F398222

General Info

Members Datasets Scaffolds Average Seq Length
305 164 610 211

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0275585|Ga0395901_0275585_402_1097
Length 231
Sequence VADRSSDPLALADDAVTDSRVAWALGRRYIGWPTKLAMRPRPFGRDRVPRTGGLVYAINHLHWIDIPVVGQVSPRNIDFVAKVEAMRVPGVGRFLEWHGTIAVRRGESDRVAVRKMLESARAGRVVGLFVEGTRQTTGRPGLAQPGAAMVAIQADVPVVPVAIYGTQFWKPGNFKPSYVVFGEPAWFDELPKGGRGYKQATAEIERRINVLFDWAADVYAGRRPQSEVPPL

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
65 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
66 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
67 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 2.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.48
Rhizosphere 87.87
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0275585 3300038443 Bacteria 1749
2 Ga0070658_10029439 3300005327 Bacteria 4411
3 Ga0070683_100020999 3300005329 Bacteria 5823
4 Ga0070683_100024910 3300005329 Bacteria 5365
5 Ga0070683_100260151 3300005329 Bacteria 1651
6 Ga0070683_100831258 3300005329 Bacteria 886
7 Ga0070680_100004066 3300005336 Bacteria 10953
8 Ga0070680_100187694 3300005336 Bacteria 1742
9 Ga0068868_100450892 3300005338 Unclassified 1119
10 Ga0070660_100028506 3300005339 Bacteria 4178
11 Ga0070660_100048693 3300005339 Bacteria 3255
12 Ga0070660_100145142 3300005339 Bacteria 1906
13 Ga0070661_100248869 3300005344 Bacteria 1371
14 Ga0070661_100340992 3300005344 Bacteria 1174
15 Ga0070671_100053442 3300005355 Bacteria 3358
16 Ga0070659_100060567 3300005366 Bacteria 2990
17 Ga0070714_100511613 3300005435 Bacteria 1146
18 Ga0070708_100032885 3300005445 Bacteria 4502
19 Ga0070678_100088368 3300005456 Bacteria 2369
20 Ga0070681_10014333 3300005458 Bacteria 7888
21 Ga0070681_10109564 3300005458 Bacteria 2701
22 Ga0070681_10231826 3300005458 Bacteria 1761
23 Ga0070681_10427408 3300005458 Bacteria 1237
24 Ga0070706_100328980 3300005467 Bacteria 1425
25 Ga0070699_100622149 3300005518 Bacteria 985
26 Ga0070679_100015413 3300005530 Bacteria 7346
27 Ga0070679_100031376 3300005530 Bacteria 5248
28 Ga0070679_100277008 3300005530 Bacteria 1630
29 Ga0070684_100024738 3300005535 Bacteria 5040
30 Ga0070684_100093432 3300005535 Bacteria 2678
31 Ga0070684_100095342 3300005535 Bacteria 2651
32 Ga0070684_100152834 3300005535 Bacteria 2092
33 Ga0070684_100268674 3300005535 Bacteria 1561
34 Ga0070686_100326919 3300005544 Bacteria 1145
35 Ga0068855_100018756 3300005563 Bacteria 8318
36 Ga0068855_100105823 3300005563 Bacteria 3234
37 Ga0068855_100260336 3300005563 Bacteria 1933
38 Ga0068855_100304737 3300005563 Bacteria 1764
39 Ga0068855_100360477 3300005563 Bacteria 1600
40 Ga0068855_100398326 3300005563 Bacteria 1509
41 Ga0068856_100073595 3300005614 Bacteria 3383
42 Ga0068856_100093898 3300005614 Bacteria 2986
43 Ga0068856_100630009 3300005614 Bacteria 1093
44 Ga0068852_100406172 3300005616 Bacteria 1341
45 Ga0081455_10133295 3300005937 Bacteria 1939
46 Ga0081538_10002388 3300005981 Bacteria 18442
47 Ga0070716_100019756 3300006173 Bacteria 3526
48 Ga0070712_100032929 3300006175 Bacteria 3503
49 Ga0075433_10255549 3300006852 Bacteria 1554
50 Ga0075434_100022927 3300006871 Bacteria 6077
51 Ga0075435_100215657 3300007076 Bacteria 1629
52 Ga0105240_10067615 3300009093 Bacteria 4429
53 Ga0105243_10086664 3300009148 Bacteria 2569
54 Ga0105241_10312121 3300009174 Bacteria 1353
55 Ga0105238_10184291 3300009551 Bacteria 2064
56 Ga0157373_10006332 3300013100 Bacteria 8843
57 Ga0157370_10021230 3300013104 Bacteria 6472
58 Ga0157370_10036346 3300013104 Bacteria 4780
59 Ga0157369_10005974 3300013105 Bacteria 14139
60 Ga0157369_10350416 3300013105 Bacteria 1533
61 Ga0157369_10390444 3300013105 Bacteria 1444
62 Ga0157369_10556449 3300013105 Bacteria 1185
63 Ga0157372_10059227 3300013307 Bacteria 4283
64 Ga0157372_10476691 3300013307 Bacteria 1455
65 Ga0157372_10861669 3300013307 Bacteria 1051
66 Ga0157377_10263659 3300014745 Bacteria 1122
67 Ga0182007_10173070 3300015262 Bacteria 743
68 Ga0197907_10339587 3300020069 Bacteria 1551
69 Ga0206356_10036152 3300020070 Bacteria 2748
70 Ga0206356_10143580 3300020070 Bacteria 1543
71 Ga0206356_10980188 3300020070 Bacteria 1182
72 Ga0206354_10994504 3300020081 Bacteria 3186
73 Ga0206354_11587759 3300020081 Bacteria 2190
74 Ga0206353_10644669 3300020082 Bacteria 6644
75 Ga0206353_11048365 3300020082 Bacteria 2110
76 Ga0207705_10009211 3300025909 Bacteria 7189
77 Ga0207705_10258495 3300025909 Bacteria 1329
78 Ga0207705_10553335 3300025909 Bacteria 894
79 Ga0207684_10212729 3300025910 Bacteria 1668
80 Ga0207707_10018213 3300025912 Bacteria 6121
81 Ga0207707_10027877 3300025912 Bacteria 4938
82 Ga0207707_10139816 3300025912 Bacteria 2117
83 Ga0207707_10267470 3300025912 Bacteria 1482
84 Ga0207693_10009741 3300025915 Bacteria 7823
85 Ga0207693_10021190 3300025915 Bacteria 5166
86 Ga0207663_10041743 3300025916 Bacteria 2798
87 Ga0207660_10069500 3300025917 Bacteria 2558
88 Ga0207657_10001037 3300025919 Bacteria 29400
89 Ga0207657_10015933 3300025919 Bacteria 7262
90 Ga0207657_10053658 3300025919 Bacteria 3491
91 Ga0207657_10089117 3300025919 Bacteria 2578
92 Ga0207657_10440108 3300025919 Bacteria 1023
93 Ga0207649_10057424 3300025920 Bacteria 2433
94 Ga0207652_10036085 3300025921 Bacteria 4178
95 Ga0207652_10038859 3300025921 Bacteria 4036
96 Ga0207694_10112000 3300025924 Bacteria 2171
97 Ga0207694_10602723 3300025924 Bacteria 924
98 Ga0207690_10037965 3300025932 Bacteria 3131
99 Ga0207686_10057154 3300025934 Bacteria 2455
100 Ga0207665_10029700 3300025939 Bacteria 3612
101 Ga0207661_10020904 3300025944 Bacteria 4900
102 Ga0207661_10034994 3300025944 Bacteria 3911
103 Ga0207661_10217067 3300025944 Bacteria 1689
104 Ga0207661_10286678 3300025944 Bacteria 1473
105 Ga0207661_10651788 3300025944 Bacteria 968
106 Ga0207667_10038736 3300025949 Bacteria 5086
107 Ga0207667_10295556 3300025949 Bacteria 1655
108 Ga0207667_10325635 3300025949 Bacteria 1569
109 Ga0207667_10336623 3300025949 Bacteria 1540
110 Ga0207667_10463229 3300025949 Bacteria 1287
111 Ga0207667_10819885 3300025949 Unclassified 926
112 Ga0207677_10513316 3300026023 Unclassified 1038
113 Ga0207639_10296421 3300026041 Bacteria 1428
114 Ga0207702_10600631 3300026078 Bacteria 1080
115 Ga0207702_10796471 3300026078 Bacteria 934
116 Ga0207683_10105590 3300026121 Bacteria 2518
117 Ga0207698_10497835 3300026142 Bacteria 1185
118 Ga0265338_10026332 3300028800 Bacteria 5869
119 Ga0265338_10386322 3300028800 Bacteria 1000
120 Ga0265330_10178912 3300031235 Bacteria 898
121 Ga0265329_10016532 3300031242 Bacteria 2555
122 Ga0265340_10027019 3300031247 Bacteria 2896
123 Ga0265339_10082815 3300031249 Bacteria 1693
124 Ga0265327_10061383 3300031251 Bacteria 1918
125 Ga0265316_10017706 3300031344 Bacteria 6144
126 Ga0265313_10010768 3300031595 Bacteria 5748
127 Ga0265314_10016878 3300031711 Bacteria 5751
128 Ga0265342_10013305 3300031712 Bacteria 5529
129 Ga0307405_10179352 3300031731 Bacteria 1519
130 Ga0307407_10289372 3300031903 Bacteria 1138
131 Ga0307412_10293741 3300031911 Bacteria 1281
132 Ga0307416_100058289 3300032002 Bacteria 3130
133 Ga0373936_0028931 3300035113 Bacteria 2180
134 Ga0373943_0007597 3300035170 Bacteria 4868
135 Ga0373946_0002400 3300035171 Bacteria 6622
136 Ga0373946_0116775 3300035171 Bacteria 1214
137 Ga0373935_0038231 3300035692 Bacteria 3004
138 Ga0373935_0177721 3300035692 Bacteria 1460
139 Ga0373927_0033470 3300035695 Bacteria 3347
140 Ga0373947_0000199 3300035725 Bacteria 33261
141 Ga0373947_0009534 3300035725 Bacteria 5573
142 Ga0373925_0008623 3300037068 Bacteria 7427
143 Ga0373925_0123045 3300037068 Bacteria 2015
144 Ga0395900_0031904 3300037418 Bacteria 5415
145 Ga0395900_0172972 3300037418 Bacteria 2197
146 Ga0395900_1044261 3300037418 Unclassified 736
147 Ga0395898_0001817 3300037466 Bacteria 27561
148 Ga0395898_0004459 3300037466 Bacteria 15301
149 Ga0395898_0007475 3300037466 Bacteria 11603
150 Ga0395898_0171239 3300037466 Bacteria 2076
151 Ga0395905_0043623 3300037471 Bacteria 4207
152 Ga0395905_0215244 3300037471 Bacteria 1799
153 Ga0395905_0717165 3300037471 Bacteria 902
154 Ga0395901_0002378 3300038443 Bacteria 19139
155 Ga0395901_0055051 3300038443 Bacteria 4136
156 Ga0395901_0055642 3300038443 Bacteria 4114
157 Ga0395901_0143687 3300038443 Bacteria 2508
158 Ga0395901_0166596 3300038443 Bacteria 2313
159 Ga0395901_0603830 3300038443 Bacteria 1106
160 Ga0436365_0038275 3300039437 Bacteria 1614
161 Ga0436365_0163110 3300039437 Bacteria 4940
162 Ga0466965_0158828 3300044683 Bacteria 1185
163 Ga0466965_0191009 3300044683 Bacteria 1083
164 Ga0466966_0055797 3300044684 Bacteria 2500
165 Ga0466966_0254777 3300044684 Bacteria 1057
166 Ga0466961_0001531 3300044693 Bacteria 14313
167 Ga0466961_0270789 3300044693 Bacteria 1040
168 Ga0466961_0280201 3300044693 Bacteria 1020
169 Ga0466963_0000807 3300044694 Bacteria 15640
170 Ga0466963_0025805 3300044694 Bacteria 3751
171 Ga0466963_0043184 3300044694 Bacteria 2963
172 Ga0466963_0122541 3300044694 Bacteria 1790
173 Ga0466963_0126923 3300044694 Bacteria 1759
174 Ga0466963_0135561 3300044694 Bacteria 1703
175 Ga0466963_0146957 3300044694 Bacteria 1636
176 Ga0466963_0234553 3300044694 Bacteria 1286
177 Ga0466963_0304279 3300044694 Bacteria 1121
178 Ga0466963_0400099 3300044694 Bacteria 968
179 Ga0466964_0017973 3300044706 Bacteria 2709
180 Ga0466971_0000264 3300044719 Bacteria 20112
181 Ga0466971_0012031 3300044719 Bacteria 3792
182 Ga0466971_0357940 3300044719 Bacteria 707
183 Ga0466968_0042104 3300044735 Bacteria 1930
184 Ga0466970_0268915 3300044765 Bacteria 957
185 Ga0466957_0007400 3300044842 Bacteria 6205
186 Ga0466959_0034079 3300045049 Bacteria 3767
187 Ga0466959_0041084 3300045049 Bacteria 3415
188 Ga0466959_0055296 3300045049 Bacteria 2898
189 Ga0466958_0000900 3300045836 Bacteria 13345
190 Ga0466958_0012102 3300045836 Bacteria 4878
191 Ga0466958_0108110 3300045836 Bacteria 1735
192 Ga0466958_0172242 3300045836 Bacteria 1371
193 Ga0466967_0000073 3300045976 Bacteria 37163
194 Ga0466967_0005966 3300045976 Bacteria 8549
195 Ga0466967_0254214 3300045976 Bacteria 1679
196 Ga0466967_0344510 3300045976 Bacteria 1442
197 Ga0466967_0383199 3300045976 Bacteria 1365
198 Ga0466967_0598942 3300045976 Bacteria 1087
199 Ga0466967_0700173 3300045976 Bacteria 1003
200 Ga0466967_0765027 3300045976 Bacteria 958
201 Ga0495603_0075216 3300046455 Bacteria 1983
202 Ga0495629_0054422 3300046459 Bacteria 2798
203 Ga0495641_0069251 3300046461 Bacteria 1586
204 Ga0495653_0026842 3300046463 Bacteria 4614
205 Ga0495653_0255700 3300046463 Bacteria 1160
206 Ga0495582_0000028 3300046473 Bacteria 79694
207 Ga0495639_0001806 3300046475 Bacteria 9491
208 Ga0495662_0063668 3300046476 Bacteria 1781
209 Ga0495662_0090909 3300046476 Bacteria 1488
210 Ga0495664_0119291 3300046477 Bacteria 1595
211 Ga0495594_0071192 3300046499 Bacteria 1934
212 Ga0495618_0113686 3300046514 Bacteria 1733
213 Ga0495618_0308587 3300046514 Bacteria 982
214 Ga0495628_0041206 3300046516 Bacteria 3687
215 Ga0495628_0347209 3300046516 Bacteria 1091
216 Ga0495630_0067164 3300046517 Bacteria 2695
217 Ga0495630_0221767 3300046517 Bacteria 1443
218 Ga0495652_0165909 3300046529 Bacteria 1709
219 Ga0495652_0240712 3300046529 Bacteria 1346
220 Ga0495665_0000945 3300046531 Bacteria 15313
221 Ga0495640_0037814 3300046533 Bacteria 3400
222 Ga0495640_0112218 3300046533 Bacteria 1780
223 Ga0495645_0499051 3300046543 Bacteria 761
224 Ga0495667_0037864 3300046559 Bacteria 3213
225 Ga0495634_0065345 3300046642 Bacteria 2411
226 Ga0495634_0217233 3300046642 Bacteria 1181
227 Ga0495657_0172895 3300046675 Bacteria 1329
228 Ga0495599_0219028 3300046678 Bacteria 1165
229 Ga0495623_0173000 3300046679 Bacteria 1260
230 Ga0495647_0008346 3300046681 Bacteria 3481
231 Ga0495658_0005214 3300046683 Bacteria 6392
232 Ga0495658_0145569 3300046683 Bacteria 1452
233 Ga0495613_0001574 3300046689 Bacteria 17316
234 Ga0495613_0090960 3300046689 Bacteria 2210
235 Ga0495624_0039667 3300046690 Bacteria 3018
236 Ga0495600_0106529 3300046809 Bacteria 1826
237 Ga0495581_0008832 3300047315 Bacteria 5832
238 Ga0495604_0046251 3300047317 Bacteria 3393
239 Ga0495674_0000901 3300047319 Bacteria 28391
240 Ga0495674_0197834 3300047319 Bacteria 1668
241 Ga0495674_0338772 3300047319 Bacteria 1222
242 Ga0495676_0000952 3300047321 Bacteria 24281
243 Ga0495676_0165592 3300047321 Bacteria 1560
244 Ga0495680_0002334 3300047322 Bacteria 19461
245 Ga0495680_0062250 3300047322 Bacteria 2869
246 Ga0495680_0105067 3300047322 Bacteria 2100
247 Ga0495675_0073471 3300047444 Bacteria 2157
248 Ga0495684_0095591 3300047471 Bacteria 2249
249 Ga0495593_0008759 3300047673 Bacteria 5875
250 Ga0495593_0114724 3300047673 Bacteria 1374
251 Ga0495602_0047048 3300048088 Bacteria 3891
252 Ga0495602_0127412 3300048088 Bacteria 2037
253 Ga0495614_0024667 3300048089 Bacteria 2595
254 Ga0496100_0015408 3300048903 Bacteria 4464
255 Ga0496100_0325235 3300048903 Bacteria 1156
256 Ga0496101_0040376 3300048904 Bacteria 3323
257 Ga0496101_0101688 3300048904 Bacteria 2152
258 Ga0496101_0152368 3300048904 Bacteria 1769
259 Ga0496102_0001032 3300048905 Bacteria 25893
260 Ga0496103_0097546 3300048906 Bacteria 1858
261 Ga0496103_0131124 3300048906 Bacteria 1601
262 Ga0496103_0137958 3300048906 Bacteria 1559
263 Ga0496104_0002708 3300048907 Bacteria 15253
264 Ga0496104_0260773 3300048907 Bacteria 1646
265 Ga0496105_0004504 3300048908 Bacteria 10487
266 Ga0496105_0017327 3300048908 Bacteria 5773
267 Ga0496106_0655652 3300048909 Bacteria 838
268 Ga0496107_0000855 3300048910 Bacteria 17880
269 Ga0496107_0040678 3300048910 Bacteria 3337
270 Ga0496108_0025309 3300048911 Bacteria 4890
271 Ga0496108_0143428 3300048911 Bacteria 2058
272 Ga0496109_0007874 3300048912 Bacteria 9031
273 Ga0496109_0457765 3300048912 Bacteria 1205
274 Ga0496109_0501058 3300048912 Bacteria 1146
275 Ga0496110_0071615 3300048913 Bacteria 3074
276 Ga0496110_0432762 3300048913 Bacteria 1199
277 Ga0496111_0030113 3300048914 Bacteria 3859
278 Ga0496112_0053247 3300048915 Bacteria 3974
279 Ga0496112_0310923 3300048915 Bacteria 1521
280 Ga0496112_0336138 3300048915 Bacteria 1454
281 Ga0496112_0800642 3300048915 Bacteria 867
282 Ga0496113_0464384 3300048916 Bacteria 1017
283 Ga0496114_0000390 3300048917 Bacteria 32469
284 Ga0496114_0035223 3300048917 Bacteria 4133
285 Ga0496114_0494054 3300048917 Bacteria 1083
286 Ga0496115_0001620 3300048918 Bacteria 16194
287 Ga0496115_0025893 3300048918 Bacteria 4571
288 Ga0496115_0299094 3300048918 Bacteria 1319
289 Ga0501067_0015284 3300049583 Bacteria 4248
290 Ga0501069_0088311 3300049585 Bacteria 1752
291 Ga0501070_0223374 3300049586 Bacteria 1544
292 Ga0501074_0033472 3300049590 Bacteria 3724
293 Ga0501080_0082868 3300049742 Bacteria 2979
294 Ga0501080_0156897 3300049742 Bacteria 2102
295 Ga0501044_0178480 3300049823 Bacteria 2092
296 nmdc:mga0n895_24639_c1 3300050512 Bacteria 5673
297 nmdc:mga0rr50_86927_c1 3300050513 Bacteria 2426
298 Ga0495601_0040971 3300053077 Bacteria 2902
299 Ga0495601_0065276 3300053077 Bacteria 2316
300 Ga0495612_0393066 3300053078 Bacteria 629
301 Ga0495595_0006622 3300053084 Bacteria 4729
302 Ga0495619_0058642 3300053085 Bacteria 2556
303 Ga0495619_0103293 3300053085 Bacteria 1941
304 Ga0466962_0003518 3300061719 Bacteria 7465
305 Ga0466962_0035349 3300061719 Bacteria 2392
306 Ga0395901_0275585
307 Ga0070658_10029439
308 Ga0070683_100020999
309 Ga0070683_100024910
310 Ga0070683_100260151
311 Ga0070683_100831258
312 Ga0070680_100004066
313 Ga0070680_100187694
314 Ga0068868_100450892
315 Ga0070660_100028506
316 Ga0070660_100048693
317 Ga0070660_100145142
318 Ga0070661_100248869
319 Ga0070661_100340992
320 Ga0070671_100053442
321 Ga0070659_100060567
322 Ga0070714_100511613
323 Ga0070708_100032885
324 Ga0070678_100088368
325 Ga0070681_10014333
326 Ga0070681_10109564
327 Ga0070681_10231826
328 Ga0070681_10427408
329 Ga0070706_100328980
330 Ga0070699_100622149
331 Ga0070679_100015413
332 Ga0070679_100031376
333 Ga0070679_100277008
334 Ga0070684_100024738
335 Ga0070684_100093432
336 Ga0070684_100095342
337 Ga0070684_100152834
338 Ga0070684_100268674
339 Ga0070686_100326919
340 Ga0068855_100018756
341 Ga0068855_100105823
342 Ga0068855_100260336
343 Ga0068855_100304737
344 Ga0068855_100360477
345 Ga0068855_100398326
346 Ga0068856_100073595
347 Ga0068856_100093898
348 Ga0068856_100630009
349 Ga0068852_100406172
350 Ga0081455_10133295
351 Ga0081538_10002388
352 Ga0070716_100019756
353 Ga0070712_100032929
354 Ga0075433_10255549
355 Ga0075434_100022927
356 Ga0075435_100215657
357 Ga0105240_10067615
358 Ga0105243_10086664
359 Ga0105241_10312121
360 Ga0105238_10184291
361 Ga0157373_10006332
362 Ga0157370_10021230
363 Ga0157370_10036346
364 Ga0157369_10005974
365 Ga0157369_10350416
366 Ga0157369_10390444
367 Ga0157369_10556449
368 Ga0157372_10059227
369 Ga0157372_10476691
370 Ga0157372_10861669
371 Ga0157377_10263659
372 Ga0182007_10173070
373 Ga0197907_10339587
374 Ga0206356_10036152
375 Ga0206356_10143580
376 Ga0206356_10980188
377 Ga0206354_10994504
378 Ga0206354_11587759
379 Ga0206353_10644669
380 Ga0206353_11048365
381 Ga0207705_10009211
382 Ga0207705_10258495
383 Ga0207705_10553335
384 Ga0207684_10212729
385 Ga0207707_10018213
386 Ga0207707_10027877
387 Ga0207707_10139816
388 Ga0207707_10267470
389 Ga0207693_10009741
390 Ga0207693_10021190
391 Ga0207663_10041743
392 Ga0207660_10069500
393 Ga0207657_10001037
394 Ga0207657_10015933
395 Ga0207657_10053658
396 Ga0207657_10089117
397 Ga0207657_10440108
398 Ga0207649_10057424
399 Ga0207652_10036085
400 Ga0207652_10038859
401 Ga0207694_10112000
402 Ga0207694_10602723
403 Ga0207690_10037965
404 Ga0207686_10057154
405 Ga0207665_10029700
406 Ga0207661_10020904
407 Ga0207661_10034994
408 Ga0207661_10217067
409 Ga0207661_10286678
410 Ga0207661_10651788
411 Ga0207667_10038736
412 Ga0207667_10295556
413 Ga0207667_10325635
414 Ga0207667_10336623
415 Ga0207667_10463229
416 Ga0207667_10819885
417 Ga0207677_10513316
418 Ga0207639_10296421
419 Ga0207702_10600631
420 Ga0207702_10796471
421 Ga0207683_10105590
422 Ga0207698_10497835
423 Ga0265338_10026332
424 Ga0265338_10386322
425 Ga0265330_10178912
426 Ga0265329_10016532
427 Ga0265340_10027019
428 Ga0265339_10082815
429 Ga0265327_10061383
430 Ga0265316_10017706
431 Ga0265313_10010768
432 Ga0265314_10016878
433 Ga0265342_10013305
434 Ga0307405_10179352
435 Ga0307407_10289372
436 Ga0307412_10293741
437 Ga0307416_100058289
438 Ga0373936_0028931
439 Ga0373943_0007597
440 Ga0373946_0002400
441 Ga0373946_0116775
442 Ga0373935_0038231
443 Ga0373935_0177721
444 Ga0373927_0033470
445 Ga0373947_0000199
446 Ga0373947_0009534
447 Ga0373925_0008623
448 Ga0373925_0123045
449 Ga0395900_0031904
450 Ga0395900_0172972
451 Ga0395900_1044261
452 Ga0395898_0001817
453 Ga0395898_0004459
454 Ga0395898_0007475
455 Ga0395898_0171239
456 Ga0395905_0043623
457 Ga0395905_0215244
458 Ga0395905_0717165
459 Ga0395901_0002378
460 Ga0395901_0055051
461 Ga0395901_0055642
462 Ga0395901_0143687
463 Ga0395901_0166596
464 Ga0395901_0603830
465 Ga0436365_0038275
466 Ga0436365_0163110
467 Ga0466965_0158828
468 Ga0466965_0191009
469 Ga0466966_0055797
470 Ga0466966_0254777
471 Ga0466961_0001531
472 Ga0466961_0270789
473 Ga0466961_0280201
474 Ga0466963_0000807
475 Ga0466963_0025805
476 Ga0466963_0043184
477 Ga0466963_0122541
478 Ga0466963_0126923
479 Ga0466963_0135561
480 Ga0466963_0146957
481 Ga0466963_0234553
482 Ga0466963_0304279
483 Ga0466963_0400099
484 Ga0466964_0017973
485 Ga0466971_0000264
486 Ga0466971_0012031
487 Ga0466971_0357940
488 Ga0466968_0042104
489 Ga0466970_0268915
490 Ga0466957_0007400
491 Ga0466959_0034079
492 Ga0466959_0041084
493 Ga0466959_0055296
494 Ga0466958_0000900
495 Ga0466958_0012102
496 Ga0466958_0108110
497 Ga0466958_0172242
498 Ga0466967_0000073
499 Ga0466967_0005966
500 Ga0466967_0254214
501 Ga0466967_0344510
502 Ga0466967_0383199
503 Ga0466967_0598942
504 Ga0466967_0700173
505 Ga0466967_0765027
506 Ga0495603_0075216
507 Ga0495629_0054422
508 Ga0495641_0069251
509 Ga0495653_0026842
510 Ga0495653_0255700
511 Ga0495582_0000028
512 Ga0495639_0001806
513 Ga0495662_0063668
514 Ga0495662_0090909
515 Ga0495664_0119291
516 Ga0495594_0071192
517 Ga0495618_0113686
518 Ga0495618_0308587
519 Ga0495628_0041206
520 Ga0495628_0347209
521 Ga0495630_0067164
522 Ga0495630_0221767
523 Ga0495652_0165909
524 Ga0495652_0240712
525 Ga0495665_0000945
526 Ga0495640_0037814
527 Ga0495640_0112218
528 Ga0495645_0499051
529 Ga0495667_0037864
530 Ga0495634_0065345
531 Ga0495634_0217233
532 Ga0495657_0172895
533 Ga0495599_0219028
534 Ga0495623_0173000
535 Ga0495647_0008346
536 Ga0495658_0005214
537 Ga0495658_0145569
538 Ga0495613_0001574
539 Ga0495613_0090960
540 Ga0495624_0039667
541 Ga0495600_0106529
542 Ga0495581_0008832
543 Ga0495604_0046251
544 Ga0495674_0000901
545 Ga0495674_0197834
546 Ga0495674_0338772
547 Ga0495676_0000952
548 Ga0495676_0165592
549 Ga0495680_0002334
550 Ga0495680_0062250
551 Ga0495680_0105067
552 Ga0495675_0073471
553 Ga0495684_0095591
554 Ga0495593_0008759
555 Ga0495593_0114724
556 Ga0495602_0047048
557 Ga0495602_0127412
558 Ga0495614_0024667
559 Ga0496100_0015408
560 Ga0496100_0325235
561 Ga0496101_0040376
562 Ga0496101_0101688
563 Ga0496101_0152368
564 Ga0496102_0001032
565 Ga0496103_0097546
566 Ga0496103_0131124
567 Ga0496103_0137958
568 Ga0496104_0002708
569 Ga0496104_0260773
570 Ga0496105_0004504
571 Ga0496105_0017327
572 Ga0496106_0655652
573 Ga0496107_0000855
574 Ga0496107_0040678
575 Ga0496108_0025309
576 Ga0496108_0143428
577 Ga0496109_0007874
578 Ga0496109_0457765
579 Ga0496109_0501058
580 Ga0496110_0071615
581 Ga0496110_0432762
582 Ga0496111_0030113
583 Ga0496112_0053247
584 Ga0496112_0310923
585 Ga0496112_0336138
586 Ga0496112_0800642
587 Ga0496113_0464384
588 Ga0496114_0000390
589 Ga0496114_0035223
590 Ga0496114_0494054
591 Ga0496115_0001620
592 Ga0496115_0025893
593 Ga0496115_0299094
594 Ga0501067_0015284
595 Ga0501069_0088311
596 Ga0501070_0223374
597 Ga0501074_0033472
598 Ga0501080_0082868
599 Ga0501080_0156897
600 Ga0501044_0178480
601 nmdc:mga0n895_24639_c1
602 nmdc:mga0rr50_86927_c1
603 Ga0495601_0040971
604 Ga0495601_0065276
605 Ga0495612_0393066
606 Ga0495595_0006622
607 Ga0495619_0058642
608 Ga0495619_0103293
609 Ga0466962_0003518
610 Ga0466962_0035349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

41

164

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7266 4 193
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7247 4 212
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.7186 7 211
1iuq-assembly1.cif.gz_A the 1.55 a crystal structure of glycerol-3-phosphate acyltransferase 0.6848 7 211
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6639 4 212
ID Description Score Start End Superfamily
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8857 29 143 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8552 29 147 3.40.50.2000
af_Q8I5S7_22_233_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8526 29 139 3.40.50.2000
af_Q4DRS8_153_366_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8358 29 143 3.40.50.2000
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.833 29 147 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V9P417-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9555 6 215 GO:0003841
GO:0006654
AF-A0A538GUA4-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9432 4 209 GO:0003841
GO:0006654
AF-A0A7V9DJ86-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.94 1 216 GO:0003841
GO:0006654
AF-A0A537TUS9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9388 1 212 GO:0003841
GO:0006654
AF-A0A538EWF9-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9378 4 209 GO:0003841
GO:0006654

Map