F398254
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 181 | 306 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0202584|Ga0453684_0202584_1293_2147 |
| Length | 284 |
| Sequence | MYINSFLLPGQPVVSVVAYLHEKPFNMLMPISDDNSDRHLTPFINYLLIILNVLVFVVLQQSGNNLYFTYSFSTVPAEILTGTDIVTQGKIVIDPYTQQQFEIPGLQITPIPVYFTLLTSMFMHGGWGHLLGNMLYLYIFGDNLENRMGHGRYLAFYLLTGVLASMAHVFSSLMVPGQELIPSLGASGAISGVLGGNLILFPSRKVNALLGWFVVQVPVLVALGLWIVFQVVSGLGMLGGGSDGVAYAAHIGGFVAGMLLVKFFDKGLRKPPGRWQSRRFEYRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 106 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 107 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 108 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 110 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 111 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 114 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 121 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 122 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 123 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 124 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 125 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 126 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 127 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 128 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 137 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 142 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 147 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 148 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 149 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 150 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 151 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 152 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 153 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 154 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 156 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 157 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 158 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 159 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 160 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 161 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 162 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 163 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 164 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 165 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 166 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 167 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 171 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 172 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 173 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 174 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 175 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 176 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 181 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.3 |
| Rhizosphere | 96.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000013 | 3300002459 | Bacteria | 113565 |
| 2 | JGI25406J46586_10002162 | 3300003203 | Bacteria | 9293 |
| 3 | JGI25406J46586_10004689 | 3300003203 | Bacteria | 6362 |
| 4 | rootH1_10045760 | 3300003316 | Bacteria | 11183 |
| 5 | rootH1_10045760 | 3300003323 | Bacteria | 5061 |
| 6 | Ga0065712_10002668 | 3300005290 | Bacteria | 6597 |
| 7 | Ga0065712_10017142 | 3300005290 | Bacteria | 2179 |
| 8 | Ga0065712_10076587 | 3300005290 | Unclassified | 3599 |
| 9 | Ga0065715_10005754 | 3300005293 | Bacteria | 4856 |
| 10 | Ga0070690_100031553 | 3300005330 | Unclassified | 3302 |
| 11 | Ga0070670_100000129 | 3300005331 | Bacteria | 71325 |
| 12 | Ga0070670_100054918 | 3300005331 | Unclassified | 3419 |
| 13 | Ga0070670_100226113 | 3300005331 | Bacteria | 1628 |
| 14 | Ga0068869_100305900 | 3300005334 | Bacteria | 1285 |
| 15 | Ga0070660_100735677 | 3300005339 | Bacteria | 828 |
| 16 | Ga0070689_100307162 | 3300005340 | Bacteria | 1322 |
| 17 | Ga0070692_10232717 | 3300005345 | Bacteria | 1095 |
| 18 | Ga0070668_100027625 | 3300005347 | Bacteria | 4308 |
| 19 | Ga0070669_100001596 | 3300005353 | Bacteria | 16395 |
| 20 | Ga0070675_100021198 | 3300005354 | Bacteria | 5190 |
| 21 | Ga0070675_100627825 | 3300005354 | Bacteria | 976 |
| 22 | Ga0070673_100075298 | 3300005364 | Bacteria | 2722 |
| 23 | Ga0070673_100216336 | 3300005364 | Bacteria | 1657 |
| 24 | Ga0070688_100063014 | 3300005365 | Bacteria | 2348 |
| 25 | Ga0070659_100342418 | 3300005366 | Bacteria | 1253 |
| 26 | Ga0070667_100022995 | 3300005367 | Bacteria | 5169 |
| 27 | Ga0070700_100000070 | 3300005441 | Bacteria | 72718 |
| 28 | Ga0070700_100014022 | 3300005441 | Bacteria | 4518 |
| 29 | Ga0070694_100030369 | 3300005444 | Bacteria | 3534 |
| 30 | Ga0070694_100152741 | 3300005444 | Bacteria | 1687 |
| 31 | Ga0070694_100390083 | 3300005444 | Bacteria | 1088 |
| 32 | Ga0070678_100097374 | 3300005456 | Bacteria | 2272 |
| 33 | Ga0070662_100151820 | 3300005457 | Bacteria | 1804 |
| 34 | Ga0068867_100095661 | 3300005459 | Bacteria | 2260 |
| 35 | Ga0068867_100231464 | 3300005459 | Bacteria | 1494 |
| 36 | Ga0070698_100005833 | 3300005471 | Bacteria | 13467 |
| 37 | Ga0070698_100175480 | 3300005471 | Bacteria | 2083 |
| 38 | Ga0070699_100063244 | 3300005518 | Bacteria | 3209 |
| 39 | Ga0068853_100196488 | 3300005539 | Bacteria | 1835 |
| 40 | Ga0070672_100117406 | 3300005543 | Bacteria | 2175 |
| 41 | Ga0070672_100548293 | 3300005543 | Bacteria | 1004 |
| 42 | Ga0070695_100007274 | 3300005545 | Bacteria | 6562 |
| 43 | Ga0070696_100029654 | 3300005546 | Bacteria | 3741 |
| 44 | Ga0070693_100208562 | 3300005547 | Bacteria | 1273 |
| 45 | Ga0070693_100242197 | 3300005547 | Bacteria | 1192 |
| 46 | Ga0070704_100021850 | 3300005549 | Bacteria | 4155 |
| 47 | Ga0070664_100080721 | 3300005564 | Bacteria | 2802 |
| 48 | Ga0070664_100084001 | 3300005564 | Bacteria | 2748 |
| 49 | Ga0068857_100203115 | 3300005577 | Bacteria | 1807 |
| 50 | Ga0068857_100489203 | 3300005577 | Bacteria | 1153 |
| 51 | Ga0068854_100226107 | 3300005578 | Bacteria | 1483 |
| 52 | Ga0070702_100073202 | 3300005615 | Bacteria | 2029 |
| 53 | Ga0068852_100268397 | 3300005616 | Bacteria | 1641 |
| 54 | Ga0068852_100509858 | 3300005616 | Bacteria | 1199 |
| 55 | Ga0068859_100010508 | 3300005617 | Bacteria | 9315 |
| 56 | Ga0068859_100047313 | 3300005617 | Bacteria | 4321 |
| 57 | Ga0068859_100080639 | 3300005617 | Bacteria | 3295 |
| 58 | Ga0068859_100090911 | 3300005617 | Bacteria | 3103 |
| 59 | Ga0068859_100092704 | 3300005617 | Bacteria | 3072 |
| 60 | Ga0068859_100193780 | 3300005617 | Bacteria | 2117 |
| 61 | Ga0068864_100102133 | 3300005618 | Bacteria | 2544 |
| 62 | Ga0068864_100201402 | 3300005618 | Bacteria | 1829 |
| 63 | Ga0068864_100269689 | 3300005618 | Bacteria | 1585 |
| 64 | Ga0068864_100353807 | 3300005618 | Bacteria | 1386 |
| 65 | Ga0068864_100461594 | 3300005618 | Bacteria | 1216 |
| 66 | Ga0068866_10130381 | 3300005718 | Unclassified | 1429 |
| 67 | Ga0068861_100141350 | 3300005719 | Bacteria | 1965 |
| 68 | Ga0068861_100176754 | 3300005719 | Bacteria | 1773 |
| 69 | Ga0068863_100175861 | 3300005841 | Bacteria | 2054 |
| 70 | Ga0068863_100196504 | 3300005841 | Unclassified | 1939 |
| 71 | Ga0068863_100199756 | 3300005841 | Bacteria | 1923 |
| 72 | Ga0068863_100390099 | 3300005841 | Bacteria | 1360 |
| 73 | Ga0068858_100058286 | 3300005842 | Bacteria | 3570 |
| 74 | Ga0068858_100108248 | 3300005842 | Bacteria | 2594 |
| 75 | Ga0068858_100639769 | 3300005842 | Bacteria | 1033 |
| 76 | Ga0068860_100022560 | 3300005843 | Bacteria | 6085 |
| 77 | Ga0068860_100184604 | 3300005843 | Bacteria | 2016 |
| 78 | Ga0068860_100585333 | 3300005843 | Bacteria | 1120 |
| 79 | Ga0068860_100779588 | 3300005843 | Bacteria | 969 |
| 80 | Ga0068862_100002420 | 3300005844 | Bacteria | 16571 |
| 81 | Ga0068862_100009883 | 3300005844 | Bacteria | 7880 |
| 82 | Ga0081539_10000360 | 3300005985 | Bacteria | 100156 |
| 83 | Ga0081539_10000783 | 3300005985 | Bacteria | 61928 |
| 84 | Ga0097621_100000460 | 3300006237 | Bacteria | 28549 |
| 85 | Ga0097621_100182894 | 3300006237 | Unclassified | 1812 |
| 86 | Ga0068871_100000251 | 3300006358 | Bacteria | 37472 |
| 87 | Ga0068871_100102604 | 3300006358 | Bacteria | 2398 |
| 88 | Ga0075430_100012882 | 3300006846 | Bacteria | 7126 |
| 89 | Ga0075430_100051911 | 3300006846 | Bacteria | 3453 |
| 90 | Ga0075430_100083983 | 3300006846 | Bacteria | 2667 |
| 91 | Ga0075430_100202117 | 3300006846 | Bacteria | 1650 |
| 92 | Ga0075430_100362036 | 3300006846 | Bacteria | 1198 |
| 93 | Ga0075431_100014315 | 3300006847 | Bacteria | 8023 |
| 94 | Ga0075431_100101979 | 3300006847 | Bacteria | 2961 |
| 95 | Ga0075431_100160869 | 3300006847 | Bacteria | 2309 |
| 96 | Ga0075431_100526402 | 3300006847 | Bacteria | 1171 |
| 97 | Ga0075434_100216190 | 3300006871 | Bacteria | 1937 |
| 98 | Ga0075429_100085830 | 3300006880 | Bacteria | 2743 |
| 99 | Ga0075429_100508511 | 3300006880 | Bacteria | 1056 |
| 100 | Ga0075436_100000173 | 3300006914 | Bacteria | 40359 |
| 101 | Ga0097620_100010508 | 3300006931 | Bacteria | 9315 |
| 102 | Ga0097620_100047313 | 3300006931 | Bacteria | 4321 |
| 103 | Ga0097620_100080640 | 3300006931 | Bacteria | 3295 |
| 104 | Ga0097620_100090910 | 3300006931 | Bacteria | 3103 |
| 105 | Ga0097620_100092710 | 3300006931 | Bacteria | 3072 |
| 106 | Ga0097620_100193772 | 3300006931 | Bacteria | 2117 |
| 107 | Ga0075435_100510527 | 3300007076 | Bacteria | 1040 |
| 108 | Ga0105251_10036530 | 3300009011 | Bacteria | 2417 |
| 109 | Ga0105247_10048317 | 3300009101 | Bacteria | 2613 |
| 110 | Ga0105247_10053337 | 3300009101 | Bacteria | 2494 |
| 111 | Ga0105247_10086587 | 3300009101 | Bacteria | 1983 |
| 112 | Ga0105241_10100176 | 3300009174 | Bacteria | 2302 |
| 113 | Ga0105241_10849485 | 3300009174 | Bacteria | 844 |
| 114 | Ga0105242_10598245 | 3300009176 | Bacteria | 1065 |
| 115 | Ga0105248_10003370 | 3300009177 | Bacteria | 17750 |
| 116 | Ga0105248_10091388 | 3300009177 | Bacteria | 3428 |
| 117 | Ga0105248_10097744 | 3300009177 | Bacteria | 3308 |
| 118 | Ga0105248_10222513 | 3300009177 | Unclassified | 2125 |
| 119 | Ga0105248_10892880 | 3300009177 | Bacteria | 1003 |
| 120 | Ga0105237_10471080 | 3300009545 | Bacteria | 1262 |
| 121 | Ga0105238_10003652 | 3300009551 | Bacteria | 15343 |
| 122 | Ga0105249_10017478 | 3300009553 | Bacteria | 6368 |
| 123 | Ga0105249_10018257 | 3300009553 | Bacteria | 6236 |
| 124 | Ga0105239_10397698 | 3300010375 | Bacteria | 1559 |
| 125 | Ga0105246_10119306 | 3300011119 | Unclassified | 1951 |
| 126 | Ga0105246_10279657 | 3300011119 | Bacteria | 1338 |
| 127 | Ga0105246_10475664 | 3300011119 | Bacteria | 1056 |
| 128 | Ga0157371_10033088 | 3300013102 | Bacteria | 3716 |
| 129 | Ga0157374_10025860 | 3300013296 | Bacteria | 5277 |
| 130 | Ga0157378_10046347 | 3300013297 | Unclassified | 3865 |
| 131 | Ga0157378_10374879 | 3300013297 | Bacteria | 1396 |
| 132 | Ga0163162_10000628 | 3300013306 | Bacteria | 32760 |
| 133 | Ga0163162_10001072 | 3300013306 | Bacteria | 25452 |
| 134 | Ga0163162_10108318 | 3300013306 | Bacteria | 2875 |
| 135 | Ga0163162_10135830 | 3300013306 | Bacteria | 2570 |
| 136 | Ga0157372_11137834 | 3300013307 | Bacteria | 903 |
| 137 | Ga0157375_10000403 | 3300013308 | Bacteria | 39237 |
| 138 | Ga0157375_10105735 | 3300013308 | Unclassified | 2906 |
| 139 | Ga0163163_10000360 | 3300014325 | Bacteria | 43731 |
| 140 | Ga0163163_10000536 | 3300014325 | Bacteria | 33560 |
| 141 | Ga0163163_10536746 | 3300014325 | Bacteria | 1232 |
| 142 | Ga0163163_10702370 | 3300014325 | Bacteria | 1075 |
| 143 | Ga0157380_10035300 | 3300014326 | Bacteria | 3862 |
| 144 | Ga0157379_10013524 | 3300014968 | Bacteria | 7152 |
| 145 | Ga0157379_10174795 | 3300014968 | Unclassified | 1939 |
| 146 | Ga0157376_10000637 | 3300014969 | Bacteria | 22720 |
| 147 | Ga0163161_10003438 | 3300017792 | Bacteria | 11099 |
| 148 | Ga0163161_10013957 | 3300017792 | Bacteria | 5594 |
| 149 | Ga0207710_10016749 | 3300025900 | Bacteria | 3103 |
| 150 | Ga0207710_10027307 | 3300025900 | Bacteria | 2471 |
| 151 | Ga0207643_10043839 | 3300025908 | Bacteria | 2525 |
| 152 | Ga0207684_10361051 | 3300025910 | Bacteria | 1250 |
| 153 | Ga0207654_10044375 | 3300025911 | Bacteria | 2525 |
| 154 | Ga0207681_10173889 | 3300025923 | Bacteria | 1634 |
| 155 | Ga0207694_10009319 | 3300025924 | Bacteria | 7406 |
| 156 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 157 | Ga0207650_10037860 | 3300025925 | Unclassified | 3518 |
| 158 | Ga0207650_10190650 | 3300025925 | Bacteria | 1638 |
| 159 | Ga0207644_10007255 | 3300025931 | Bacteria | 7214 |
| 160 | Ga0207706_10016666 | 3300025933 | Bacteria | 6632 |
| 161 | Ga0207706_10059734 | 3300025933 | Bacteria | 3358 |
| 162 | Ga0207709_10042557 | 3300025935 | Bacteria | 2733 |
| 163 | Ga0207670_10272106 | 3300025936 | Bacteria | 1317 |
| 164 | Ga0207704_10075655 | 3300025938 | Bacteria | 2154 |
| 165 | Ga0207711_10009004 | 3300025941 | Bacteria | 8348 |
| 166 | Ga0207711_10173273 | 3300025941 | Unclassified | 1959 |
| 167 | Ga0207689_10127507 | 3300025942 | Bacteria | 2093 |
| 168 | Ga0207689_10619159 | 3300025942 | Bacteria | 911 |
| 169 | Ga0207679_10111210 | 3300025945 | Bacteria | 2162 |
| 170 | Ga0207651_10062884 | 3300025960 | Bacteria | 2589 |
| 171 | Ga0207712_10000970 | 3300025961 | Bacteria | 20652 |
| 172 | Ga0207712_10008719 | 3300025961 | Bacteria | 6414 |
| 173 | Ga0207712_10080373 | 3300025961 | Bacteria | 2371 |
| 174 | Ga0207668_10019471 | 3300025972 | Bacteria | 4292 |
| 175 | Ga0207668_10851554 | 3300025972 | Bacteria | 809 |
| 176 | Ga0207640_10512341 | 3300025981 | Bacteria | 1001 |
| 177 | Ga0207640_10622288 | 3300025981 | Bacteria | 916 |
| 178 | Ga0207703_10103590 | 3300026035 | Bacteria | 2416 |
| 179 | Ga0207639_10269224 | 3300026041 | Bacteria | 1493 |
| 180 | Ga0207708_10000453 | 3300026075 | Bacteria | 31845 |
| 181 | Ga0207708_10020464 | 3300026075 | Bacteria | 4990 |
| 182 | Ga0207641_10052886 | 3300026088 | Unclassified | 3441 |
| 183 | Ga0207641_10277502 | 3300026088 | Bacteria | 1575 |
| 184 | Ga0207641_10304633 | 3300026088 | Unclassified | 1506 |
| 185 | Ga0207648_10165330 | 3300026089 | Bacteria | 1955 |
| 186 | Ga0207648_10289337 | 3300026089 | Bacteria | 1467 |
| 187 | Ga0207676_10417037 | 3300026095 | Bacteria | 1258 |
| 188 | Ga0207676_10455178 | 3300026095 | Bacteria | 1207 |
| 189 | Ga0207674_10056125 | 3300026116 | Bacteria | 4001 |
| 190 | Ga0207674_10106999 | 3300026116 | Bacteria | 2774 |
| 191 | Ga0207674_10193387 | 3300026116 | Bacteria | 1984 |
| 192 | Ga0207675_100042164 | 3300026118 | Bacteria | 4260 |
| 193 | Ga0207675_100097801 | 3300026118 | Bacteria | 2764 |
| 194 | Ga0207683_10100333 | 3300026121 | Bacteria | 2584 |
| 195 | Ga0268264_10017883 | 3300028381 | Bacteria | 5801 |
| 196 | Ga0268264_10058124 | 3300028381 | Bacteria | 3237 |
| 197 | Ga0268264_10529989 | 3300028381 | Bacteria | 1152 |
| 198 | Ga0307408_100062555 | 3300031548 | Bacteria | 2720 |
| 199 | Ga0307408_100070438 | 3300031548 | Bacteria | 2582 |
| 200 | Ga0307408_100383752 | 3300031548 | Bacteria | 1202 |
| 201 | Ga0307508_10019877 | 3300031616 | Bacteria | 6103 |
| 202 | Ga0316576_10354702 | 3300031727 | Bacteria | 1091 |
| 203 | Ga0307405_10067911 | 3300031731 | Bacteria | 2279 |
| 204 | Ga0307405_10143624 | 3300031731 | Bacteria | 1668 |
| 205 | Ga0307413_10605858 | 3300031824 | Bacteria | 897 |
| 206 | Ga0307410_10304187 | 3300031852 | Bacteria | 1259 |
| 207 | Ga0307406_10050448 | 3300031901 | Bacteria | 2638 |
| 208 | Ga0307406_10162251 | 3300031901 | Bacteria | 1608 |
| 209 | Ga0307406_10384284 | 3300031901 | Bacteria | 1108 |
| 210 | Ga0307412_10028885 | 3300031911 | Bacteria | 3476 |
| 211 | Ga0307409_100384157 | 3300031995 | Bacteria | 1336 |
| 212 | Ga0307416_100000619 | 3300032002 | Bacteria | 18304 |
| 213 | Ga0307416_101488052 | 3300032002 | Bacteria | 783 |
| 214 | Ga0307414_10073591 | 3300032004 | Bacteria | 2472 |
| 215 | Ga0307414_10638164 | 3300032004 | Bacteria | 959 |
| 216 | Ga0307415_100044648 | 3300032126 | Bacteria | 2964 |
| 217 | Ga0307415_100115977 | 3300032126 | Bacteria | 1997 |
| 218 | Ga0373951_0070421 | 3300035091 | Bacteria | 890 |
| 219 | Ga0373942_0003437 | 3300035207 | Bacteria | 3720 |
| 220 | Ga0373961_0000513 | 3300035241 | Bacteria | 14851 |
| 221 | Ga0316574_0005114 | 3300035398 | Bacteria | 6971 |
| 222 | Ga0316582_0007197 | 3300036647 | Bacteria | 5915 |
| 223 | Ga0242422_02143 | 3300038699 | Bacteria | 1344 |
| 224 | Ga0400483_041340 | 3300039062 | Bacteria | 1039 |
| 225 | Ga0439431_0034603 | 3300041997 | Bacteria | 1267 |
| 226 | Ga0439448_0033848 | 3300042005 | Bacteria | 1631 |
| 227 | Ga0439458_0005074 | 3300042157 | Bacteria | 2974 |
| 228 | Ga0451577_0050025 | 3300042876 | Bacteria | 3731 |
| 229 | Ga0453684_0167537 | 3300044712 | Bacteria | 2592 |
| 230 | Ga0453684_0202584 | 3300044712 | Bacteria | 2312 |
| 231 | Ga0453684_0919522 | 3300044712 | Unclassified | 936 |
| 232 | Ga0466970_0002902 | 3300044765 | Bacteria | 8308 |
| 233 | Ga0451576_0084913 | 3300045051 | Bacteria | 3293 |
| 234 | Ga0495643_0010796 | 3300046522 | Bacteria | 5601 |
| 235 | Ga0495613_0073792 | 3300046689 | Bacteria | 2485 |
| 236 | Ga0495600_0122258 | 3300046809 | Bacteria | 1693 |
| 237 | Ga0496100_0237953 | 3300048903 | Unclassified | 1342 |
| 238 | Ga0496104_0259474 | 3300048907 | Unclassified | 1651 |
| 239 | Ga0496106_0064870 | 3300048909 | Bacteria | 2779 |
| 240 | Ga0496108_0068538 | 3300048911 | Bacteria | 2993 |
| 241 | Ga0496110_0578481 | 3300048913 | Bacteria | 1020 |
| 242 | Ga0496112_0491711 | 3300048915 | Bacteria | 1163 |
| 243 | Ga0496114_0000004 | 3300048917 | Bacteria | 591126 |
| 244 | Ga0501293_010466 | 3300049516 | Bacteria | 802 |
| 245 | Ga0501298_002358 | 3300049521 | Bacteria | 2851 |
| 246 | Ga0501298_006464 | 3300049521 | Bacteria | 1917 |
| 247 | Ga0501068_0056726 | 3300049584 | Bacteria | 2374 |
| 248 | Ga0501075_0027709 | 3300049591 | Bacteria | 4176 |
| 249 | Ga0501077_0001348 | 3300049593 | Bacteria | 14786 |
| 250 | Ga0501198_001045 | 3300049649 | Bacteria | 3527 |
| 251 | Ga0501198_001163 | 3300049649 | Bacteria | 3372 |
| 252 | Ga0501198_013132 | 3300049649 | Bacteria | 1251 |
| 253 | Ga0501201_002606 | 3300049651 | Bacteria | 1652 |
| 254 | Ga0501202_009920 | 3300049652 | Bacteria | 1759 |
| 255 | Ga0501206_002023 | 3300049653 | Bacteria | 2558 |
| 256 | Ga0501206_005472 | 3300049653 | Bacteria | 1635 |
| 257 | Ga0501206_011292 | 3300049653 | Bacteria | 1204 |
| 258 | Ga0501207_003680 | 3300049654 | Bacteria | 2053 |
| 259 | Ga0501216_000836 | 3300049660 | Bacteria | 3877 |
| 260 | Ga0501217_000031 | 3300049661 | Bacteria | 15253 |
| 261 | Ga0501217_007459 | 3300049661 | Bacteria | 2345 |
| 262 | Ga0501222_004367 | 3300049662 | Bacteria | 1919 |
| 263 | Ga0501223_004205 | 3300049663 | Bacteria | 3101 |
| 264 | Ga0501224_002860 | 3300049664 | Bacteria | 2378 |
| 265 | Ga0501224_006057 | 3300049664 | Bacteria | 1749 |
| 266 | Ga0501233_028307 | 3300049668 | Bacteria | 1250 |
| 267 | Ga0501235_005875 | 3300049669 | Bacteria | 2672 |
| 268 | Ga0501235_011027 | 3300049669 | Bacteria | 1978 |
| 269 | Ga0501235_031844 | 3300049669 | Bacteria | 1192 |
| 270 | Ga0501240_001870 | 3300049673 | Bacteria | 2132 |
| 271 | Ga0501242_014532 | 3300049674 | Bacteria | 975 |
| 272 | Ga0501243_002034 | 3300049675 | Bacteria | 2938 |
| 273 | Ga0501256_008209 | 3300049685 | Bacteria | 970 |
| 274 | Ga0501259_012166 | 3300049688 | Bacteria | 1433 |
| 275 | Ga0501261_001243 | 3300049690 | Bacteria | 3130 |
| 276 | Ga0501221_000508 | 3300049704 | Bacteria | 6138 |
| 277 | Ga0501221_013561 | 3300049704 | Bacteria | 1501 |
| 278 | Ga0501225_0002080 | 3300049705 | Bacteria | 6222 |
| 279 | Ga0501225_0003007 | 3300049705 | Bacteria | 5149 |
| 280 | Ga0501225_0043639 | 3300049705 | Bacteria | 1239 |
| 281 | Ga0501229_016606 | 3300049706 | Bacteria | 958 |
| 282 | Ga0501234_003082 | 3300049707 | Bacteria | 2619 |
| 283 | Ga0501234_009830 | 3300049707 | Bacteria | 1492 |
| 284 | Ga0501245_003634 | 3300049708 | Bacteria | 2101 |
| 285 | Ga0501080_0002058 | 3300049742 | Bacteria | 17419 |
| 286 | Ga0501241_030984 | 3300049758 | Unclassified | 1011 |
| 287 | Ga0501272_017880 | 3300049769 | Bacteria | 837 |
| 288 | Ga0501273_006225 | 3300049770 | Bacteria | 1376 |
| 289 | Ga0501279_004687 | 3300049775 | Bacteria | 1796 |
| 290 | Ga0501279_016412 | 3300049775 | Unclassified | 1031 |
| 291 | Ga0501212_006153 | 3300049851 | Bacteria | 1610 |
| 292 | Ga0501212_024030 | 3300049851 | Bacteria | 958 |
| 293 | Ga0501226_000557 | 3300049853 | Bacteria | 5127 |
| 294 | nmdc:mga05p37_795500_c1 | 3300050507 | Bacteria | 1035 |
| 295 | nmdc:mga0qj67_319837_c1 | 3300050509 | Bacteria | 1256 |
| 296 | nmdc:mga0qj67_44441_c1 | 3300050509 | Bacteria | 3501 |
| 297 | nmdc:mga0qj67_51034_c1 | 3300050509 | Bacteria | 3270 |
| 298 | nmdc:mga0qj67_596823_c1 | 3300050509 | Unclassified | 883 |
| 299 | nmdc:mga0qj67_64072_c1 | 3300050509 | Bacteria | 2923 |
| 300 | nmdc:mga06r32_15228_c1 | 3300050510 | Bacteria | 6985 |
| 301 | nmdc:mga06r32_174303_c1 | 3300050510 | Bacteria | 2135 |
| 302 | nmdc:mga06r32_576684_c1 | 3300050510 | Bacteria | 1097 |
| 303 | nmdc:mga06r32_63237_c1 | 3300050510 | Bacteria | 3566 |
| 304 | nmdc:mga08x19_204_c1 | 3300050514 | Bacteria | 45670 |
| 305 | Ga0590075_019032 | 3300059424 | Bacteria | 1702 |
| 306 | Ga0501082_0001002 | 3300060353 | Bacteria | 24955 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0073792 | Ga0495613_0073792_256_1020 | 201 |
| 2 | 3300046809 | Ga0495600_0122258 | Ga0495600_0122258_721_1485 | 201 |
| 3 | 3300049584 | Ga0501068_0056726 | Ga0501068_0056726_1225_1917 | 204 |
| 4 | 3300049591 | Ga0501075_0027709 | Ga0501075_0027709_28_720 | 204 |
| 5 | 3300049593 | Ga0501077_0001348 | Ga0501077_0001348_12947_13639 | 204 |
| 6 | 3300049742 | Ga0501080_0002058 | Ga0501080_0002058_4171_4863 | 204 |
| 7 | 3300060353 | Ga0501082_0001002 | Ga0501082_0001002_4860_5552 | 204 |
| 8 | 3300006871 | Ga0075434_100216190 | Ga0075434_1002161902 | 207 |
| 9 | 3300006914 | Ga0075436_100000173 | Ga0075436_1000001734 | 207 |
| 10 | 3300007076 | Ga0075435_100510527 | Ga0075435_1005105272 | 207 |
| 11 | 3300050514 | nmdc:mga08x19_204_c1 | nmdc:mga08x19_204_c1_35832_36533 | 207 |
| 12 | 3300039062 | Ga0400483_041340 | Ga0400483_041340_131_865 | 210 |
| 13 | 3300032002 | Ga0307416_101488052 | Ga0307416_1014880521 | 212 |
| 14 | 3300032004 | Ga0307414_10638164 | Ga0307414_106381641 | 212 |
| 15 | 3300009545 | Ga0105237_10471080 | Ga0105237_104710802 | 213 |
| 16 | 3300046522 | Ga0495643_0010796 | Ga0495643_0010796_4405_5127 | 213 |
| 17 | 3300031727 | Ga0316576_10354702 | Ga0316576_103547021 | 214 |
| 18 | 3300035398 | Ga0316574_0005114 | Ga0316574_0005114_1642_2349 | 214 |
| 19 | 3300036647 | Ga0316582_0007197 | Ga0316582_0007197_702_1409 | 214 |
| 20 | 3300059424 | Ga0590075_019032 | Ga0590075_019032_877_1653 | 214 |
| 21 | 3300035241 | Ga0373961_0000513 | Ga0373961_0000513_10469_11158 | 217 |
| 22 | 3300048917 | Ga0496114_0000004 | Ga0496114_0000004_401246_401953 | 218 |
| 23 | 3300005364 | Ga0070673_100075298 | Ga0070673_1000752982 | 219 |
| 24 | 3300025960 | Ga0207651_10062884 | Ga0207651_100628842 | 219 |
| 25 | 3300005843 | Ga0068860_100779588 | Ga0068860_1007795882 | 220 |
| 26 | 3300025942 | Ga0207689_10619159 | Ga0207689_106191591 | 220 |
| 27 | 3300006847 | Ga0075431_100526402 | Ga0075431_1005264021 | 221 |
| 28 | 3300013102 | Ga0157371_10033088 | Ga0157371_100330884 | 221 |
| 29 | 3300031616 | Ga0307508_10019877 | Ga0307508_100198774 | 221 |
| 30 | 3300050510 | nmdc:mga06r32_576684_c1 | nmdc:mga06r32_576684_c1_307_1080 | 221 |
| 31 | 3300005347 | Ga0070668_100027625 | Ga0070668_1000276252 | 222 |
| 32 | 3300005353 | Ga0070669_100001596 | Ga0070669_10000159617 | 222 |
| 33 | 3300005457 | Ga0070662_100151820 | Ga0070662_1001518202 | 222 |
| 34 | 3300005471 | Ga0070698_100005833 | Ga0070698_1000058333 | 222 |
| 35 | 3300005471 | Ga0070698_100175480 | Ga0070698_1001754802 | 222 |
| 36 | 3300005719 | Ga0068861_100141350 | Ga0068861_1001413502 | 222 |
| 37 | 3300005844 | Ga0068862_100002420 | Ga0068862_10000242017 | 222 |
| 38 | 3300006846 | Ga0075430_100012882 | Ga0075430_1000128825 | 222 |
| 39 | 3300006846 | Ga0075430_100051911 | Ga0075430_1000519112 | 222 |
| 40 | 3300006846 | Ga0075430_100083983 | Ga0075430_1000839834 | 222 |
| 41 | 3300006846 | Ga0075430_100202117 | Ga0075430_1002021172 | 222 |
| 42 | 3300006846 | Ga0075430_100362036 | Ga0075430_1003620361 | 222 |
| 43 | 3300006847 | Ga0075431_100014315 | Ga0075431_1000143159 | 222 |
| 44 | 3300006847 | Ga0075431_100101979 | Ga0075431_1001019792 | 222 |
| 45 | 3300006847 | Ga0075431_100160869 | Ga0075431_1001608692 | 222 |
| 46 | 3300006880 | Ga0075429_100085830 | Ga0075429_1000858301 | 222 |
| 47 | 3300006880 | Ga0075429_100508511 | Ga0075429_1005085112 | 222 |
| 48 | 3300011119 | Ga0105246_10279657 | Ga0105246_102796573 | 222 |
| 49 | 3300013306 | Ga0163162_10135830 | Ga0163162_101358301 | 222 |
| 50 | 3300025908 | Ga0207643_10043839 | Ga0207643_100438392 | 222 |
| 51 | 3300025923 | Ga0207681_10173889 | Ga0207681_101738892 | 222 |
| 52 | 3300025933 | Ga0207706_10016666 | Ga0207706_100166662 | 222 |
| 53 | 3300025961 | Ga0207712_10000970 | Ga0207712_1000097019 | 222 |
| 54 | 3300025972 | Ga0207668_10019471 | Ga0207668_100194717 | 222 |
| 55 | 3300026089 | Ga0207648_10165330 | Ga0207648_101653302 | 222 |
| 56 | 3300026116 | Ga0207674_10056125 | Ga0207674_100561251 | 222 |
| 57 | 3300026118 | Ga0207675_100097801 | Ga0207675_1000978011 | 222 |
| 58 | 3300031548 | Ga0307408_100062555 | Ga0307408_1000625551 | 222 |
| 59 | 3300031548 | Ga0307408_100383752 | Ga0307408_1003837522 | 222 |
| 60 | 3300031901 | Ga0307406_10384284 | Ga0307406_103842841 | 222 |
| 61 | 3300031911 | Ga0307412_10028885 | Ga0307412_100288854 | 222 |
| 62 | 3300032002 | Ga0307416_100000619 | Ga0307416_1000006195 | 222 |
| 63 | 3300049516 | Ga0501293_010466 | Ga0501293_010466_123_791 | 222 |
| 64 | 3300050507 | nmdc:mga05p37_795500_c1 | nmdc:mga05p37_795500_c1_37_807 | 222 |
| 65 | 3300050509 | nmdc:mga0qj67_319837_c1 | nmdc:mga0qj67_319837_c1_421_1200 | 222 |
| 66 | 3300050509 | nmdc:mga0qj67_44441_c1 | nmdc:mga0qj67_44441_c1_2621_3394 | 222 |
| 67 | 3300050509 | nmdc:mga0qj67_51034_c1 | nmdc:mga0qj67_51034_c1_228_1001 | 222 |
| 68 | 3300050509 | nmdc:mga0qj67_596823_c1 | nmdc:mga0qj67_596823_c1_10_789 | 222 |
| 69 | 3300050509 | nmdc:mga0qj67_64072_c1 | nmdc:mga0qj67_64072_c1_1296_2072 | 222 |
| 70 | 3300050510 | nmdc:mga06r32_15228_c1 | nmdc:mga06r32_15228_c1_5315_6088 | 222 |
| 71 | 3300050510 | nmdc:mga06r32_174303_c1 | nmdc:mga06r32_174303_c1_237_1010 | 222 |
| 72 | 3300050510 | nmdc:mga06r32_63237_c1 | nmdc:mga06r32_63237_c1_1351_2130 | 222 |
| 73 | 3300041997 | Ga0439431_0034603 | Ga0439431_0034603_407_1213 | 223 |
| 74 | 3300006358 | Ga0068871_100102604 | Ga0068871_1001026043 | 224 |
| 75 | 3300044712 | Ga0453684_0919522 | Ga0453684_0919522_65_832 | 225 |
| 76 | 3300005617 | Ga0068859_100193780 | Ga0068859_1001937802 | 226 |
| 77 | 3300006931 | Ga0097620_100193772 | Ga0097620_1001937722 | 226 |
| 78 | 3300005290 | Ga0065712_10076587 | Ga0065712_100765871 | 236 |
| 79 | 3300005354 | Ga0070675_100021198 | Ga0070675_1000211984 | 236 |
| 80 | 3300005365 | Ga0070688_100063014 | Ga0070688_1000630143 | 236 |
| 81 | 3300005543 | Ga0070672_100117406 | Ga0070672_1001174063 | 236 |
| 82 | 3300014325 | Ga0163163_10536746 | Ga0163163_105367462 | 236 |
| 83 | 3300014326 | Ga0157380_10035300 | Ga0157380_100353002 | 236 |
| 84 | 3300025972 | Ga0207668_10851554 | Ga0207668_108515541 | 236 |
| 85 | 3300031824 | Ga0307413_10605858 | Ga0307413_106058581 | 236 |
| 86 | 3300031995 | Ga0307409_100384157 | Ga0307409_1003841572 | 238 |
| 87 | 3300025910 | Ga0207684_10361051 | Ga0207684_103610512 | 240 |
| 88 | 3300005616 | Ga0068852_100509858 | Ga0068852_1005098582 | 243 |
| 89 | 3300003316 | rootH1_10045760 | rootH1_100457604 | 244 |
| 90 | 3300003203 | JGI25406J46586_10004689 | JGI25406J46586_100046892 | 245 |
| 91 | 3300005617 | Ga0068859_100080639 | Ga0068859_1000806391 | 245 |
| 92 | 3300005618 | Ga0068864_100201402 | Ga0068864_1002014022 | 245 |
| 93 | 3300005841 | Ga0068863_100199756 | Ga0068863_1001997561 | 245 |
| 94 | 3300005843 | Ga0068860_100022560 | Ga0068860_1000225608 | 245 |
| 95 | 3300005844 | Ga0068862_100009883 | Ga0068862_1000098835 | 245 |
| 96 | 3300005985 | Ga0081539_10000360 | Ga0081539_1000036014 | 245 |
| 97 | 3300006931 | Ga0097620_100080640 | Ga0097620_1000806405 | 245 |
| 98 | 3300026095 | Ga0207676_10417037 | Ga0207676_104170371 | 245 |
| 99 | 3300028381 | Ga0268264_10017883 | Ga0268264_100178831 | 245 |
| 100 | 3300044712 | Ga0453684_0167537 | Ga0453684_0167537_1096_1857 | 246 |
| 101 | 3300044765 | Ga0466970_0002902 | Ga0466970_0002902_1398_2171 | 246 |
| 102 | 3300005367 | Ga0070667_100022995 | Ga0070667_1000229956 | 247 |
| 103 | 3300005564 | Ga0070664_100080721 | Ga0070664_1000807212 | 247 |
| 104 | 3300005616 | Ga0068852_100268397 | Ga0068852_1002683973 | 247 |
| 105 | 3300005718 | Ga0068866_10130381 | Ga0068866_101303812 | 247 |
| 106 | 3300005841 | Ga0068863_100196504 | Ga0068863_1001965042 | 247 |
| 107 | 3300005842 | Ga0068858_100639769 | Ga0068858_1006397692 | 247 |
| 108 | 3300006237 | Ga0097621_100000460 | Ga0097621_10000046013 | 247 |
| 109 | 3300006358 | Ga0068871_100000251 | Ga0068871_10000025130 | 247 |
| 110 | 3300009177 | Ga0105248_10222513 | Ga0105248_102225132 | 247 |
| 111 | 3300009553 | Ga0105249_10017478 | Ga0105249_100174782 | 247 |
| 112 | 3300013296 | Ga0157374_10025860 | Ga0157374_100258601 | 247 |
| 113 | 3300013297 | Ga0157378_10046347 | Ga0157378_100463472 | 247 |
| 114 | 3300013306 | Ga0163162_10000628 | Ga0163162_1000062816 | 247 |
| 115 | 3300013306 | Ga0163162_10001072 | Ga0163162_100010724 | 247 |
| 116 | 3300013306 | Ga0163162_10108318 | Ga0163162_101083181 | 247 |
| 117 | 3300013308 | Ga0157375_10000403 | Ga0157375_100004038 | 247 |
| 118 | 3300013308 | Ga0157375_10105735 | Ga0157375_101057353 | 247 |
| 119 | 3300014325 | Ga0163163_10000360 | Ga0163163_1000036021 | 247 |
| 120 | 3300014968 | Ga0157379_10013524 | Ga0157379_100135249 | 247 |
| 121 | 3300014968 | Ga0157379_10174795 | Ga0157379_101747952 | 247 |
| 122 | 3300014969 | Ga0157376_10000637 | Ga0157376_1000063716 | 247 |
| 123 | 3300017792 | Ga0163161_10003438 | Ga0163161_100034385 | 247 |
| 124 | 3300017792 | Ga0163161_10013957 | Ga0163161_100139578 | 247 |
| 125 | 3300025931 | Ga0207644_10007255 | Ga0207644_100072554 | 247 |
| 126 | 3300025941 | Ga0207711_10173273 | Ga0207711_101732732 | 247 |
| 127 | 3300025945 | Ga0207679_10111210 | Ga0207679_101112102 | 247 |
| 128 | 3300025961 | Ga0207712_10080373 | Ga0207712_100803732 | 247 |
| 129 | 3300026088 | Ga0207641_10052886 | Ga0207641_100528863 | 247 |
| 130 | 3300031731 | Ga0307405_10143624 | Ga0307405_101436243 | 247 |
| 131 | 3300031852 | Ga0307410_10304187 | Ga0307410_103041872 | 247 |
| 132 | 3300032126 | Ga0307415_100115977 | Ga0307415_1001159772 | 247 |
| 133 | 3300048903 | Ga0496100_0237953 | Ga0496100_0237953_519_1286 | 247 |
| 134 | 3300048907 | Ga0496104_0259474 | Ga0496104_0259474_259_1026 | 247 |
| 135 | 3300049649 | Ga0501198_013132 | Ga0501198_013132_168_926 | 247 |
| 136 | 3300049669 | Ga0501235_031844 | Ga0501235_031844_235_993 | 247 |
| 137 | 3300049707 | Ga0501234_009830 | Ga0501234_009830_639_1397 | 247 |
| 138 | 3300049775 | Ga0501279_016412 | Ga0501279_016412_16_774 | 247 |
| 139 | 3300005331 | Ga0070670_100226113 | Ga0070670_1002261132 | 248 |
| 140 | 3300005456 | Ga0070678_100097374 | Ga0070678_1000973742 | 248 |
| 141 | 3300005459 | Ga0068867_100231464 | Ga0068867_1002314642 | 248 |
| 142 | 3300005618 | Ga0068864_100461594 | Ga0068864_1004615941 | 248 |
| 143 | 3300025925 | Ga0207650_10190650 | Ga0207650_101906502 | 248 |
| 144 | 3300026121 | Ga0207683_10100333 | Ga0207683_101003332 | 248 |
| 145 | 3300042876 | Ga0451577_0050025 | Ga0451577_0050025_560_1345 | 248 |
| 146 | 3300044712 | Ga0453684_0202584 | Ga0453684_0202584_1293_2147 | 248 |
| 147 | 3300049521 | Ga0501298_002358 | Ga0501298_002358_1768_2526 | 248 |
| 148 | 3300049649 | Ga0501198_001163 | Ga0501198_001163_1941_2699 | 248 |
| 149 | 3300049651 | Ga0501201_002606 | Ga0501201_002606_99_857 | 248 |
| 150 | 3300049652 | Ga0501202_009920 | Ga0501202_009920_930_1688 | 248 |
| 151 | 3300049653 | Ga0501206_002023 | Ga0501206_002023_155_913 | 248 |
| 152 | 3300049661 | Ga0501217_000031 | Ga0501217_000031_6743_7501 | 248 |
| 153 | 3300049662 | Ga0501222_004367 | Ga0501222_004367_677_1435 | 248 |
| 154 | 3300049663 | Ga0501223_004205 | Ga0501223_004205_1839_2597 | 248 |
| 155 | 3300049664 | Ga0501224_006057 | Ga0501224_006057_104_862 | 248 |
| 156 | 3300049668 | Ga0501233_028307 | Ga0501233_028307_13_771 | 248 |
| 157 | 3300049669 | Ga0501235_011027 | Ga0501235_011027_563_1321 | 248 |
| 158 | 3300049674 | Ga0501242_014532 | Ga0501242_014532_205_963 | 248 |
| 159 | 3300049685 | Ga0501256_008209 | Ga0501256_008209_71_829 | 248 |
| 160 | 3300049688 | Ga0501259_012166 | Ga0501259_012166_70_828 | 248 |
| 161 | 3300049690 | Ga0501261_001243 | Ga0501261_001243_2262_3020 | 248 |
| 162 | 3300049704 | Ga0501221_000508 | Ga0501221_000508_3117_3875 | 248 |
| 163 | 3300049705 | Ga0501225_0003007 | Ga0501225_0003007_585_1343 | 248 |
| 164 | 3300049708 | Ga0501245_003634 | Ga0501245_003634_1112_1870 | 248 |
| 165 | 3300049758 | Ga0501241_030984 | Ga0501241_030984_94_852 | 248 |
| 166 | 3300049775 | Ga0501279_004687 | Ga0501279_004687_693_1451 | 248 |
| 167 | 3300049851 | Ga0501212_006153 | Ga0501212_006153_247_1005 | 248 |
| 168 | 3300005354 | Ga0070675_100627825 | Ga0070675_1006278251 | 249 |
| 169 | 3300005444 | Ga0070694_100030369 | Ga0070694_1000303692 | 249 |
| 170 | 3300005545 | Ga0070695_100007274 | Ga0070695_1000072748 | 249 |
| 171 | 3300011119 | Ga0105246_10475664 | Ga0105246_104756641 | 249 |
| 172 | 3300013307 | Ga0157372_11137834 | Ga0157372_111378341 | 249 |
| 173 | 3300005290 | Ga0065712_10017142 | Ga0065712_100171423 | 250 |
| 174 | 3300005331 | Ga0070670_100054918 | Ga0070670_1000549184 | 250 |
| 175 | 3300005339 | Ga0070660_100735677 | Ga0070660_1007356771 | 250 |
| 176 | 3300005345 | Ga0070692_10232717 | Ga0070692_102327171 | 250 |
| 177 | 3300005444 | Ga0070694_100390083 | Ga0070694_1003900831 | 250 |
| 178 | 3300005539 | Ga0068853_100196488 | Ga0068853_1001964883 | 250 |
| 179 | 3300005547 | Ga0070693_100208562 | Ga0070693_1002085622 | 250 |
| 180 | 3300005547 | Ga0070693_100242197 | Ga0070693_1002421972 | 250 |
| 181 | 3300005549 | Ga0070704_100021850 | Ga0070704_1000218502 | 250 |
| 182 | 3300005617 | Ga0068859_100047313 | Ga0068859_1000473135 | 250 |
| 183 | 3300005617 | Ga0068859_100092704 | Ga0068859_1000927042 | 250 |
| 184 | 3300005841 | Ga0068863_100390099 | Ga0068863_1003900992 | 250 |
| 185 | 3300005842 | Ga0068858_100108248 | Ga0068858_1001082483 | 250 |
| 186 | 3300006931 | Ga0097620_100047313 | Ga0097620_1000473132 | 250 |
| 187 | 3300006931 | Ga0097620_100092710 | Ga0097620_1000927103 | 250 |
| 188 | 3300009101 | Ga0105247_10086587 | Ga0105247_100865871 | 250 |
| 189 | 3300009177 | Ga0105248_10091388 | Ga0105248_100913883 | 250 |
| 190 | 3300009177 | Ga0105248_10892880 | Ga0105248_108928802 | 250 |
| 191 | 3300009553 | Ga0105249_10018257 | Ga0105249_100182571 | 250 |
| 192 | 3300025925 | Ga0207650_10037860 | Ga0207650_100378604 | 250 |
| 193 | 3300025961 | Ga0207712_10008719 | Ga0207712_100087192 | 250 |
| 194 | 3300025981 | Ga0207640_10622288 | Ga0207640_106222881 | 250 |
| 195 | 3300026035 | Ga0207703_10103590 | Ga0207703_101035902 | 250 |
| 196 | 3300026041 | Ga0207639_10269224 | Ga0207639_102692243 | 250 |
| 197 | 3300026088 | Ga0207641_10277502 | Ga0207641_102775022 | 250 |
| 198 | 3300028381 | Ga0268264_10529989 | Ga0268264_105299892 | 250 |
| 199 | 3300035207 | Ga0373942_0003437 | Ga0373942_0003437_2355_3107 | 250 |
| 200 | 3300038699 | Ga0242422_02143 | Ga0242422_02143_112_870 | 250 |
| 201 | 3300045051 | Ga0451576_0084913 | Ga0451576_0084913_2303_3061 | 250 |
| 202 | 3300048909 | Ga0496106_0064870 | Ga0496106_0064870_236_988 | 250 |
| 203 | 3300048911 | Ga0496108_0068538 | Ga0496108_0068538_1132_1884 | 250 |
| 204 | 3300048915 | Ga0496112_0491711 | Ga0496112_0491711_271_1023 | 250 |
| 205 | 3300005340 | Ga0070689_100307162 | Ga0070689_1003071622 | 251 |
| 206 | 3300005441 | Ga0070700_100014022 | Ga0070700_1000140222 | 251 |
| 207 | 3300005459 | Ga0068867_100095661 | Ga0068867_1000956612 | 251 |
| 208 | 3300005518 | Ga0070699_100063244 | Ga0070699_1000632443 | 251 |
| 209 | 3300005564 | Ga0070664_100084001 | Ga0070664_1000840012 | 251 |
| 210 | 3300005577 | Ga0068857_100489203 | Ga0068857_1004892032 | 251 |
| 211 | 3300005615 | Ga0070702_100073202 | Ga0070702_1000732022 | 251 |
| 212 | 3300005617 | Ga0068859_100090911 | Ga0068859_1000909113 | 251 |
| 213 | 3300005618 | Ga0068864_100102133 | Ga0068864_1001021332 | 251 |
| 214 | 3300005618 | Ga0068864_100269689 | Ga0068864_1002696892 | 251 |
| 215 | 3300005618 | Ga0068864_100353807 | Ga0068864_1003538072 | 251 |
| 216 | 3300005719 | Ga0068861_100176754 | Ga0068861_1001767543 | 251 |
| 217 | 3300005841 | Ga0068863_100175861 | Ga0068863_1001758612 | 251 |
| 218 | 3300005842 | Ga0068858_100058286 | Ga0068858_1000582862 | 251 |
| 219 | 3300005843 | Ga0068860_100184604 | Ga0068860_1001846042 | 251 |
| 220 | 3300005843 | Ga0068860_100585333 | Ga0068860_1005853332 | 251 |
| 221 | 3300006237 | Ga0097621_100182894 | Ga0097621_1001828942 | 251 |
| 222 | 3300006931 | Ga0097620_100090910 | Ga0097620_1000909103 | 251 |
| 223 | 3300009011 | Ga0105251_10036530 | Ga0105251_100365302 | 251 |
| 224 | 3300009101 | Ga0105247_10053337 | Ga0105247_100533373 | 251 |
| 225 | 3300009174 | Ga0105241_10849485 | Ga0105241_108494851 | 251 |
| 226 | 3300009177 | Ga0105248_10097744 | Ga0105248_100977443 | 251 |
| 227 | 3300009551 | Ga0105238_10003652 | Ga0105238_100036525 | 251 |
| 228 | 3300011119 | Ga0105246_10119306 | Ga0105246_101193062 | 251 |
| 229 | 3300014325 | Ga0163163_10702370 | Ga0163163_107023702 | 251 |
| 230 | 3300025900 | Ga0207710_10027307 | Ga0207710_100273073 | 251 |
| 231 | 3300025911 | Ga0207654_10044375 | Ga0207654_100443753 | 251 |
| 232 | 3300025924 | Ga0207694_10009319 | Ga0207694_100093197 | 251 |
| 233 | 3300025933 | Ga0207706_10059734 | Ga0207706_100597343 | 251 |
| 234 | 3300025935 | Ga0207709_10042557 | Ga0207709_100425572 | 251 |
| 235 | 3300025938 | Ga0207704_10075655 | Ga0207704_100756552 | 251 |
| 236 | 3300025942 | Ga0207689_10127507 | Ga0207689_101275072 | 251 |
| 237 | 3300026075 | Ga0207708_10020464 | Ga0207708_100204642 | 251 |
| 238 | 3300026088 | Ga0207641_10304633 | Ga0207641_103046332 | 251 |
| 239 | 3300026089 | Ga0207648_10289337 | Ga0207648_102893372 | 251 |
| 240 | 3300026095 | Ga0207676_10455178 | Ga0207676_104551781 | 251 |
| 241 | 3300026116 | Ga0207674_10106999 | Ga0207674_101069992 | 251 |
| 242 | 3300026118 | Ga0207675_100042164 | Ga0207675_1000421643 | 251 |
| 243 | 3300028381 | Ga0268264_10058124 | Ga0268264_100581243 | 251 |
| 244 | 3300035091 | Ga0373951_0070421 | Ga0373951_0070421_49_807 | 251 |
| 245 | 3300048913 | Ga0496110_0578481 | Ga0496110_0578481_79_834 | 251 |
| 246 | 3300005441 | Ga0070700_100000070 | Ga0070700_10000007037 | 252 |
| 247 | 3300005444 | Ga0070694_100152741 | Ga0070694_1001527411 | 252 |
| 248 | 3300005543 | Ga0070672_100548293 | Ga0070672_1005482931 | 252 |
| 249 | 3300005546 | Ga0070696_100029654 | Ga0070696_1000296544 | 252 |
| 250 | 3300005617 | Ga0068859_100010508 | Ga0068859_1000105086 | 252 |
| 251 | 3300006931 | Ga0097620_100010508 | Ga0097620_1000105086 | 252 |
| 252 | 3300009174 | Ga0105241_10100176 | Ga0105241_101001763 | 252 |
| 253 | 3300009176 | Ga0105242_10598245 | Ga0105242_105982451 | 252 |
| 254 | 3300009177 | Ga0105248_10003370 | Ga0105248_1000337015 | 252 |
| 255 | 3300010375 | Ga0105239_10397698 | Ga0105239_103976982 | 252 |
| 256 | 3300013297 | Ga0157378_10374879 | Ga0157378_103748792 | 252 |
| 257 | 3300025941 | Ga0207711_10009004 | Ga0207711_100090042 | 252 |
| 258 | 3300026075 | Ga0207708_10000453 | Ga0207708_1000045310 | 252 |
| 259 | 3300031731 | Ga0307405_10067911 | Ga0307405_100679113 | 252 |
| 260 | 3300031901 | Ga0307406_10050448 | Ga0307406_100504482 | 252 |
| 261 | 3300032004 | Ga0307414_10073591 | Ga0307414_100735912 | 252 |
| 262 | 3300042005 | Ga0439448_0033848 | Ga0439448_0033848_154_912 | 252 |
| 263 | 3300042157 | Ga0439458_0005074 | Ga0439458_0005074_2050_2808 | 252 |
| 264 | 3300049521 | Ga0501298_006464 | Ga0501298_006464_45_803 | 252 |
| 265 | 3300049649 | Ga0501198_001045 | Ga0501198_001045_1194_1952 | 252 |
| 266 | 3300049653 | Ga0501206_011292 | Ga0501206_011292_249_1007 | 252 |
| 267 | 3300049654 | Ga0501207_003680 | Ga0501207_003680_1242_2000 | 252 |
| 268 | 3300049660 | Ga0501216_000836 | Ga0501216_000836_2146_2904 | 252 |
| 269 | 3300049661 | Ga0501217_007459 | Ga0501217_007459_128_886 | 252 |
| 270 | 3300049664 | Ga0501224_002860 | Ga0501224_002860_503_1261 | 252 |
| 271 | 3300049669 | Ga0501235_005875 | Ga0501235_005875_1248_2006 | 252 |
| 272 | 3300049673 | Ga0501240_001870 | Ga0501240_001870_1314_2072 | 252 |
| 273 | 3300049675 | Ga0501243_002034 | Ga0501243_002034_564_1322 | 252 |
| 274 | 3300049704 | Ga0501221_013561 | Ga0501221_013561_483_1241 | 252 |
| 275 | 3300049705 | Ga0501225_0002080 | Ga0501225_0002080_913_1671 | 252 |
| 276 | 3300049705 | Ga0501225_0043639 | Ga0501225_0043639_141_899 | 252 |
| 277 | 3300049706 | Ga0501229_016606 | Ga0501229_016606_145_903 | 252 |
| 278 | 3300049707 | Ga0501234_003082 | Ga0501234_003082_931_1689 | 252 |
| 279 | 3300049769 | Ga0501272_017880 | Ga0501272_017880_69_827 | 252 |
| 280 | 3300049770 | Ga0501273_006225 | Ga0501273_006225_422_1180 | 252 |
| 281 | 3300049851 | Ga0501212_024030 | Ga0501212_024030_52_810 | 252 |
| 282 | 3300049853 | Ga0501226_000557 | Ga0501226_000557_2226_2984 | 252 |
| 283 | 3300002459 | JGI24751J29686_10000013 | JGI24751J29686_1000001363 | 253 |
| 284 | 3300003203 | JGI25406J46586_10002162 | JGI25406J46586_100021627 | 253 |
| 285 | 3300005290 | Ga0065712_10002668 | Ga0065712_100026685 | 253 |
| 286 | 3300005293 | Ga0065715_10005754 | Ga0065715_100057542 | 253 |
| 287 | 3300005330 | Ga0070690_100031553 | Ga0070690_1000315532 | 253 |
| 288 | 3300005331 | Ga0070670_100000129 | Ga0070670_10000012944 | 253 |
| 289 | 3300005334 | Ga0068869_100305900 | Ga0068869_1003059001 | 253 |
| 290 | 3300005364 | Ga0070673_100216336 | Ga0070673_1002163362 | 253 |
| 291 | 3300005366 | Ga0070659_100342418 | Ga0070659_1003424182 | 253 |
| 292 | 3300005577 | Ga0068857_100203115 | Ga0068857_1002031152 | 253 |
| 293 | 3300005578 | Ga0068854_100226107 | Ga0068854_1002261073 | 253 |
| 294 | 3300005985 | Ga0081539_10000783 | Ga0081539_1000078315 | 253 |
| 295 | 3300009101 | Ga0105247_10048317 | Ga0105247_100483173 | 253 |
| 296 | 3300014325 | Ga0163163_10000536 | Ga0163163_1000053621 | 253 |
| 297 | 3300025900 | Ga0207710_10016749 | Ga0207710_100167492 | 253 |
| 298 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001113 | 253 |
| 299 | 3300025936 | Ga0207670_10272106 | Ga0207670_102721062 | 253 |
| 300 | 3300025981 | Ga0207640_10512341 | Ga0207640_105123411 | 253 |
| 301 | 3300026116 | Ga0207674_10193387 | Ga0207674_101933872 | 253 |
| 302 | 3300031548 | Ga0307408_100070438 | Ga0307408_1000704383 | 253 |
| 303 | 3300031901 | Ga0307406_10162251 | Ga0307406_101622513 | 253 |
| 304 | 3300032126 | Ga0307415_100044648 | Ga0307415_1000446482 | 253 |
| 305 | 3300049653 | Ga0501206_005472 | Ga0501206_005472_11_772 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6pjp-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.7899 | 18 | 240 |
| 6pj8-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.7783 | 13 | 240 |
| 6pj5-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.7745 | 11 | 240 |
| 6pjp-assembly1.cif.gz_A | time-resolved structural snapshot of proteolysis by glpg inside the membrane | 0.7566 | 18 | 240 |
| 2irv-assembly1.cif.gz_A | crystal structure of glpg, a rhomboid intramembrane serine protease | 0.7562 | 18 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JZG9_137_329_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8386 | 18 | 238 | 1.20.1540.10 |
| af_F1R9M8_118_305_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8251 | 17 | 240 | 1.20.1540.10 |
| af_O53632_31_206_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8199 | 12 | 242 | 1.20.1540.10 |
| af_I1JZG9_137_329_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8187 | 18 | 238 | 1.20.1540.10 |
| af_B4FAA8_33_228_1.20.1540.10 | Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like | 0.8136 | 13 | 245 | 1.20.1540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1L2L7-F1-model_v4 | Rhomboid family intramembrane serine protease | 0.9754 | 3 | 140 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A7X8CVX7-F1-model_v4 | Rhomboid family intramembrane serine protease | 0.9443 | 3 | 241 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A7W1L2L7-F1-model_v4 | Rhomboid family intramembrane serine protease | 0.9419 | 3 | 140 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A7X9Q4R5-F1-model_v4 | Rhomboid family intramembrane serine protease | 0.9342 | 18 | 242 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A1A9I1U6-F1-model_v4 | Rhomboid family intramembrane serine protease | 0.9332 | 3 | 244 |
GO:0004252
GO:0006508 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar