661 Bacteria 2345
262 Ga0501222_004367 3300049662 Bacteria 1919
263 Ga0501223_004205 3300049663 Bacteria 3101
264 Ga0501224_002860 3300049664 Bacteria 2378
265 Ga0501224_006057 3300049664 Bacteria 1749
266 Ga0501233_028307 3300049668 Bacteria 1250
267 Ga0501235_005875 3300049669 Bacteria 2672
268 Ga0501235_011027 3300049669 Bacteria 1978
269 Ga0501235_031844 3300049669 Bacteria 1192
270 Ga0501240_001870 3300049673 Bacteria 2132
271 Ga0501242_014532 3300049674 Bacteria 975
272 Ga0501243_002034 3300049675 Bacteria 2938
273 Ga0501256_008209 3300049685 Bacteria 970
274 Ga0501259_012166 3300049688 Bacteria 1433
275 Ga0501261_001243 3300049690 Bacteria 3130
276 Ga0501221_000508 3300049704 Bacteria 6138
277 Ga0501221_013561 3300049704 Bacteria 1501
278 Ga0501225_0002080 3300049705 Bacteria 6222
279 Ga0501225_0003007 3300049705 Bacteria 5149
280 Ga0501225_0043639 3300049705 Bacteria 1239
281 Ga0501229_016606 3300049706 Bacteria 958
282 Ga0501234_003082 3300049707 Bacteria 2619
283 Ga0501234_009830 3300049707 Bacteria 1492
284 Ga0501245_003634 3300049708 Bacteria 2101
285 Ga0501080_0002058 3300049742 Bacteria 17419
286 Ga0501241_030984 3300049758 Unclassified 1011
287 Ga0501272_017880 3300049769 Bacteria 837
288 Ga0501273_006225 3300049770 Bacteria 1376
289 Ga0501279_004687 3300049775 Bacteria 1796
290 Ga0501279_016412 3300049775 Unclassified 1031
291 Ga0501212_006153 3300049851 Bacteria 1610
292 Ga0501212_024030 3300049851 Bacteria 958
293 Ga0501226_000557 3300049853 Bacteria 5127
294 nmdc:mga05p37_795500_c1 3300050507 Bacteria 1035
295 nmdc:mga0qj67_319837_c1 3300050509 Bacteria 1256
296 nmdc:mga0qj67_44441_c1 3300050509 Bacteria 3501
297 nmdc:mga0qj67_51034_c1 3300050509 Bacteria 3270
298 nmdc:mga0qj67_596823_c1 3300050509 Unclassified 883
299 nmdc:mga0qj67_64072_c1 3300050509 Bacteria 2923
300 nmdc:mga06r32_15228_c1 3300050510 Bacteria 6985
301 nmdc:mga06r32_174303_c1 3300050510 Bacteria 2135
302 nmdc:mga06r32_576684_c1 3300050510 Bacteria 1097
303 nmdc:mga06r32_63237_c1 3300050510 Bacteria 3566
304 nmdc:mga08x19_204_c1 3300050514 Bacteria 45670
305 Ga0590075_019032 3300059424 Bacteria 1702
306 Ga0501082_0001002 3300060353 Bacteria 24955

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0073792 Ga0495613_0073792_256_1020 201
2 3300046809 Ga0495600_0122258 Ga0495600_0122258_721_1485 201
3 3300049584 Ga0501068_0056726 Ga0501068_0056726_1225_1917 204
4 3300049591 Ga0501075_0027709 Ga0501075_0027709_28_720 204
5 3300049593 Ga0501077_0001348 Ga0501077_0001348_12947_13639 204
6 3300049742 Ga0501080_0002058 Ga0501080_0002058_4171_4863 204
7 3300060353 Ga0501082_0001002 Ga0501082_0001002_4860_5552 204
8 3300006871 Ga0075434_100216190 Ga0075434_1002161902 207
9 3300006914 Ga0075436_100000173 Ga0075436_1000001734 207
10 3300007076 Ga0075435_100510527 Ga0075435_1005105272 207
11 3300050514 nmdc:mga08x19_204_c1 nmdc:mga08x19_204_c1_35832_36533 207
12 3300039062 Ga0400483_041340 Ga0400483_041340_131_865 210
13 3300032002 Ga0307416_101488052 Ga0307416_1014880521 212
14 3300032004 Ga0307414_10638164 Ga0307414_106381641 212
15 3300009545 Ga0105237_10471080 Ga0105237_104710802 213
16 3300046522 Ga0495643_0010796 Ga0495643_0010796_4405_5127 213
17 3300031727 Ga0316576_10354702 Ga0316576_103547021 214
18 3300035398 Ga0316574_0005114 Ga0316574_0005114_1642_2349 214
19 3300036647 Ga0316582_0007197 Ga0316582_0007197_702_1409 214
20 3300059424 Ga0590075_019032 Ga0590075_019032_877_1653 214
21 3300035241 Ga0373961_0000513 Ga0373961_0000513_10469_11158 217
22 3300048917 Ga0496114_0000004 Ga0496114_0000004_401246_401953 218
23 3300005364 Ga0070673_100075298 Ga0070673_1000752982 219
24 3300025960 Ga0207651_10062884 Ga0207651_100628842 219
25 3300005843 Ga0068860_100779588 Ga0068860_1007795882 220
26 3300025942 Ga0207689_10619159 Ga0207689_106191591 220
27 3300006847 Ga0075431_100526402 Ga0075431_1005264021 221
28 3300013102 Ga0157371_10033088 Ga0157371_100330884 221
29 3300031616 Ga0307508_10019877 Ga0307508_100198774 221
30 3300050510 nmdc:mga06r32_576684_c1 nmdc:mga06r32_576684_c1_307_1080 221
31 3300005347 Ga0070668_100027625 Ga0070668_1000276252 222
32 3300005353 Ga0070669_100001596 Ga0070669_10000159617 222
33 3300005457 Ga0070662_100151820 Ga0070662_1001518202 222
34 3300005471 Ga0070698_100005833 Ga0070698_1000058333 222
35 3300005471 Ga0070698_100175480 Ga0070698_1001754802 222
36 3300005719 Ga0068861_100141350 Ga0068861_1001413502 222
37 3300005844 Ga0068862_100002420 Ga0068862_10000242017 222
38 3300006846 Ga0075430_100012882 Ga0075430_1000128825 222
39 3300006846 Ga0075430_100051911 Ga0075430_1000519112 222
40 3300006846 Ga0075430_100083983 Ga0075430_1000839834 222
41 3300006846 Ga0075430_100202117 Ga0075430_1002021172 222
42 3300006846 Ga0075430_100362036 Ga0075430_1003620361 222
43 3300006847 Ga0075431_100014315 Ga0075431_1000143159 222
44 3300006847 Ga0075431_100101979 Ga0075431_1001019792 222
45 3300006847 Ga0075431_100160869 Ga0075431_1001608692 222
46 3300006880 Ga0075429_100085830 Ga0075429_1000858301 222
47 3300006880 Ga0075429_100508511 Ga0075429_1005085112 222
48 3300011119 Ga0105246_10279657 Ga0105246_102796573 222
49 3300013306 Ga0163162_10135830 Ga0163162_101358301 222
50 3300025908 Ga0207643_10043839 Ga0207643_100438392 222
51 3300025923 Ga0207681_10173889 Ga0207681_101738892 222
52 3300025933 Ga0207706_10016666 Ga0207706_100166662 222
53 3300025961 Ga0207712_10000970 Ga0207712_1000097019 222
54 3300025972 Ga0207668_10019471 Ga0207668_100194717 222
55 3300026089 Ga0207648_10165330 Ga0207648_101653302 222
56 3300026116 Ga0207674_10056125 Ga0207674_100561251 222
57 3300026118 Ga0207675_100097801 Ga0207675_1000978011 222
58 3300031548 Ga0307408_100062555 Ga0307408_1000625551 222
59 3300031548 Ga0307408_100383752 Ga0307408_1003837522 222
60 3300031901 Ga0307406_10384284 Ga0307406_103842841 222
61 3300031911 Ga0307412_10028885 Ga0307412_100288854 222
62 3300032002 Ga0307416_100000619 Ga0307416_1000006195 222
63 3300049516 Ga0501293_010466 Ga0501293_010466_123_791 222
64 3300050507 nmdc:mga05p37_795500_c1 nmdc:mga05p37_795500_c1_37_807 222
65 3300050509 nmdc:mga0qj67_319837_c1 nmdc:mga0qj67_319837_c1_421_1200 222
66 3300050509 nmdc:mga0qj67_44441_c1 nmdc:mga0qj67_44441_c1_2621_3394 222
67 3300050509 nmdc:mga0qj67_51034_c1 nmdc:mga0qj67_51034_c1_228_1001 222
68 3300050509 nmdc:mga0qj67_596823_c1 nmdc:mga0qj67_596823_c1_10_789 222
69 3300050509 nmdc:mga0qj67_64072_c1 nmdc:mga0qj67_64072_c1_1296_2072 222
70 3300050510 nmdc:mga06r32_15228_c1 nmdc:mga06r32_15228_c1_5315_6088 222
71 3300050510 nmdc:mga06r32_174303_c1 nmdc:mga06r32_174303_c1_237_1010 222
72 3300050510 nmdc:mga06r32_63237_c1 nmdc:mga06r32_63237_c1_1351_2130 222
73 3300041997 Ga0439431_0034603 Ga0439431_0034603_407_1213 223
74 3300006358 Ga0068871_100102604 Ga0068871_1001026043 224
75 3300044712 Ga0453684_0919522 Ga0453684_0919522_65_832 225
76 3300005617 Ga0068859_100193780 Ga0068859_1001937802 226
77 3300006931 Ga0097620_100193772 Ga0097620_1001937722 226
78 3300005290 Ga0065712_10076587 Ga0065712_100765871 236
79 3300005354 Ga0070675_100021198 Ga0070675_1000211984 236
80 3300005365 Ga0070688_100063014 Ga0070688_1000630143 236
81 3300005543 Ga0070672_100117406 Ga0070672_1001174063 236
82 3300014325 Ga0163163_10536746 Ga0163163_105367462 236
83 3300014326 Ga0157380_10035300 Ga0157380_100353002 236
84 3300025972 Ga0207668_10851554 Ga0207668_108515541 236
85 3300031824 Ga0307413_10605858 Ga0307413_106058581 236
86 3300031995 Ga0307409_100384157 Ga0307409_1003841572 238
87 3300025910 Ga0207684_10361051 Ga0207684_103610512 240
88 3300005616 Ga0068852_100509858 Ga0068852_1005098582 243
89 3300003316 rootH1_10045760 rootH1_100457604 244
90 3300003203 JGI25406J46586_10004689 JGI25406J46586_100046892 245
91 3300005617 Ga0068859_100080639 Ga0068859_1000806391 245
92 3300005618 Ga0068864_100201402 Ga0068864_1002014022 245
93 3300005841 Ga0068863_100199756 Ga0068863_1001997561 245
94 3300005843 Ga0068860_100022560 Ga0068860_1000225608 245
95 3300005844 Ga0068862_100009883 Ga0068862_1000098835 245
96 3300005985 Ga0081539_10000360 Ga0081539_1000036014 245
97 3300006931 Ga0097620_100080640 Ga0097620_1000806405 245
98 3300026095 Ga0207676_10417037 Ga0207676_104170371 245
99 3300028381 Ga0268264_10017883 Ga0268264_100178831 245
100 3300044712 Ga0453684_0167537 Ga0453684_0167537_1096_1857 246
101 3300044765 Ga0466970_0002902 Ga0466970_0002902_1398_2171 246
102 3300005367 Ga0070667_100022995 Ga0070667_1000229956 247
103 3300005564 Ga0070664_100080721 Ga0070664_1000807212 247
104 3300005616 Ga0068852_100268397 Ga0068852_1002683973 247
105 3300005718 Ga0068866_10130381 Ga0068866_101303812 247
106 3300005841 Ga0068863_100196504 Ga0068863_1001965042 247
107 3300005842 Ga0068858_100639769 Ga0068858_1006397692 247
108 3300006237 Ga0097621_100000460 Ga0097621_10000046013 247
109 3300006358 Ga0068871_100000251 Ga0068871_10000025130 247
110 3300009177 Ga0105248_10222513 Ga0105248_102225132 247
111 3300009553 Ga0105249_10017478 Ga0105249_100174782 247
112 3300013296 Ga0157374_10025860 Ga0157374_100258601 247
113 3300013297 Ga0157378_10046347 Ga0157378_100463472 247
114 3300013306 Ga0163162_10000628 Ga0163162_1000062816 247
115 3300013306 Ga0163162_10001072 Ga0163162_100010724 247
116 3300013306 Ga0163162_10108318 Ga0163162_101083181 247
117 3300013308 Ga0157375_10000403 Ga0157375_100004038 247
118 3300013308 Ga0157375_10105735 Ga0157375_101057353 247
119 3300014325 Ga0163163_10000360 Ga0163163_1000036021 247
120 3300014968 Ga0157379_10013524 Ga0157379_100135249 247
121 3300014968 Ga0157379_10174795 Ga0157379_101747952 247
122 3300014969 Ga0157376_10000637 Ga0157376_1000063716 247
123 3300017792 Ga0163161_10003438 Ga0163161_100034385 247
124 3300017792 Ga0163161_10013957 Ga0163161_100139578 247
125 3300025931 Ga0207644_10007255 Ga0207644_100072554 247
126 3300025941 Ga0207711_10173273 Ga0207711_101732732 247
127 3300025945 Ga0207679_10111210 Ga0207679_101112102 247
128 3300025961 Ga0207712_10080373 Ga0207712_100803732 247
129 3300026088 Ga0207641_10052886 Ga0207641_100528863 247
130 3300031731 Ga0307405_10143624 Ga0307405_101436243 247
131 3300031852 Ga0307410_10304187 Ga0307410_103041872 247
132 3300032126 Ga0307415_100115977 Ga0307415_1001159772 247
133 3300048903 Ga0496100_0237953 Ga0496100_0237953_519_1286 247
134 3300048907 Ga0496104_0259474 Ga0496104_0259474_259_1026 247
135 3300049649 Ga0501198_013132 Ga0501198_013132_168_926 247
136 3300049669 Ga0501235_031844 Ga0501235_031844_235_993 247
137 3300049707 Ga0501234_009830 Ga0501234_009830_639_1397 247
138 3300049775 Ga0501279_016412 Ga0501279_016412_16_774 247
139 3300005331 Ga0070670_100226113 Ga0070670_1002261132 248
140 3300005456 Ga0070678_100097374 Ga0070678_1000973742 248
141 3300005459 Ga0068867_100231464 Ga0068867_1002314642 248
142 3300005618 Ga0068864_100461594 Ga0068864_1004615941 248
143 3300025925 Ga0207650_10190650 Ga0207650_101906502 248
144 3300026121 Ga0207683_10100333 Ga0207683_101003332 248
145 3300042876 Ga0451577_0050025 Ga0451577_0050025_560_1345 248
146 3300044712 Ga0453684_0202584 Ga0453684_0202584_1293_2147 248
147 3300049521 Ga0501298_002358 Ga0501298_002358_1768_2526 248
148 3300049649 Ga0501198_001163 Ga0501198_001163_1941_2699 248
149 3300049651 Ga0501201_002606 Ga0501201_002606_99_857 248
150 3300049652 Ga0501202_009920 Ga0501202_009920_930_1688 248
151 3300049653 Ga0501206_002023 Ga0501206_002023_155_913 248
152 3300049661 Ga0501217_000031 Ga0501217_000031_6743_7501 248
153 3300049662 Ga0501222_004367 Ga0501222_004367_677_1435 248
154 3300049663 Ga0501223_004205 Ga0501223_004205_1839_2597 248
155 3300049664 Ga0501224_006057 Ga0501224_006057_104_862 248
156 3300049668 Ga0501233_028307 Ga0501233_028307_13_771 248
157 3300049669 Ga0501235_011027 Ga0501235_011027_563_1321 248
158 3300049674 Ga0501242_014532 Ga0501242_014532_205_963 248
159 3300049685 Ga0501256_008209 Ga0501256_008209_71_829 248
160 3300049688 Ga0501259_012166 Ga0501259_012166_70_828 248
161 3300049690 Ga0501261_001243 Ga0501261_001243_2262_3020 248
162 3300049704 Ga0501221_000508 Ga0501221_000508_3117_3875 248
163 3300049705 Ga0501225_0003007 Ga0501225_0003007_585_1343 248
164 3300049708 Ga0501245_003634 Ga0501245_003634_1112_1870 248
165 3300049758 Ga0501241_030984 Ga0501241_030984_94_852 248
166 3300049775 Ga0501279_004687 Ga0501279_004687_693_1451 248
167 3300049851 Ga0501212_006153 Ga0501212_006153_247_1005 248
168 3300005354 Ga0070675_100627825 Ga0070675_1006278251 249
169 3300005444 Ga0070694_100030369 Ga0070694_1000303692 249
170 3300005545 Ga0070695_100007274 Ga0070695_1000072748 249
171 3300011119 Ga0105246_10475664 Ga0105246_104756641 249
172 3300013307 Ga0157372_11137834 Ga0157372_111378341 249
173 3300005290 Ga0065712_10017142 Ga0065712_100171423 250
174 3300005331 Ga0070670_100054918 Ga0070670_1000549184 250
175 3300005339 Ga0070660_100735677 Ga0070660_1007356771 250
176 3300005345 Ga0070692_10232717 Ga0070692_102327171 250
177 3300005444 Ga0070694_100390083 Ga0070694_1003900831 250
178 3300005539 Ga0068853_100196488 Ga0068853_1001964883 250
179 3300005547 Ga0070693_100208562 Ga0070693_1002085622 250
180 3300005547 Ga0070693_100242197 Ga0070693_1002421972 250
181 3300005549 Ga0070704_100021850 Ga0070704_1000218502 250
182 3300005617 Ga0068859_100047313 Ga0068859_1000473135 250
183 3300005617 Ga0068859_100092704 Ga0068859_1000927042 250
184 3300005841 Ga0068863_100390099 Ga0068863_1003900992 250
185 3300005842 Ga0068858_100108248 Ga0068858_1001082483 250
186 3300006931 Ga0097620_100047313 Ga0097620_1000473132 250
187 3300006931 Ga0097620_100092710 Ga0097620_1000927103 250
188 3300009101 Ga0105247_10086587 Ga0105247_100865871 250
189 3300009177 Ga0105248_10091388 Ga0105248_100913883 250
190 3300009177 Ga0105248_10892880 Ga0105248_108928802 250
191 3300009553 Ga0105249_10018257 Ga0105249_100182571 250
192 3300025925 Ga0207650_10037860 Ga0207650_100378604 250
193 3300025961 Ga0207712_10008719 Ga0207712_100087192 250
194 3300025981 Ga0207640_10622288 Ga0207640_106222881 250
195 3300026035 Ga0207703_10103590 Ga0207703_101035902 250
196 3300026041 Ga0207639_10269224 Ga0207639_102692243 250
197 3300026088 Ga0207641_10277502 Ga0207641_102775022 250
198 3300028381 Ga0268264_10529989 Ga0268264_105299892 250
199 3300035207 Ga0373942_0003437 Ga0373942_0003437_2355_3107 250
200 3300038699 Ga0242422_02143 Ga0242422_02143_112_870 250
201 3300045051 Ga0451576_0084913 Ga0451576_0084913_2303_3061 250
202 3300048909 Ga0496106_0064870 Ga0496106_0064870_236_988 250
203 3300048911 Ga0496108_0068538 Ga0496108_0068538_1132_1884 250
204 3300048915 Ga0496112_0491711 Ga0496112_0491711_271_1023 250
205 3300005340 Ga0070689_100307162 Ga0070689_1003071622 251
206 3300005441 Ga0070700_100014022 Ga0070700_1000140222 251
207 3300005459 Ga0068867_100095661 Ga0068867_1000956612 251
208 3300005518 Ga0070699_100063244 Ga0070699_1000632443 251
209 3300005564 Ga0070664_100084001 Ga0070664_1000840012 251
210 3300005577 Ga0068857_100489203 Ga0068857_1004892032 251
211 3300005615 Ga0070702_100073202 Ga0070702_1000732022 251
212 3300005617 Ga0068859_100090911 Ga0068859_1000909113 251
213 3300005618 Ga0068864_100102133 Ga0068864_1001021332 251
214 3300005618 Ga0068864_100269689 Ga0068864_1002696892 251
215 3300005618 Ga0068864_100353807 Ga0068864_1003538072 251
216 3300005719 Ga0068861_100176754 Ga0068861_1001767543 251
217 3300005841 Ga0068863_100175861 Ga0068863_1001758612 251
218 3300005842 Ga0068858_100058286 Ga0068858_1000582862 251
219 3300005843 Ga0068860_100184604 Ga0068860_1001846042 251
220 3300005843 Ga0068860_100585333 Ga0068860_1005853332 251
221 3300006237 Ga0097621_100182894 Ga0097621_1001828942 251
222 3300006931 Ga0097620_100090910 Ga0097620_1000909103 251
223 3300009011 Ga0105251_10036530 Ga0105251_100365302 251
224 3300009101 Ga0105247_10053337 Ga0105247_100533373 251
225 3300009174 Ga0105241_10849485 Ga0105241_108494851 251
226 3300009177 Ga0105248_10097744 Ga0105248_100977443 251
227 3300009551 Ga0105238_10003652 Ga0105238_100036525 251
228 3300011119 Ga0105246_10119306 Ga0105246_101193062 251
229 3300014325 Ga0163163_10702370 Ga0163163_107023702 251
230 3300025900 Ga0207710_10027307 Ga0207710_100273073 251
231 3300025911 Ga0207654_10044375 Ga0207654_100443753 251
232 3300025924 Ga0207694_10009319 Ga0207694_100093197 251
233 3300025933 Ga0207706_10059734 Ga0207706_100597343 251
234 3300025935 Ga0207709_10042557 Ga0207709_100425572 251
235 3300025938 Ga0207704_10075655 Ga0207704_100756552 251
236 3300025942 Ga0207689_10127507 Ga0207689_101275072 251
237 3300026075 Ga0207708_10020464 Ga0207708_100204642 251
238 3300026088 Ga0207641_10304633 Ga0207641_103046332 251
239 3300026089 Ga0207648_10289337 Ga0207648_102893372 251
240 3300026095 Ga0207676_10455178 Ga0207676_104551781 251
241 3300026116 Ga0207674_10106999 Ga0207674_101069992 251
242 3300026118 Ga0207675_100042164 Ga0207675_1000421643 251
243 3300028381 Ga0268264_10058124 Ga0268264_100581243 251
244 3300035091 Ga0373951_0070421 Ga0373951_0070421_49_807 251
245 3300048913 Ga0496110_0578481 Ga0496110_0578481_79_834 251
246 3300005441 Ga0070700_100000070 Ga0070700_10000007037 252
247 3300005444 Ga0070694_100152741 Ga0070694_1001527411 252
248 3300005543 Ga0070672_100548293 Ga0070672_1005482931 252
249 3300005546 Ga0070696_100029654 Ga0070696_1000296544 252
250 3300005617 Ga0068859_100010508 Ga0068859_1000105086 252
251 3300006931 Ga0097620_100010508 Ga0097620_1000105086 252
252 3300009174 Ga0105241_10100176 Ga0105241_101001763 252
253 3300009176 Ga0105242_10598245 Ga0105242_105982451 252
254 3300009177 Ga0105248_10003370 Ga0105248_1000337015 252
255 3300010375 Ga0105239_10397698 Ga0105239_103976982 252
256 3300013297 Ga0157378_10374879 Ga0157378_103748792 252
257 3300025941 Ga0207711_10009004 Ga0207711_100090042 252
258 3300026075 Ga0207708_10000453 Ga0207708_1000045310 252
259 3300031731 Ga0307405_10067911 Ga0307405_100679113 252
260 3300031901 Ga0307406_10050448 Ga0307406_100504482 252
261 3300032004 Ga0307414_10073591 Ga0307414_100735912 252
262 3300042005 Ga0439448_0033848 Ga0439448_0033848_154_912 252
263 3300042157 Ga0439458_0005074 Ga0439458_0005074_2050_2808 252
264 3300049521 Ga0501298_006464 Ga0501298_006464_45_803 252
265 3300049649 Ga0501198_001045 Ga0501198_001045_1194_1952 252
266 3300049653 Ga0501206_011292 Ga0501206_011292_249_1007 252
267 3300049654 Ga0501207_003680 Ga0501207_003680_1242_2000 252
268 3300049660 Ga0501216_000836 Ga0501216_000836_2146_2904 252
269 3300049661 Ga0501217_007459 Ga0501217_007459_128_886 252
270 3300049664 Ga0501224_002860 Ga0501224_002860_503_1261 252
271 3300049669 Ga0501235_005875 Ga0501235_005875_1248_2006 252
272 3300049673 Ga0501240_001870 Ga0501240_001870_1314_2072 252
273 3300049675 Ga0501243_002034 Ga0501243_002034_564_1322 252
274 3300049704 Ga0501221_013561 Ga0501221_013561_483_1241 252
275 3300049705 Ga0501225_0002080 Ga0501225_0002080_913_1671 252
276 3300049705 Ga0501225_0043639 Ga0501225_0043639_141_899 252
277 3300049706 Ga0501229_016606 Ga0501229_016606_145_903 252
278 3300049707 Ga0501234_003082 Ga0501234_003082_931_1689 252
279 3300049769 Ga0501272_017880 Ga0501272_017880_69_827 252
280 3300049770 Ga0501273_006225 Ga0501273_006225_422_1180 252
281 3300049851 Ga0501212_024030 Ga0501212_024030_52_810 252
282 3300049853 Ga0501226_000557 Ga0501226_000557_2226_2984 252
283 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001363 253
284 3300003203 JGI25406J46586_10002162 JGI25406J46586_100021627 253
285 3300005290 Ga0065712_10002668 Ga0065712_100026685 253
286 3300005293 Ga0065715_10005754 Ga0065715_100057542 253
287 3300005330 Ga0070690_100031553 Ga0070690_1000315532 253
288 3300005331 Ga0070670_100000129 Ga0070670_10000012944 253
289 3300005334 Ga0068869_100305900 Ga0068869_1003059001 253
290 3300005364 Ga0070673_100216336 Ga0070673_1002163362 253
291 3300005366 Ga0070659_100342418 Ga0070659_1003424182 253
292 3300005577 Ga0068857_100203115 Ga0068857_1002031152 253
293 3300005578 Ga0068854_100226107 Ga0068854_1002261073 253
294 3300005985 Ga0081539_10000783 Ga0081539_1000078315 253
295 3300009101 Ga0105247_10048317 Ga0105247_100483173 253
296 3300014325 Ga0163163_10000536 Ga0163163_1000053621 253
297 3300025900 Ga0207710_10016749 Ga0207710_100167492 253
298 3300025925 Ga0207650_10000001 Ga0207650_10000001113 253
299 3300025936 Ga0207670_10272106 Ga0207670_102721062 253
300 3300025981 Ga0207640_10512341 Ga0207640_105123411 253
301 3300026116 Ga0207674_10193387 Ga0207674_101933872 253
302 3300031548 Ga0307408_100070438 Ga0307408_1000704383 253
303 3300031901 Ga0307406_10162251 Ga0307406_101622513 253
304 3300032126 Ga0307415_100044648 Ga0307415_1000446482 253
305 3300049653 Ga0501206_005472 Ga0501206_005472_11_772 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

112

266

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7899 18 240
6pj8-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7783 13 240
6pj5-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7745 11 240
6pjp-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7566 18 240
2irv-assembly1.cif.gz_A crystal structure of glpg, a rhomboid intramembrane serine protease 0.7562 18 243
ID Description Score Start End Superfamily
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8386 18 238 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8251 17 240 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8199 12 242 1.20.1540.10
af_I1JZG9_137_329_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8187 18 238 1.20.1540.10
af_B4FAA8_33_228_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8136 13 245 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A7W1L2L7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9754 3 140 GO:0004252
GO:0006508
GO:0016020
AF-A0A7X8CVX7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9443 3 241 GO:0004252
GO:0006508
GO:0016020
AF-A0A7W1L2L7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9419 3 140 GO:0004252
GO:0006508
GO:0016020
AF-A0A7X9Q4R5-F1-model_v4 Rhomboid family intramembrane serine protease 0.9342 18 242 GO:0004252
GO:0006508
GO:0016020
AF-A0A1A9I1U6-F1-model_v4 Rhomboid family intramembrane serine protease 0.9332 3 244 GO:0004252
GO:0006508
GO:0016020

Feature Viewer

pLDDT pTM Quality
86.16 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map