F397996

General Info

Members Datasets Scaffolds Average Seq Length
305 178 610 134

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10061638|Ga0070685_100616382
Length 149
Sequence VIGEKALKAILVLIAAYHVVTGLLALVAPDTFFEQIGHYGVENSHYVGDVGAFILAFGIALGIAVVRPAWRAPLLWLGALWYGIHAINHAFDTGEAKSDARGWSDTVLIAFGGVASAWLARVAERLKRAAQETAHPQATSSTRTGGEVG

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
92 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 11.8
Rhizosphere 86.89
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10061638 3300005466 Bacteria 2197
2 JGI24746J21847_1000021 3300001977 Bacteria 15686
3 Ga0070683_100011595 3300005329 Bacteria 7627
4 Ga0070683_100415199 3300005329 Bacteria 1284
5 Ga0070683_100581779 3300005329 Unclassified 1071
6 Ga0070677_10000031 3300005333 Bacteria 41799
7 Ga0070682_100000029 3300005337 Bacteria 183516
8 Ga0070682_100332203 3300005337 Bacteria 1127
9 Ga0068868_100000755 3300005338 Bacteria 21936
10 Ga0070660_101744009 3300005339 Bacteria 530
11 Ga0070689_100018822 3300005340 Bacteria 5097
12 Ga0070692_10389908 3300005345 Bacteria 876
13 Ga0070674_101000562 3300005356 Unclassified 734
14 Ga0070714_100043170 3300005435 Bacteria 3812
15 Ga0070713_100886077 3300005436 Unclassified 858
16 Ga0070701_10589317 3300005438 Bacteria 735
17 Ga0070711_100042630 3300005439 Bacteria 3069
18 Ga0070700_100099601 3300005441 Bacteria 1912
19 Ga0070662_100000085 3300005457 Bacteria 50770
20 Ga0070681_10714283 3300005458 Unclassified 918
21 Ga0070679_100739080 3300005530 Unclassified 927
22 Ga0070684_100004097 3300005535 Bacteria 11032
23 Ga0070684_100378928 3300005535 Bacteria 1303
24 Ga0070684_100554494 3300005535 Bacteria 1067
25 Ga0068853_100003416 3300005539 Bacteria 12149
26 Ga0070695_100466115 3300005545 Unclassified 971
27 Ga0070693_100003712 3300005547 Bacteria 7142
28 Ga0070665_100000120 3300005548 Bacteria 148340
29 Ga0070664_100245240 3300005564 Bacteria 1609
30 Ga0068857_100084639 3300005577 Bacteria 2834
31 Ga0068854_100009329 3300005578 Bacteria 6335
32 Ga0068856_100001591 3300005614 Bacteria 23741
33 Ga0068856_101281886 3300005614 Bacteria 748
34 Ga0068864_100000044 3300005618 Bacteria 157919
35 Ga0068866_10747191 3300005718 Bacteria 675
36 Ga0068861_101983862 3300005719 Bacteria 580
37 Ga0068863_100000080 3300005841 Bacteria 106670
38 Ga0068858_100000035 3300005842 Bacteria 140466
39 Ga0068860_101114018 3300005843 Bacteria 809
40 Ga0075365_10694733 3300006038 Bacteria 719
41 Ga0070716_100301221 3300006173 Bacteria 1115
42 Ga0097621_100940759 3300006237 Bacteria 806
43 Ga0068871_100081315 3300006358 Bacteria 2684
44 Ga0075428_102424227 3300006844 Bacteria 538
45 Ga0075430_101453093 3300006846 Unclassified 563
46 Ga0075431_100312679 3300006847 Bacteria 1585
47 Ga0075433_10000058 3300006852 Bacteria 48106
48 Ga0075433_10499147 3300006852 Bacteria 1071
49 Ga0075434_101241065 3300006871 Bacteria 757
50 Ga0111539_10260005 3300009094 Bacteria 2021
51 Ga0111539_10365842 3300009094 Bacteria 1679
52 Ga0105245_10000053 3300009098 Bacteria 125678
53 Ga0105245_10000859 3300009098 Bacteria 27564
54 Ga0105247_10477458 3300009101 Unclassified 904
55 Ga0114129_10270469 3300009147 Bacteria 2274
56 Ga0114129_10420546 3300009147 Bacteria 1758
57 Ga0105243_13109027 3300009148 Unclassified 503
58 Ga0105248_13240830 3300009177 Unclassified 518
59 Ga0105249_10000095 3300009553 Bacteria 121300
60 Ga0105249_10247091 3300009553 Bacteria 1767
61 Ga0105249_11475078 3300009553 Bacteria 752
62 Ga0105246_11590369 3300011119 Unclassified 617
63 Ga0157374_10002465 3300013296 Bacteria 15626
64 Ga0157372_10828526 3300013307 Bacteria 1074
65 Ga0157372_13020137 3300013307 Bacteria 538
66 Ga0157375_10007931 3300013308 Bacteria 9296
67 Ga0163163_10056003 3300014325 Bacteria 3897
68 Ga0157380_10000080 3300014326 Bacteria 53731
69 Ga0163161_10000364 3300017792 Bacteria 37857
70 Ga0163161_10364406 3300017792 Unclassified 1152
71 Ga0207682_10000067 3300025893 Bacteria 45608
72 Ga0207643_11017797 3300025908 Unclassified 535
73 Ga0207707_10677236 3300025912 Unclassified 868
74 Ga0207663_10073803 3300025916 Bacteria 2209
75 Ga0207652_10000177 3300025921 Bacteria 67555
76 Ga0207687_10000021 3300025927 Bacteria 226396
77 Ga0207687_10000785 3300025927 Bacteria 21381
78 Ga0207700_10717294 3300025928 Unclassified 893
79 Ga0207664_10236061 3300025929 Unclassified 1591
80 Ga0207706_10000338 3300025933 Bacteria 50849
81 Ga0207670_10020190 3300025936 Bacteria 4089
82 Ga0207689_11444911 3300025942 Bacteria 575
83 Ga0207661_10028569 3300025944 Bacteria 4273
84 Ga0207661_10058300 3300025944 Bacteria 3107
85 Ga0207661_10750611 3300025944 Bacteria 898
86 Ga0207679_10324126 3300025945 Bacteria 1335
87 Ga0207712_10000003 3300025961 Bacteria 615314
88 Ga0207712_10120496 3300025961 Bacteria 1984
89 Ga0207712_10968221 3300025961 Bacteria 754
90 Ga0207668_10785679 3300025972 Bacteria 842
91 Ga0207640_10107642 3300025981 Bacteria 1969
92 Ga0207677_10000877 3300026023 Bacteria 17024
93 Ga0207703_10001065 3300026035 Bacteria 26177
94 Ga0207639_10002191 3300026041 Bacteria 13152
95 Ga0207708_10116451 3300026075 Bacteria 2079
96 Ga0207702_10005728 3300026078 Bacteria 10827
97 Ga0207641_10000304 3300026088 Bacteria 61194
98 Ga0207676_10000043 3300026095 Bacteria 161948
99 Ga0268266_10000023 3300028379 Bacteria 501899
100 Ga0373953_0201912 3300035117 Unclassified 860
101 Ga0373957_0184058 3300035120 Unclassified 867
102 Ga0373955_0309742 3300035172 Bacteria 953
103 Ga0373937_0031476 3300036401 Bacteria 4808
104 Ga0373937_0222627 3300036401 Bacteria 1776
105 Ga0373937_1200295 3300036401 Unclassified 707
106 Ga0451853_0514721 3300041512 Bacteria 1022
107 Ga0466972_0205888 3300044658 Bacteria 921
108 Ga0466960_0016318 3300044901 Bacteria 3219
109 Ga0466967_0290425 3300045976 Unclassified 1571
110 Ga0466967_0700695 3300045976 Bacteria 1003
111 Ga0495592_0013084 3300046454 Bacteria 6314
112 Ga0495592_0235618 3300046454 Bacteria 1217
113 Ga0495603_0000117 3300046455 Bacteria 38871
114 Ga0495603_0006716 3300046455 Bacteria 6905
115 Ga0495591_058702 3300046458 Unclassified 1028
116 Ga0495629_0049807 3300046459 Bacteria 2936
117 Ga0495629_0308946 3300046459 Bacteria 1082
118 Ga0495629_0453443 3300046459 Unclassified 868
119 Ga0495641_0000001 3300046461 Bacteria 485224
120 Ga0495641_0062160 3300046461 Unclassified 1685
121 Ga0495641_0439578 3300046461 Bacteria 593
122 Ga0495653_0047602 3300046463 Bacteria 3316
123 Ga0495653_0193862 3300046463 Unclassified 1384
124 Ga0495639_0274503 3300046475 Bacteria 837
125 Ga0495662_0003022 3300046476 Bacteria 8489
126 Ga0495662_0066535 3300046476 Bacteria 1743
127 Ga0495596_0213497 3300046500 Bacteria 749
128 Ga0495608_0000163 3300046511 Bacteria 47170
129 Ga0495608_0039180 3300046511 Bacteria 3178
130 Ga0495618_0000087 3300046514 Bacteria 66305
131 Ga0495620_0000119 3300046515 Bacteria 63487
132 Ga0495628_0028579 3300046516 Bacteria 4528
133 Ga0495628_0104394 3300046516 Bacteria 2184
134 Ga0495628_0352869 3300046516 Bacteria 1081
135 Ga0495628_0441612 3300046516 Bacteria 946
136 Ga0495628_0911133 3300046516 Unclassified 609
137 Ga0495630_0002802 3300046517 Bacteria 12100
138 Ga0495630_0036518 3300046517 Bacteria 3673
139 Ga0495630_0109331 3300046517 Bacteria 2094
140 Ga0495630_0208201 3300046517 Unclassified 1493
141 Ga0495652_0004243 3300046529 Bacteria 13770
142 Ga0495652_0186791 3300046529 Bacteria 1585
143 Ga0495640_0084921 3300046533 Bacteria 2098
144 Ga0495587_0126710 3300046536 Bacteria 1461
145 Ga0495587_0682615 3300046536 Bacteria 563
146 Ga0495621_0012625 3300046539 Bacteria 2636
147 Ga0495645_0002968 3300046543 Bacteria 11480
148 Ga0495645_0013456 3300046543 Bacteria 5784
149 Ga0495667_0000273 3300046559 Bacteria 33677
150 Ga0495667_0231047 3300046559 Bacteria 1179
151 Ga0495667_0354026 3300046559 Bacteria 927
152 Ga0495634_0000132 3300046642 Bacteria 64402
153 Ga0495634_0002989 3300046642 Bacteria 13782
154 Ga0495634_0117037 3300046642 Bacteria 1709
155 Ga0495635_0005816 3300046663 Bacteria 8594
156 Ga0495657_0079509 3300046675 Unclassified 2123
157 Ga0495657_0144535 3300046675 Bacteria 1480
158 Ga0495599_0136376 3300046678 Unclassified 1523
159 Ga0495623_0722669 3300046679 Unclassified 509
160 Ga0495647_0000897 3300046681 Bacteria 8926
161 Ga0495647_0198073 3300046681 Bacteria 880
162 Ga0495658_0298883 3300046683 Bacteria 1018
163 Ga0495658_0497442 3300046683 Bacteria 780
164 Ga0495669_0114734 3300046684 Bacteria 1260
165 Ga0495613_0000342 3300046689 Bacteria 41726
166 Ga0495613_0380623 3300046689 Bacteria 965
167 Ga0495613_0796629 3300046689 Bacteria 617
168 Ga0495624_0001826 3300046690 Bacteria 16258
169 Ga0495624_0046404 3300046690 Bacteria 2762
170 Ga0495624_0201256 3300046690 Bacteria 1210
171 Ga0495670_0071147 3300046691 Unclassified 1761
172 Ga0495600_0000846 3300046809 Bacteria 16323
173 Ga0495600_0097170 3300046809 Bacteria 1920
174 Ga0495600_0109135 3300046809 Bacteria 1802
175 Ga0495600_0188698 3300046809 Bacteria 1326
176 Ga0495604_0027920 3300047317 Bacteria 4489
177 Ga0495674_0401552 3300047319 Bacteria 1106
178 Ga0495676_0002618 3300047321 Bacteria 16074
179 Ga0495676_0110083 3300047321 Bacteria 2023
180 Ga0495676_0257653 3300047321 Bacteria 1188
181 Ga0495676_0721526 3300047321 Bacteria 644
182 Ga0495680_0002569 3300047322 Bacteria 18505
183 Ga0495680_0003396 3300047322 Bacteria 15711
184 Ga0495680_0011566 3300047322 Bacteria 7803
185 Ga0495680_0278115 3300047322 Bacteria 1180
186 Ga0495680_0372562 3300047322 Unclassified 990
187 Ga0495684_0134515 3300047471 Unclassified 1856
188 Ga0495593_0100232 3300047673 Bacteria 1486
189 Ga0495593_0188129 3300047673 Bacteria 1039
190 Ga0495602_0210569 3300048088 Unclassified 1476
191 Ga0495602_0418718 3300048088 Bacteria 952
192 Ga0495614_0299738 3300048089 Bacteria 743
193 Ga0496100_0000003 3300048903 Bacteria 360802
194 Ga0496100_0000008 3300048903 Bacteria 231974
195 Ga0496101_0000003 3300048904 Bacteria 406565
196 Ga0496101_0000016 3300048904 Bacteria 240753
197 Ga0496102_0667945 3300048905 Bacteria 962
198 Ga0496104_0000003 3300048907 Bacteria 669219
199 Ga0496105_0000031 3300048908 Bacteria 137220
200 Ga0496105_0000070 3300048908 Bacteria 80117
201 Ga0496105_0062987 3300048908 Bacteria 3060
202 Ga0496105_0757943 3300048908 Bacteria 741
203 Ga0496106_0000015 3300048909 Bacteria 187570
204 Ga0496106_0000086 3300048909 Bacteria 73933
205 Ga0496106_0001663 3300048909 Bacteria 16681
206 Ga0496106_1363012 3300048909 Bacteria 549
207 Ga0496107_0000008 3300048910 Bacteria 251874
208 Ga0496107_0000009 3300048910 Bacteria 231682
209 Ga0496107_0048052 3300048910 Bacteria 3073
210 Ga0496108_0643412 3300048911 Bacteria 922
211 Ga0496109_0000001 3300048912 Bacteria 700852
212 Ga0496109_0126641 3300048912 Bacteria 2382
213 Ga0496109_0327790 3300048912 Bacteria 1445
214 Ga0496109_0573765 3300048912 Bacteria 1063
215 Ga0496109_0656675 3300048912 Unclassified 986
216 Ga0496110_0019299 3300048913 Bacteria 5734
217 Ga0496110_0024010 3300048913 Bacteria 5194
218 Ga0496110_0184531 3300048913 Bacteria 1894
219 Ga0496111_0281080 3300048914 Bacteria 1234
220 Ga0496112_0000002 3300048915 Bacteria 782039
221 Ga0496112_0076729 3300048915 Bacteria 3305
222 Ga0496112_0418846 3300048915 Bacteria 1278
223 Ga0496112_0817719 3300048915 Bacteria 856
224 Ga0496112_0898074 3300048915 Unclassified 808
225 Ga0496113_0033746 3300048916 Bacteria 3729
226 Ga0496113_0072838 3300048916 Bacteria 2616
227 Ga0496113_0327640 3300048916 Bacteria 1228
228 Ga0496115_0007058 3300048918 Bacteria 8252
229 Ga0496119_0196889 3300048922 Bacteria 1046
230 Ga0501031_0157327 3300049568 Bacteria 1485
231 Ga0501031_0408988 3300049568 Bacteria 877
232 Ga0501032_0952028 3300049569 Bacteria 540
233 Ga0501033_0246177 3300049570 Bacteria 1268
234 Ga0501033_0774414 3300049570 Bacteria 650
235 Ga0501033_0809689 3300049570 Unclassified 633
236 Ga0501036_0289238 3300049572 Bacteria 1371
237 Ga0501037_0522861 3300049573 Bacteria 803
238 Ga0501039_0057418 3300049575 Bacteria 3014
239 Ga0501039_0166207 3300049575 Bacteria 1735
240 Ga0501041_0128533 3300049577 Bacteria 1578
241 Ga0501041_0227109 3300049577 Unclassified 1172
242 Ga0501042_0152594 3300049578 Unclassified 1666
243 Ga0501042_0317158 3300049578 Bacteria 1126
244 Ga0501043_0592295 3300049579 Bacteria 820
245 Ga0501046_0217498 3300049580 Bacteria 1416
246 Ga0501046_0296394 3300049580 Unclassified 1182
247 Ga0501048_0044019 3300049582 Bacteria 3194
248 Ga0501048_0468414 3300049582 Unclassified 903
249 Ga0501068_0259888 3300049584 Bacteria 1107
250 Ga0501068_0501868 3300049584 Bacteria 787
251 Ga0501069_0302717 3300049585 Bacteria 938
252 Ga0501069_0443359 3300049585 Bacteria 771
253 Ga0501071_0360214 3300049587 Bacteria 1107
254 Ga0501072_0032626 3300049588 Bacteria 4079
255 Ga0501072_0105756 3300049588 Bacteria 2238
256 Ga0501072_0186018 3300049588 Bacteria 1657
257 Ga0501074_0116855 3300049590 Bacteria 1908
258 Ga0501075_0077475 3300049591 Bacteria 2515
259 Ga0501075_0091944 3300049591 Bacteria 2302
260 Ga0501075_0318097 3300049591 Bacteria 1186
261 Ga0501075_0913626 3300049591 Archaea 667
262 Ga0501076_0055977 3300049592 Bacteria 3129
263 Ga0501076_0226893 3300049592 Unclassified 1527
264 Ga0501079_0314777 3300049741 Bacteria 1225
265 Ga0501080_0950949 3300049742 Bacteria 747
266 Ga0501080_1122280 3300049742 Unclassified 678
267 nmdc:mga05p37_509322_c1 3300050507 Bacteria 1379
268 nmdc:mga09592_285786_c1 3300050508 Bacteria 1430
269 nmdc:mga0qj67_1184868_c1 3300050509 Bacteria 595
270 nmdc:mga0qj67_34557_c1 3300050509 Bacteria 3949
271 nmdc:mga06r32_25168_c1 3300050510 Bacteria 5533
272 nmdc:mga06r32_369060_c1 3300050510 Bacteria 1418
273 nmdc:mga08y16_334820_c1 3300050511 Bacteria 1556
274 nmdc:mga08y16_383447_c1 3300050511 Bacteria 1440
275 nmdc:mga0n895_871448_c1 3300050512 Bacteria 887
276 nmdc:mga0a205_9_c2 3300050515 Bacteria 69167
277 Ga0495601_0005154 3300053077 Bacteria 7596
278 Ga0495601_0015700 3300053077 Bacteria 4579
279 Ga0495601_0022889 3300053077 Bacteria 3839
280 Ga0495601_0199546 3300053077 Unclassified 1307
281 Ga0495601_0245382 3300053077 Bacteria 1169
282 Ga0495601_0300914 3300053077 Unclassified 1045
283 Ga0495601_0511655 3300053077 Bacteria 774
284 Ga0495612_0000125 3300053078 Bacteria 32341
285 Ga0495612_0000432 3300053078 Bacteria 16768
286 Ga0495612_0199297 3300053078 Bacteria 883
287 Ga0495595_0000410 3300053084 Bacteria 16323
288 Ga0495595_0167903 3300053084 Unclassified 1085
289 Ga0495595_0191674 3300053084 Bacteria 1016
290 Ga0495619_0000512 3300053085 Bacteria 25819
291 Ga0495619_0002664 3300053085 Bacteria 11675
292 Ga0495619_0011829 3300053085 Bacteria 5497
293 Ga0495619_0011864 3300053085 Bacteria 5489
294 Ga0495619_0039327 3300053085 Bacteria 3088
295 Ga0495619_0061137 3300053085 Bacteria 2506
296 Ga0495619_0087346 3300053085 Unclassified 2108
297 Ga0500614_000031 3300053123 Bacteria 31527
298 Ga0501084_0012504 3300054114 Bacteria 7031
299 Ga0501084_0082503 3300054114 Bacteria 2698
300 Ga0501084_0561973 3300054114 Unclassified 964
301 Ga0501082_0198272 3300060353 Bacteria 1746
302 Ga0501082_0225898 3300060353 Bacteria 1629
303 Ga0501082_0374542 3300060353 Unclassified 1242
304 Ga0530510_0003841 3300061734 Bacteria 10354
305 Ga0530510_0068468 3300061734 Bacteria 2575
306 Ga0070685_10061638
307 JGI24746J21847_1000021
308 Ga0070683_100011595
309 Ga0070683_100415199
310 Ga0070683_100581779
311 Ga0070677_10000031
312 Ga0070682_100000029
313 Ga0070682_100332203
314 Ga0068868_100000755
315 Ga0070660_101744009
316 Ga0070689_100018822
317 Ga0070692_10389908
318 Ga0070674_101000562
319 Ga0070714_100043170
320 Ga0070713_100886077
321 Ga0070701_10589317
322 Ga0070711_100042630
323 Ga0070700_100099601
324 Ga0070662_100000085
325 Ga0070681_10714283
326 Ga0070679_100739080
327 Ga0070684_100004097
328 Ga0070684_100378928
329 Ga0070684_100554494
330 Ga0068853_100003416
331 Ga0070695_100466115
332 Ga0070693_100003712
333 Ga0070665_100000120
334 Ga0070664_100245240
335 Ga0068857_100084639
336 Ga0068854_100009329
337 Ga0068856_100001591
338 Ga0068856_101281886
339 Ga0068864_100000044
340 Ga0068866_10747191
341 Ga0068861_101983862
342 Ga0068863_100000080
343 Ga0068858_100000035
344 Ga0068860_101114018
345 Ga0075365_10694733
346 Ga0070716_100301221
347 Ga0097621_100940759
348 Ga0068871_100081315
349 Ga0075428_102424227
350 Ga0075430_101453093
351 Ga0075431_100312679
352 Ga0075433_10000058
353 Ga0075433_10499147
354 Ga0075434_101241065
355 Ga0111539_10260005
356 Ga0111539_10365842
357 Ga0105245_10000053
358 Ga0105245_10000859
359 Ga0105247_10477458
360 Ga0114129_10270469
361 Ga0114129_10420546
362 Ga0105243_13109027
363 Ga0105248_13240830
364 Ga0105249_10000095
365 Ga0105249_10247091
366 Ga0105249_11475078
367 Ga0105246_11590369
368 Ga0157374_10002465
369 Ga0157372_10828526
370 Ga0157372_13020137
371 Ga0157375_10007931
372 Ga0163163_10056003
373 Ga0157380_10000080
374 Ga0163161_10000364
375 Ga0163161_10364406
376 Ga0207682_10000067
377 Ga0207643_11017797
378 Ga0207707_10677236
379 Ga0207663_10073803
380 Ga0207652_10000177
381 Ga0207687_10000021
382 Ga0207687_10000785
383 Ga0207700_10717294
384 Ga0207664_10236061
385 Ga0207706_10000338
386 Ga0207670_10020190
387 Ga0207689_11444911
388 Ga0207661_10028569
389 Ga0207661_10058300
390 Ga0207661_10750611
391 Ga0207679_10324126
392 Ga0207712_10000003
393 Ga0207712_10120496
394 Ga0207712_10968221
395 Ga0207668_10785679
396 Ga0207640_10107642
397 Ga0207677_10000877
398 Ga0207703_10001065
399 Ga0207639_10002191
400 Ga0207708_10116451
401 Ga0207702_10005728
402 Ga0207641_10000304
403 Ga0207676_10000043
404 Ga0268266_10000023
405 Ga0373953_0201912
406 Ga0373957_0184058
407 Ga0373955_0309742
408 Ga0373937_0031476
409 Ga0373937_0222627
410 Ga0373937_1200295
411 Ga0451853_0514721
412 Ga0466972_0205888
413 Ga0466960_0016318
414 Ga0466967_0290425
415 Ga0466967_0700695
416 Ga0495592_0013084
417 Ga0495592_0235618
418 Ga0495603_0000117
419 Ga0495603_0006716
420 Ga0495591_058702
421 Ga0495629_0049807
422 Ga0495629_0308946
423 Ga0495629_0453443
424 Ga0495641_0000001
425 Ga0495641_0062160
426 Ga0495641_0439578
427 Ga0495653_0047602
428 Ga0495653_0193862
429 Ga0495639_0274503
430 Ga0495662_0003022
431 Ga0495662_0066535
432 Ga0495596_0213497
433 Ga0495608_0000163
434 Ga0495608_0039180
435 Ga0495618_0000087
436 Ga0495620_0000119
437 Ga0495628_0028579
438 Ga0495628_0104394
439 Ga0495628_0352869
440 Ga0495628_0441612
441 Ga0495628_0911133
442 Ga0495630_0002802
443 Ga0495630_0036518
444 Ga0495630_0109331
445 Ga0495630_0208201
446 Ga0495652_0004243
447 Ga0495652_0186791
448 Ga0495640_0084921
449 Ga0495587_0126710
450 Ga0495587_0682615
451 Ga0495621_0012625
452 Ga0495645_0002968
453 Ga0495645_0013456
454 Ga0495667_0000273
455 Ga0495667_0231047
456 Ga0495667_0354026
457 Ga0495634_0000132
458 Ga0495634_0002989
459 Ga0495634_0117037
460 Ga0495635_0005816
461 Ga0495657_0079509
462 Ga0495657_0144535
463 Ga0495599_0136376
464 Ga0495623_0722669
465 Ga0495647_0000897
466 Ga0495647_0198073
467 Ga0495658_0298883
468 Ga0495658_0497442
469 Ga0495669_0114734
470 Ga0495613_0000342
471 Ga0495613_0380623
472 Ga0495613_0796629
473 Ga0495624_0001826
474 Ga0495624_0046404
475 Ga0495624_0201256
476 Ga0495670_0071147
477 Ga0495600_0000846
478 Ga0495600_0097170
479 Ga0495600_0109135
480 Ga0495600_0188698
481 Ga0495604_0027920
482 Ga0495674_0401552
483 Ga0495676_0002618
484 Ga0495676_0110083
485 Ga0495676_0257653
486 Ga0495676_0721526
487 Ga0495680_0002569
488 Ga0495680_0003396
489 Ga0495680_0011566
490 Ga0495680_0278115
491 Ga0495680_0372562
492 Ga0495684_0134515
493 Ga0495593_0100232
494 Ga0495593_0188129
495 Ga0495602_0210569
496 Ga0495602_0418718
497 Ga0495614_0299738
498 Ga0496100_0000003
499 Ga0496100_0000008
500 Ga0496101_0000003
501 Ga0496101_0000016
502 Ga0496102_0667945
503 Ga0496104_0000003
504 Ga0496105_0000031
505 Ga0496105_0000070
506 Ga0496105_0062987
507 Ga0496105_0757943
508 Ga0496106_0000015
509 Ga0496106_0000086
510 Ga0496106_0001663
511 Ga0496106_1363012
512 Ga0496107_0000008
513 Ga0496107_0000009
514 Ga0496107_0048052
515 Ga0496108_0643412
516 Ga0496109_0000001
517 Ga0496109_0126641
518 Ga0496109_0327790
519 Ga0496109_0573765
520 Ga0496109_0656675
521 Ga0496110_0019299
522 Ga0496110_0024010
523 Ga0496110_0184531
524 Ga0496111_0281080
525 Ga0496112_0000002
526 Ga0496112_0076729
527 Ga0496112_0418846
528 Ga0496112_0817719
529 Ga0496112_0898074
530 Ga0496113_0033746
531 Ga0496113_0072838
532 Ga0496113_0327640
533 Ga0496115_0007058
534 Ga0496119_0196889
535 Ga0501031_0157327
536 Ga0501031_0408988
537 Ga0501032_0952028
538 Ga0501033_0246177
539 Ga0501033_0774414
540 Ga0501033_0809689
541 Ga0501036_0289238
542 Ga0501037_0522861
543 Ga0501039_0057418
544 Ga0501039_0166207
545 Ga0501041_0128533
546 Ga0501041_0227109
547 Ga0501042_0152594
548 Ga0501042_0317158
549 Ga0501043_0592295
550 Ga0501046_0217498
551 Ga0501046_0296394
552 Ga0501048_0044019
553 Ga0501048_0468414
554 Ga0501068_0259888
555 Ga0501068_0501868
556 Ga0501069_0302717
557 Ga0501069_0443359
558 Ga0501071_0360214
559 Ga0501072_0032626
560 Ga0501072_0105756
561 Ga0501072_0186018
562 Ga0501074_0116855
563 Ga0501075_0077475
564 Ga0501075_0091944
565 Ga0501075_0318097
566 Ga0501075_0913626
567 Ga0501076_0055977
568 Ga0501076_0226893
569 Ga0501079_0314777
570 Ga0501080_0950949
571 Ga0501080_1122280
572 nmdc:mga05p37_509322_c1
573 nmdc:mga09592_285786_c1
574 nmdc:mga0qj67_1184868_c1
575 nmdc:mga0qj67_34557_c1
576 nmdc:mga06r32_25168_c1
577 nmdc:mga06r32_369060_c1
578 nmdc:mga08y16_334820_c1
579 nmdc:mga08y16_383447_c1
580 nmdc:mga0n895_871448_c1
581 nmdc:mga0a205_9_c2
582 Ga0495601_0005154
583 Ga0495601_0015700
584 Ga0495601_0022889
585 Ga0495601_0199546
586 Ga0495601_0245382
587 Ga0495601_0300914
588 Ga0495601_0511655
589 Ga0495612_0000125
590 Ga0495612_0000432
591 Ga0495612_0199297
592 Ga0495595_0000410
593 Ga0495595_0167903
594 Ga0495595_0191674
595 Ga0495619_0000512
596 Ga0495619_0002664
597 Ga0495619_0011829
598 Ga0495619_0011864
599 Ga0495619_0039327
600 Ga0495619_0061137
601 Ga0495619_0087346
602 Ga0500614_000031
603 Ga0501084_0012504
604 Ga0501084_0082503
605 Ga0501084_0561973
606 Ga0501082_0198272
607 Ga0501082_0225898
608 Ga0501082_0374542
609 Ga0530510_0003841
610 Ga0530510_0068468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.7012 1 125
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.6873 1 125
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.6413 6 124
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.6206 6 124
3iwj-assembly1.cif.gz_B crystal structure of aminoaldehyde dehydrogenase 2 from pisum sativum (psamadh2) 0.6164 10 66
ID Description Score Start End Superfamily
af_Q7K527_1_92_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.7254 7 76 1.20.5.110
af_Q9N4P4_40_210_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.716 4 116 1.20.120.550
af_M9MSL9_1_154_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6769 3 133 1.20.140.150
af_C6SWX3_2_116_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6702 5 118 1.20.1280.290
af_O74820_11_117_3.40.50.11000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Fe-S cluster assembly protein Dre2, N-terminal domain 0.6566 6 106 3.40.50.11000
ID Description Score Start End GO Terms
AF-A0A7J9YTK8-F1-model_v4 DUF4383 domain-containing protein 0.9253 1 146 GO:0016020
AF-A0A7J9YTK8-F1-model_v4 DUF4383 domain-containing protein 0.9192 1 146 GO:0016020
AF-A0A7W0LPL4-F1-model_v4 DUF4345 family protein 0.9065 1 128 GO:0016020
AF-A0A4V2S3D9-F1-model_v4 DoxX-like protein 0.9065 1 127 GO:0016020
AF-A0A841NEM9-F1-model_v4 deleted 0.9045 1 129

Map