F398231

General Info

Members Datasets Scaffolds Average Seq Length
305 189 610 266

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0044898|Ga0439436_0044898_82_981
Length 299
Sequence VTDKVDGMGSHKDSENPKATLPTPVTPAGRDALDAILADPGRTVIALDFDGTLAPIVPDPEQARAHPDAVPALAALAPRVLSVAVVTGRPAAVAVRHGGFAGVPGLEHLTVLGHYGAERWDAATDSVTAPPPHPGVTAVRAELPAVLDEAGAGEGTWIEEKGRAVAVHTRRAADPQATFEALRAPLTDLATRHGLIVEPGRMVLELRPPGMDKGVALRRHVVDSAATAVLYAGDDLGDLPAFAAVEKLRGEGVPGLLVCSGSTEVTELSERADLVVDGPEGVVRLLARIADGVGAGGAQ

Samples

Sample ID Description Type Environment
1 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
9 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
10 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
15 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
21 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
22 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
23 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
24 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
25 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
26 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
27 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
28 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
29 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
30 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
31 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
32 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
33 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
34 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
35 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
36 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
37 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
38 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
39 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
40 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
41 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
42 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
43 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
44 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
45 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
46 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
47 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
50 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
59 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
60 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
64 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
65 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
66 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
67 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
68 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
77 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
78 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
85 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
86 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
116 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
154 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
155 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
157 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
160 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
161 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
164 2643221548 Streptomyces sp. Root55 Isolate Unclassified
165 2643221578 Streptomyces sp. Root63 Isolate Unclassified
166 2643221670 Streptomyces sp. Root431 Isolate Unclassified
167 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
168 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
169 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
170 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
171 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
172 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
173 2862574272 Streptomyces sp. AcE210 Isolate Nodule
174 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
175 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
176 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
177 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
178 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
179 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
180 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
181 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
182 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
183 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
184 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
185 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
186 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
187 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
188 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
189 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.84
Metatranscriptomes 0
Isolates 10.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0.33
Rhizoplane 0.98
Rhizosphere 84.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439436_0044898 3300041404 Bacteria 1258
2 rootH1_10004602 3300003316 Bacteria 2669
3 Ga0070670_100202679 3300005331 Bacteria 1724
4 Ga0070685_10068383 3300005466 Bacteria 2098
5 Ga0075368_10009506 3300006042 Bacteria 3496
6 Ga0075367_10000717 3300006178 Bacteria 12816
7 Ga0105251_10020121 3300009011 Bacteria 3512
8 Ga0105250_10105997 3300009092 Bacteria 1149
9 Ga0105245_10139815 3300009098 Bacteria 2279
10 Ga0105243_10141612 3300009148 Bacteria 2052
11 Ga0105246_10004452 3300011119 Bacteria 8528
12 Ga0157369_10527614 3300013105 Bacteria 1221
13 Ga0157372_10266780 3300013307 Bacteria 1988
14 Ga0157375_10433427 3300013308 Bacteria 1480
15 Ga0207713_1041509 3300025735 Bacteria 1918
16 Ga0207687_10117410 3300025927 Bacteria 1984
17 Ga0207691_10365866 3300025940 Bacteria 1232
18 Ga0207711_10166296 3300025941 Bacteria 1999
19 Ga0268266_10363217 3300028379 Bacteria 1363
20 Ga0307517_10003190 3300028786 Bacteria 25757
21 Ga0307515_10005593 3300028794 Bacteria 25395
22 Ga0307511_10000262 3300030521 Bacteria 54437
23 Ga0307512_10004180 3300030522 Bacteria 16012
24 Ga0307513_10034392 3300031456 Bacteria 5689
25 Ga0307513_10191814 3300031456 Bacteria 1894
26 Ga0307509_10012491 3300031507 Bacteria 10156
27 Ga0307509_10024253 3300031507 Bacteria 6795
28 Ga0307508_10205327 3300031616 Bacteria 1571
29 Ga0307508_10383583 3300031616 Bacteria 996
30 Ga0307514_10078863 3300031649 Bacteria 2443
31 Ga0307514_10124352 3300031649 Bacteria 1791
32 Ga0307514_10130102 3300031649 Bacteria 1735
33 Ga0307516_10058324 3300031730 Bacteria 3758
34 Ga0307518_10030136 3300031838 Bacteria 3928
35 Ga0307518_10127169 3300031838 Bacteria 1796
36 Ga0307507_10014045 3300033179 Bacteria 9615
37 Ga0307507_10020957 3300033179 Bacteria 7298
38 Ga0307510_10039340 3300033180 Bacteria 5211
39 Ga0307510_10127913 3300033180 Bacteria 2223
40 Ga0307510_10131198 3300033180 Bacteria 2178
41 Ga0395898_0207312 3300037466 Bacteria 1870
42 Ga0395898_0235252 3300037466 Bacteria 1747
43 Ga0395901_0031387 3300038443 Bacteria 5479
44 Ga0439439_0005178 3300041406 Bacteria 2969
45 Ga0451841_0695266 3300041498 Bacteria 921
46 Ga0439433_0037875 3300041999 Bacteria 1117
47 Ga0439449_0001748 3300042007 Bacteria 8547
48 Ga0439449_0015159 3300042007 Bacteria 2896
49 Ga0439457_020987 3300042014 Bacteria 1448
50 Ga0450894_000035 3300042131 Bacteria 19542
51 Ga0450896_003833 3300042133 Bacteria 2018
52 Ga0450898_000115 3300042134 Bacteria 7600
53 Ga0450899_000155 3300042135 Bacteria 6593
54 Ga0450900_008129 3300042136 Bacteria 1305
55 Ga0450906_001157 3300042145 Bacteria 5825
56 Ga0450908_006704 3300042184 Bacteria 2179
57 Ga0466969_0005328 3300044656 Bacteria 6841
58 Ga0466969_0007813 3300044656 Bacteria 5687
59 Ga0466972_0004844 3300044658 Bacteria 6752
60 Ga0466972_0041625 3300044658 Bacteria 2236
61 Ga0466965_0000512 3300044683 Bacteria 13809
62 Ga0466965_0005568 3300044683 Bacteria 5682
63 Ga0466966_0006270 3300044684 Bacteria 7866
64 Ga0466966_0021560 3300044684 Bacteria 4230
65 Ga0466966_0045560 3300044684 Bacteria 2803
66 Ga0466961_0003886 3300044693 Bacteria 9335
67 Ga0466961_0155176 3300044693 Bacteria 1428
68 Ga0466963_0000687 3300044694 Bacteria 16444
69 Ga0466963_0001071 3300044694 Bacteria 14271
70 Ga0466963_0026346 3300044694 Bacteria 3718
71 Ga0466964_0008148 3300044706 Bacteria 3933
72 Ga0466971_0000608 3300044719 Bacteria 14248
73 Ga0466968_0010952 3300044735 Bacteria 3525
74 Ga0466970_0002624 3300044765 Bacteria 8668
75 Ga0466957_0005491 3300044842 Bacteria 7115
76 Ga0466959_0002551 3300045049 Bacteria 11686
77 Ga0466958_0001076 3300045836 Bacteria 12546
78 Ga0466967_0007993 3300045976 Bacteria 7701
79 Ga0466967_0009089 3300045976 Bacteria 7348
80 Ga0466967_0011149 3300045976 Bacteria 6791
81 Ga0466967_0089682 3300045976 Bacteria 2792
82 Ga0495617_031076 3300046452 Bacteria 1794
83 Ga0495592_0006582 3300046454 Bacteria 8656
84 Ga0495592_0015328 3300046454 Bacteria 5816
85 Ga0495592_0042026 3300046454 Bacteria 3424
86 Ga0495603_0003315 3300046455 Bacteria 9584
87 Ga0495603_0009629 3300046455 Bacteria 5840
88 Ga0495603_0015705 3300046455 Bacteria 4580
89 Ga0495603_0023701 3300046455 Bacteria 3712
90 Ga0495603_0037317 3300046455 Bacteria 2915
91 Ga0495590_0018236 3300046457 Bacteria 2514
92 Ga0495629_0000848 3300046459 Bacteria 24687
93 Ga0495629_0012499 3300046459 Bacteria 6149
94 Ga0495629_0017448 3300046459 Bacteria 5143
95 Ga0495629_0026299 3300046459 Bacteria 4135
96 Ga0495629_0026348 3300046459 Bacteria 4130
97 Ga0495629_0295915 3300046459 Bacteria 1109
98 Ga0495638_0016557 3300046460 Bacteria 4935
99 Ga0495638_0105997 3300046460 Bacteria 1675
100 Ga0495651_0001723 3300046462 Bacteria 16877
101 Ga0495651_0003025 3300046462 Bacteria 12973
102 Ga0495580_0025351 3300046472 Bacteria 4334
103 Ga0495582_0197702 3300046473 Bacteria 1148
104 Ga0495662_0002144 3300046476 Bacteria 9906
105 Ga0495662_0010539 3300046476 Bacteria 4522
106 Ga0495662_0034049 3300046476 Bacteria 2460
107 Ga0495664_0009009 3300046477 Bacteria 5578
108 Ga0495664_0014332 3300046477 Bacteria 4492
109 Ga0495585_0146109 3300046492 Bacteria 1235
110 Ga0495594_0000685 3300046499 Bacteria 17457
111 Ga0495594_0011728 3300046499 Bacteria 4555
112 Ga0495594_0055335 3300046499 Bacteria 2187
113 Ga0495596_0045312 3300046500 Bacteria 1729
114 Ga0495607_0035889 3300046501 Bacteria 2994
115 Ga0495606_0046127 3300046507 Bacteria 2882
116 Ga0495608_0045384 3300046511 Bacteria 2928
117 Ga0495610_0021231 3300046512 Bacteria 3576
118 Ga0495616_0007630 3300046513 Bacteria 6473
119 Ga0495618_0033349 3300046514 Bacteria 3228
120 Ga0495618_0054759 3300046514 Bacteria 2525
121 Ga0495618_0056909 3300046514 Bacteria 2476
122 Ga0495620_0005316 3300046515 Bacteria 7203
123 Ga0495620_0042229 3300046515 Bacteria 1993
124 Ga0495628_0001215 3300046516 Bacteria 23569
125 Ga0495630_0005594 3300046517 Bacteria 8875
126 Ga0495630_0027673 3300046517 Bacteria 4208
127 Ga0495630_0543272 3300046517 Bacteria 891
128 Ga0495631_0002692 3300046518 Bacteria 9871
129 Ga0495643_0011742 3300046522 Bacteria 5314
130 Ga0495648_0024766 3300046524 Bacteria 4076
131 Ga0495666_0017558 3300046526 Bacteria 3563
132 Ga0495642_0094364 3300046528 Bacteria 1269
133 Ga0495665_0015740 3300046531 Bacteria 4072
134 Ga0495640_0018110 3300046533 Bacteria 5233
135 Ga0495640_0019728 3300046533 Bacteria 4972
136 Ga0495640_0031550 3300046533 Bacteria 3780
137 Ga0495586_0063275 3300046535 Bacteria 2015
138 Ga0495586_0093547 3300046535 Bacteria 1662
139 Ga0495587_0003891 3300046536 Bacteria 9905
140 Ga0495587_0101727 3300046536 Bacteria 1655
141 Ga0495609_0022335 3300046538 Bacteria 2914
142 Ga0495645_0091575 3300046543 Bacteria 2172
143 Ga0495645_0208889 3300046543 Bacteria 1319
144 Ga0495622_0004732 3300046557 Bacteria 6301
145 Ga0495622_0051129 3300046557 Bacteria 1917
146 Ga0495622_0068066 3300046557 Bacteria 1645
147 Ga0495633_0039196 3300046558 Bacteria 2261
148 Ga0495668_0022476 3300046616 Bacteria 3604
149 Ga0495668_0076994 3300046616 Bacteria 1831
150 Ga0495668_0135883 3300046616 Bacteria 1346
151 Ga0495634_0001585 3300046642 Bacteria 19972
152 Ga0495634_0029395 3300046642 Bacteria 3804
153 Ga0495611_0043344 3300046648 Bacteria 2011
154 Ga0495625_0045784 3300046660 Bacteria 3160
155 Ga0495635_0026953 3300046663 Bacteria 3997
156 Ga0495635_0068053 3300046663 Bacteria 2442
157 Ga0495661_0045759 3300046665 Bacteria 2674
158 Ga0495588_0002099 3300046674 Bacteria 8549
159 Ga0495588_0027583 3300046674 Bacteria 2838
160 Ga0495588_0043578 3300046674 Bacteria 2296
161 Ga0495657_0031010 3300046675 Bacteria 3739
162 Ga0495657_0031794 3300046675 Bacteria 3686
163 Ga0495657_0033150 3300046675 Bacteria 3598
164 Ga0495657_0117476 3300046675 Bacteria 1678
165 Ga0495599_0276619 3300046678 Bacteria 1017
166 Ga0495623_0003796 3300046679 Bacteria 9951
167 Ga0495623_0239502 3300046679 Bacteria 1025
168 Ga0495646_0000882 3300046680 Bacteria 17025
169 Ga0495646_0043280 3300046680 Bacteria 2758
170 Ga0495658_0022205 3300046683 Bacteria 3353
171 Ga0495613_0002932 3300046689 Bacteria 12776
172 Ga0495613_0023052 3300046689 Bacteria 4639
173 Ga0495613_0027324 3300046689 Bacteria 4246
174 Ga0495613_0051775 3300046689 Bacteria 3025
175 Ga0495613_0055425 3300046689 Bacteria 2912
176 Ga0495613_0113648 3300046689 Bacteria 1949
177 Ga0495613_0122473 3300046689 Bacteria 1867
178 Ga0495624_0172228 3300046690 Bacteria 1320
179 Ga0495670_0091887 3300046691 Bacteria 1554
180 Ga0495671_0001574 3300046692 Bacteria 15105
181 Ga0495649_0016369 3300046694 Bacteria 4201
182 Ga0495649_0078987 3300046694 Bacteria 1760
183 Ga0495589_0017375 3300046794 Bacteria 3692
184 Ga0495589_0018544 3300046794 Bacteria 3567
185 Ga0495589_0032267 3300046794 Bacteria 2633
186 Ga0495589_0043692 3300046794 Bacteria 2229
187 Ga0495589_0052866 3300046794 Bacteria 2006
188 Ga0495600_0012553 3300046809 Bacteria 5300
189 Ga0495600_0263420 3300046809 Bacteria 1094
190 Ga0495660_0023334 3300046810 Bacteria 3528
191 Ga0495660_0041654 3300046810 Bacteria 2540
192 Ga0495581_0003314 3300047315 Bacteria 9251
193 Ga0495581_0027583 3300047315 Bacteria 3293
194 Ga0495604_0002884 3300047317 Bacteria 13771
195 Ga0495604_0010057 3300047317 Bacteria 7488
196 Ga0495604_0063618 3300047317 Bacteria 2814
197 Ga0495604_0075563 3300047317 Bacteria 2536
198 Ga0495636_0001927 3300047318 Bacteria 7940
199 Ga0495636_0045027 3300047318 Bacteria 1838
200 Ga0495636_0048940 3300047318 Bacteria 1767
201 Ga0495674_0026242 3300047319 Bacteria 5333
202 Ga0495674_0041362 3300047319 Bacteria 4117
203 Ga0495674_0124382 3300047319 Bacteria 2177
204 Ga0495676_0004818 3300047321 Bacteria 12369
205 Ga0495676_0010189 3300047321 Bacteria 8536
206 Ga0495676_0031877 3300047321 Bacteria 4452
207 Ga0495676_0036120 3300047321 Bacteria 4128
208 Ga0495676_0045469 3300047321 Bacteria 3572
209 Ga0495680_0006200 3300047322 Bacteria 11145
210 Ga0495683_0068806 3300047323 Bacteria 1740
211 Ga0495683_0143937 3300047323 Bacteria 1115
212 Ga0495687_001373 3300047443 Bacteria 22509
213 Ga0495687_010834 3300047443 Bacteria 4956
214 Ga0495687_042826 3300047443 Bacteria 1975
215 Ga0495687_057419 3300047443 Bacteria 1618
216 Ga0495675_0017712 3300047444 Bacteria 4516
217 Ga0495675_0035547 3300047444 Bacteria 3181
218 Ga0495675_0046664 3300047444 Bacteria 2757
219 Ga0495675_0059802 3300047444 Bacteria 2416
220 Ga0495685_010442 3300047447 Bacteria 3114
221 Ga0495685_015956 3300047447 Bacteria 2565
222 Ga0495685_020469 3300047447 Bacteria 2273
223 Ga0495685_026308 3300047447 Bacteria 2001
224 Ga0495685_030959 3300047447 Bacteria 1839
225 Ga0495685_068968 3300047447 Bacteria 1186
226 Ga0495681_0000410 3300047470 Bacteria 33110
227 Ga0495681_0034288 3300047470 Bacteria 2530
228 Ga0495686_0009221 3300047472 Bacteria 7141
229 Ga0495686_0017745 3300047472 Bacteria 4790
230 Ga0495593_0012766 3300047673 Bacteria 4796
231 Ga0495593_0022264 3300047673 Bacteria 3534
232 Ga0495593_0040807 3300047673 Bacteria 2497
233 Ga0495602_0052872 3300048088 Bacteria 3603
234 Ga0495614_0006975 3300048089 Bacteria 5045
235 Ga0495614_0024370 3300048089 Bacteria 2612
236 Ga0495614_0037015 3300048089 Bacteria 2094
237 Ga0495626_0017616 3300048091 Bacteria 3603
238 Ga0496108_1011933 3300048911 Bacteria 709
239 Ga0496109_0014763 3300048912 Bacteria 6796
240 Ga0496110_0612309 3300048913 Bacteria 987
241 Ga0495678_025617 3300049459 Bacteria 2530
242 Ga0501031_0223964 3300049568 Bacteria 1224
243 Ga0501034_0035602 3300049571 Bacteria 5046
244 Ga0501034_0108556 3300049571 Bacteria 2766
245 Ga0501034_0433185 3300049571 Bacteria 1234
246 Ga0501037_0021348 3300049573 Bacteria 4783
247 Ga0501037_0324526 3300049573 Bacteria 1065
248 Ga0501038_0006943 3300049574 Bacteria 10451
249 Ga0501038_0123995 3300049574 Bacteria 2128
250 Ga0501039_0315678 3300049575 Bacteria 1229
251 Ga0501043_0021713 3300049579 Bacteria 5032
252 Ga0501046_0030673 3300049580 Bacteria 4362
253 Ga0501047_0000072 3300049581 Bacteria 126542
254 Ga0501047_0028173 3300049581 Bacteria 5413
255 Ga0501048_0044741 3300049582 Bacteria 3163
256 Ga0501048_0149670 3300049582 Bacteria 1651
257 Ga0501073_0422404 3300049589 Bacteria 921
258 Ga0501282_002487 3300049778 Bacteria 1999
259 Ga0501035_0033450 3300049822 Bacteria 4676
260 Ga0501035_0273025 3300049822 Bacteria 1430
261 Ga0501044_0015774 3300049823 Bacteria 8134
262 Ga0501044_0016313 3300049823 Bacteria 7979
263 Ga0501044_0030359 3300049823 Bacteria 5697
264 Ga0501044_0119645 3300049823 Bacteria 2635
265 nmdc:mga06z11_629_c1 3300050494 Bacteria 12831
266 Ga0495601_0072830 3300053077 Bacteria 2195
267 Ga0495612_0033984 3300053078 Bacteria 2064
268 Ga0495619_0023734 3300053085 Bacteria 3932
269 Ga0500560_001166 3300053107 Bacteria 4352
270 Ga0500572_002306 3300053111 Bacteria 4619
271 Ga0500614_015478 3300053123 Bacteria 1701
272 Ga0500573_0052612 3300053140 Bacteria 2341
273 Ga0500624_001243 3300053157 Bacteria 4505
274 Ga0466962_0002060 3300061719 Bacteria 9516
275 2554257755 2554235005 Bacteria 6457341
276 2585299229 2582581312 Bacteria 7308206
277 2585313569 2582581314 Bacteria 11452267
278 2616694997 2616644814 Bacteria 11555299
279 2616904555 2616644941 Bacteria 8510691
280 2643765035 2643221548 Bacteria 8053412
281 2643900759 2643221578 Bacteria 9213798
282 2644389991 2643221670 Bacteria 6497041
283 2644405020 2643221673 Bacteria 9196637
284 2644461126 2643221682 Bacteria 6743283
285 2785343201 2784746763 Bacteria 9783172
286 2811849132 2808606982 Bacteria 7791042
287 2862179392 2862178590 Bacteria 8583590
288 2862294820 2862290372 Bacteria 7471434
289 2862579173 2862574272 Bacteria 10567477
290 2863404512 2863404153 Bacteria 9672205
291 2873155650 2873151551 Bacteria 8625867
292 2875395633 2875391855 Bacteria 7600475
293 2912724279 2912723979 Bacteria 8557534
294 2935393335 2935390628 Bacteria 7043367
295 2946049005 2946045630 Bacteria 8527308
296 2954007291 2954002825 Bacteria 9173742
297 2990063174 2990059506 Bacteria 9321252
298 2997600348 2997600082 Bacteria 9896405
299 3006399686 3006393351 Bacteria 6615579
300 3006500833 3006493962 Bacteria 8825450
301 8008578815 8008574985 Bacteria 7815457
302 8048412661 8048406513 Bacteria 8936924
303 8056449176 8056447290 Bacteria 7680491
304 8056671195 8056667051 Bacteria 6953971
305 8056833543 8056829672 Bacteria 9045328
306 Ga0439436_0044898
307 rootH1_10004602
308 Ga0070670_100202679
309 Ga0070685_10068383
310 Ga0075368_10009506
311 Ga0075367_10000717
312 Ga0105251_10020121
313 Ga0105250_10105997
314 Ga0105245_10139815
315 Ga0105243_10141612
316 Ga0105246_10004452
317 Ga0157369_10527614
318 Ga0157372_10266780
319 Ga0157375_10433427
320 Ga0207713_1041509
321 Ga0207687_10117410
322 Ga0207691_10365866
323 Ga0207711_10166296
324 Ga0268266_10363217
325 Ga0307517_10003190
326 Ga0307515_10005593
327 Ga0307511_10000262
328 Ga0307512_10004180
329 Ga0307513_10034392
330 Ga0307513_10191814
331 Ga0307509_10012491
332 Ga0307509_10024253
333 Ga0307508_10205327
334 Ga0307508_10383583
335 Ga0307514_10078863
336 Ga0307514_10124352
337 Ga0307514_10130102
338 Ga0307516_10058324
339 Ga0307518_10030136
340 Ga0307518_10127169
341 Ga0307507_10014045
342 Ga0307507_10020957
343 Ga0307510_10039340
344 Ga0307510_10127913
345 Ga0307510_10131198
346 Ga0395898_0207312
347 Ga0395898_0235252
348 Ga0395901_0031387
349 Ga0439439_0005178
350 Ga0451841_0695266
351 Ga0439433_0037875
352 Ga0439449_0001748
353 Ga0439449_0015159
354 Ga0439457_020987
355 Ga0450894_000035
356 Ga0450896_003833
357 Ga0450898_000115
358 Ga0450899_000155
359 Ga0450900_008129
360 Ga0450906_001157
361 Ga0450908_006704
362 Ga0466969_0005328
363 Ga0466969_0007813
364 Ga0466972_0004844
365 Ga0466972_0041625
366 Ga0466965_0000512
367 Ga0466965_0005568
368 Ga0466966_0006270
369 Ga0466966_0021560
370 Ga0466966_0045560
371 Ga0466961_0003886
372 Ga0466961_0155176
373 Ga0466963_0000687
374 Ga0466963_0001071
375 Ga0466963_0026346
376 Ga0466964_0008148
377 Ga0466971_0000608
378 Ga0466968_0010952
379 Ga0466970_0002624
380 Ga0466957_0005491
381 Ga0466959_0002551
382 Ga0466958_0001076
383 Ga0466967_0007993
384 Ga0466967_0009089
385 Ga0466967_0011149
386 Ga0466967_0089682
387 Ga0495617_031076
388 Ga0495592_0006582
389 Ga0495592_0015328
390 Ga0495592_0042026
391 Ga0495603_0003315
392 Ga0495603_0009629
393 Ga0495603_0015705
394 Ga0495603_0023701
395 Ga0495603_0037317
396 Ga0495590_0018236
397 Ga0495629_0000848
398 Ga0495629_0012499
399 Ga0495629_0017448
400 Ga0495629_0026299
401 Ga0495629_0026348
402 Ga0495629_0295915
403 Ga0495638_0016557
404 Ga0495638_0105997
405 Ga0495651_0001723
406 Ga0495651_0003025
407 Ga0495580_0025351
408 Ga0495582_0197702
409 Ga0495662_0002144
410 Ga0495662_0010539
411 Ga0495662_0034049
412 Ga0495664_0009009
413 Ga0495664_0014332
414 Ga0495585_0146109
415 Ga0495594_0000685
416 Ga0495594_0011728
417 Ga0495594_0055335
418 Ga0495596_0045312
419 Ga0495607_0035889
420 Ga0495606_0046127
421 Ga0495608_0045384
422 Ga0495610_0021231
423 Ga0495616_0007630
424 Ga0495618_0033349
425 Ga0495618_0054759
426 Ga0495618_0056909
427 Ga0495620_0005316
428 Ga0495620_0042229
429 Ga0495628_0001215
430 Ga0495630_0005594
431 Ga0495630_0027673
432 Ga0495630_0543272
433 Ga0495631_0002692
434 Ga0495643_0011742
435 Ga0495648_0024766
436 Ga0495666_0017558
437 Ga0495642_0094364
438 Ga0495665_0015740
439 Ga0495640_0018110
440 Ga0495640_0019728
441 Ga0495640_0031550
442 Ga0495586_0063275
443 Ga0495586_0093547
444 Ga0495587_0003891
445 Ga0495587_0101727
446 Ga0495609_0022335
447 Ga0495645_0091575
448 Ga0495645_0208889
449 Ga0495622_0004732
450 Ga0495622_0051129
451 Ga0495622_0068066
452 Ga0495633_0039196
453 Ga0495668_0022476
454 Ga0495668_0076994
455 Ga0495668_0135883
456 Ga0495634_0001585
457 Ga0495634_0029395
458 Ga0495611_0043344
459 Ga0495625_0045784
460 Ga0495635_0026953
461 Ga0495635_0068053
462 Ga0495661_0045759
463 Ga0495588_0002099
464 Ga0495588_0027583
465 Ga0495588_0043578
466 Ga0495657_0031010
467 Ga0495657_0031794
468 Ga0495657_0033150
469 Ga0495657_0117476
470 Ga0495599_0276619
471 Ga0495623_0003796
472 Ga0495623_0239502
473 Ga0495646_0000882
474 Ga0495646_0043280
475 Ga0495658_0022205
476 Ga0495613_0002932
477 Ga0495613_0023052
478 Ga0495613_0027324
479 Ga0495613_0051775
480 Ga0495613_0055425
481 Ga0495613_0113648
482 Ga0495613_0122473
483 Ga0495624_0172228
484 Ga0495670_0091887
485 Ga0495671_0001574
486 Ga0495649_0016369
487 Ga0495649_0078987
488 Ga0495589_0017375
489 Ga0495589_0018544
490 Ga0495589_0032267
491 Ga0495589_0043692
492 Ga0495589_0052866
493 Ga0495600_0012553
494 Ga0495600_0263420
495 Ga0495660_0023334
496 Ga0495660_0041654
497 Ga0495581_0003314
498 Ga0495581_0027583
499 Ga0495604_0002884
500 Ga0495604_0010057
501 Ga0495604_0063618
502 Ga0495604_0075563
503 Ga0495636_0001927
504 Ga0495636_0045027
505 Ga0495636_0048940
506 Ga0495674_0026242
507 Ga0495674_0041362
508 Ga0495674_0124382
509 Ga0495676_0004818
510 Ga0495676_0010189
511 Ga0495676_0031877
512 Ga0495676_0036120
513 Ga0495676_0045469
514 Ga0495680_0006200
515 Ga0495683_0068806
516 Ga0495683_0143937
517 Ga0495687_001373
518 Ga0495687_010834
519 Ga0495687_042826
520 Ga0495687_057419
521 Ga0495675_0017712
522 Ga0495675_0035547
523 Ga0495675_0046664
524 Ga0495675_0059802
525 Ga0495685_010442
526 Ga0495685_015956
527 Ga0495685_020469
528 Ga0495685_026308
529 Ga0495685_030959
530 Ga0495685_068968
531 Ga0495681_0000410
532 Ga0495681_0034288
533 Ga0495686_0009221
534 Ga0495686_0017745
535 Ga0495593_0012766
536 Ga0495593_0022264
537 Ga0495593_0040807
538 Ga0495602_0052872
539 Ga0495614_0006975
540 Ga0495614_0024370
541 Ga0495614_0037015
542 Ga0495626_0017616
543 Ga0496108_1011933
544 Ga0496109_0014763
545 Ga0496110_0612309
546 Ga0495678_025617
547 Ga0501031_0223964
548 Ga0501034_0035602
549 Ga0501034_0108556
550 Ga0501034_0433185
551 Ga0501037_0021348
552 Ga0501037_0324526
553 Ga0501038_0006943
554 Ga0501038_0123995
555 Ga0501039_0315678
556 Ga0501043_0021713
557 Ga0501046_0030673
558 Ga0501047_0000072
559 Ga0501047_0028173
560 Ga0501048_0044741
561 Ga0501048_0149670
562 Ga0501073_0422404
563 Ga0501282_002487
564 Ga0501035_0033450
565 Ga0501035_0273025
566 Ga0501044_0015774
567 Ga0501044_0016313
568 Ga0501044_0030359
569 Ga0501044_0119645
570 nmdc:mga06z11_629_c1
571 Ga0495601_0072830
572 Ga0495612_0033984
573 Ga0495619_0023734
574 Ga0500560_001166
575 Ga0500572_002306
576 Ga0500614_015478
577 Ga0500573_0052612
578 Ga0500624_001243
579 Ga0466962_0002060
580 2554257755
581 2585299229
582 2585313569
583 2616694997
584 2616904555
585 2643765035
586 2643900759
587 2644389991
588 2644405020
589 2644461126
590 2785343201
591 2811849132
592 2862179392
593 2862294820
594 2862579173
595 2863404512
596 2873155650
597 2875395633
598 2912724279
599 2935393335
600 2946049005
601 2954007291
602 2990063174
603 2997600348
604 3006399686
605 3006500833
606 8008578815
607 8048412661
608 8056449176
609 8056671195
610 8056833543

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02358

Trehalose_PPase

Trehalose-phosphatase

46

275

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dxi-assembly1.cif.gz_A structure of c. albicans trehalose-6-phosphate phosphatase c-terminal domain 0.7491 16 259
1u02-assembly1.cif.gz_A crystal structure of trehalose-6-phosphate phosphatase related protein 0.7397 37 259
5dx9-assembly1.cif.gz_A structure of trehalose-6-phosphate phosphatase from cryptococcus neoformans 0.7391 16 258
5dxi-assembly2.cif.gz_B structure of c. albicans trehalose-6-phosphate phosphatase c-terminal domain 0.7293 16 263
5gvx-assembly1.cif.gz_A structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis 0.7194 25 259
ID Description Score Start End Superfamily
af_K7L284_116_213_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.7842 143 227 3.30.160.60
af_A0A0R4J4X4_114_199_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7841 37 79 3.40.50.1000
af_A0A0P0V7I2_92_292_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7216 182 229 3.40.50.1820
af_Q9C9S4_119_361_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7214 37 255 3.40.50.1000
af_I1L5Q2_219_387_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7206 104 258 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A537WIX3-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9329 122 255 GO:0004805
GO:0005992
GO:0046872
AF-A0A6B3EGR0-F1-model_v4 Trehalose-phosphatase 0.9316 106 182 GO:0005992
AF-A0A6I5GYK6-F1-model_v4 Trehalose-phosphatase 0.9278 77 263 GO:0005992
AF-A0A6B2RVJ6-F1-model_v4 Trehalose-phosphatase 0.9274 150 261 GO:0005992
AF-A0A6B1LK94-F1-model_v4 deleted 0.925 12 261

Map