F397820
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 214 | 304 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300053085|Ga0495619_0199860|Ga0495619_0199860_889_1293 |
| Length | 134 |
| Sequence | MDATMILIDSDAELARARALVDRLWDSNDPADIARLEAQARLIAAYEELKWPRGQPPSIADLIRHLMDQYGLTRADMVPILGTPSRVSEVLRGKKGLSMAMMQRLRARFRVPADLLLPPPKKAQARRGTKGVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 21 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 22 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 23 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 29 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 34 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 35 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 36 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 39 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 63 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 64 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 65 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 66 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 91 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 92 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 96 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 97 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 98 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 99 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 100 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 101 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 102 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 103 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 104 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 106 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 107 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 109 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 111 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 115 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 117 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 118 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 124 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 157 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 158 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 159 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 160 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 161 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 162 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 166 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 167 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 170 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 173 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 174 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 188 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 197 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 198 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 199 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 200 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 201 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 202 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 203 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 204 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 205 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 206 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 207 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 208 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 209 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 210 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 211 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 1.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.91 |
| Nodule | 0 |
| Rhizoplane | 9.54 |
| Rhizosphere | 77.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10009365 | 3300003659 | Bacteria | 2093 |
| 2 | Ga0070690_101718979 | 3300005330 | Unclassified | 510 |
| 3 | Ga0068869_101225159 | 3300005334 | Unclassified | 660 |
| 4 | Ga0068868_100911987 | 3300005338 | Bacteria | 799 |
| 5 | Ga0070689_100198632 | 3300005340 | Bacteria | 1636 |
| 6 | Ga0070671_100412763 | 3300005355 | Bacteria | 1156 |
| 7 | Ga0070674_100351746 | 3300005356 | Bacteria | 1190 |
| 8 | Ga0070667_101950171 | 3300005367 | Unclassified | 553 |
| 9 | Ga0070709_10777319 | 3300005434 | Unclassified | 750 |
| 10 | Ga0070709_11077723 | 3300005434 | Bacteria | 642 |
| 11 | Ga0070714_100842078 | 3300005435 | Bacteria | 889 |
| 12 | Ga0070714_101868330 | 3300005435 | Bacteria | 586 |
| 13 | Ga0070714_102089348 | 3300005435 | Bacteria | 552 |
| 14 | Ga0070713_100709002 | 3300005436 | Bacteria | 961 |
| 15 | Ga0070713_100746970 | 3300005436 | Bacteria | 936 |
| 16 | Ga0070713_100988784 | 3300005436 | Unclassified | 811 |
| 17 | Ga0070710_10086228 | 3300005437 | Bacteria | 1843 |
| 18 | Ga0070710_10398119 | 3300005437 | Bacteria | 922 |
| 19 | Ga0070710_11543529 | 3300005437 | Unclassified | 500 |
| 20 | Ga0070711_100342994 | 3300005439 | Unclassified | 1199 |
| 21 | Ga0070708_100374866 | 3300005445 | Bacteria | 1342 |
| 22 | Ga0070681_10495662 | 3300005458 | Bacteria | 1135 |
| 23 | Ga0070679_100313692 | 3300005530 | Bacteria | 1518 |
| 24 | Ga0068853_100377649 | 3300005539 | Bacteria | 1323 |
| 25 | Ga0068853_100803649 | 3300005539 | Bacteria | 901 |
| 26 | Ga0070686_100211025 | 3300005544 | Bacteria | 1398 |
| 27 | Ga0070686_100718858 | 3300005544 | Bacteria | 798 |
| 28 | Ga0068855_100592973 | 3300005563 | Bacteria | 1196 |
| 29 | Ga0068856_100453966 | 3300005614 | Bacteria | 1303 |
| 30 | Ga0068852_100187319 | 3300005616 | Bacteria | 1950 |
| 31 | Ga0068864_101315392 | 3300005618 | Bacteria | 723 |
| 32 | Ga0068866_10098578 | 3300005718 | Bacteria | 1607 |
| 33 | Ga0068861_101351259 | 3300005719 | Unclassified | 694 |
| 34 | Ga0068858_100595687 | 3300005842 | Bacteria | 1072 |
| 35 | Ga0081455_10444893 | 3300005937 | Unclassified | 887 |
| 36 | Ga0081538_10061909 | 3300005981 | Bacteria | 2138 |
| 37 | Ga0081540_1008711 | 3300005983 | Bacteria | 7061 |
| 38 | Ga0081540_1064336 | 3300005983 | Bacteria | 1731 |
| 39 | Ga0070715_10133154 | 3300006163 | Bacteria | 1199 |
| 40 | Ga0070715_10668915 | 3300006163 | Bacteria | 617 |
| 41 | Ga0070712_100130855 | 3300006175 | Bacteria | 1901 |
| 42 | Ga0070712_101063060 | 3300006175 | Bacteria | 702 |
| 43 | Ga0070712_101262834 | 3300006175 | Bacteria | 643 |
| 44 | Ga0097621_100228706 | 3300006237 | Bacteria | 1623 |
| 45 | Ga0068871_100914141 | 3300006358 | Unclassified | 814 |
| 46 | Ga0075428_100065811 | 3300006844 | Bacteria | 3969 |
| 47 | Ga0075430_100036091 | 3300006846 | Bacteria | 4192 |
| 48 | Ga0075431_100037255 | 3300006847 | Bacteria | 5012 |
| 49 | Ga0075429_100191095 | 3300006880 | Unclassified | 1794 |
| 50 | Ga0097620_101635058 | 3300006931 | Bacteria | 711 |
| 51 | Ga0099794_10018243 | 3300007265 | Bacteria | 3144 |
| 52 | Ga0099795_10021264 | 3300007788 | Bacteria | 2125 |
| 53 | Ga0099795_10046333 | 3300007788 | Bacteria | 1566 |
| 54 | Ga0099795_10171600 | 3300007788 | Bacteria | 901 |
| 55 | Ga0099795_10499829 | 3300007788 | Unclassified | 567 |
| 56 | Ga0099795_10540752 | 3300007788 | Unclassified | 548 |
| 57 | Ga0105240_10287451 | 3300009093 | Bacteria | 1886 |
| 58 | Ga0105240_12055944 | 3300009093 | Bacteria | 593 |
| 59 | Ga0105245_11292264 | 3300009098 | Bacteria | 778 |
| 60 | Ga0114129_11336154 | 3300009147 | Unclassified | 887 |
| 61 | Ga0114129_11454565 | 3300009147 | Bacteria | 844 |
| 62 | Ga0114129_12267986 | 3300009147 | Bacteria | 652 |
| 63 | Ga0105242_10221986 | 3300009176 | Bacteria | 1689 |
| 64 | Ga0105248_10186799 | 3300009177 | Bacteria | 2335 |
| 65 | Ga0105248_12182999 | 3300009177 | Unclassified | 630 |
| 66 | Ga0105237_10345124 | 3300009545 | Bacteria | 1493 |
| 67 | Ga0105237_10834377 | 3300009545 | Bacteria | 928 |
| 68 | Ga0105238_10070585 | 3300009551 | Bacteria | 3492 |
| 69 | Ga0105238_10461615 | 3300009551 | Bacteria | 1268 |
| 70 | Ga0105238_11422763 | 3300009551 | Bacteria | 721 |
| 71 | Ga0105249_11850105 | 3300009553 | Bacteria | 676 |
| 72 | Ga0105249_12460170 | 3300009553 | Bacteria | 593 |
| 73 | Ga0099796_10119640 | 3300010159 | Bacteria | 1011 |
| 74 | Ga0099796_10174559 | 3300010159 | Bacteria | 859 |
| 75 | Ga0105239_10066442 | 3300010375 | Bacteria | 3961 |
| 76 | Ga0105246_11074887 | 3300011119 | Bacteria | 733 |
| 77 | Ga0157378_10694142 | 3300013297 | Bacteria | 1037 |
| 78 | Ga0157378_11219507 | 3300013297 | Bacteria | 792 |
| 79 | Ga0163162_10590911 | 3300013306 | Bacteria | 1237 |
| 80 | Ga0157372_10058995 | 3300013307 | Bacteria | 4291 |
| 81 | Ga0157375_10501401 | 3300013308 | Bacteria | 1378 |
| 82 | Ga0157375_12892203 | 3300013308 | Bacteria | 574 |
| 83 | Ga0163163_11875728 | 3300014325 | Unclassified | 659 |
| 84 | Ga0157380_10894013 | 3300014326 | Bacteria | 914 |
| 85 | Ga0157379_10298954 | 3300014968 | Unclassified | 1467 |
| 86 | Ga0157379_10323798 | 3300014968 | Bacteria | 1407 |
| 87 | Ga0157379_11949556 | 3300014968 | Unclassified | 580 |
| 88 | Ga0157376_10260544 | 3300014969 | Bacteria | 1624 |
| 89 | Ga0182005_1064297 | 3300015265 | Bacteria | 1003 |
| 90 | Ga0163161_10401167 | 3300017792 | Bacteria | 1099 |
| 91 | Ga0206356_10768386 | 3300020070 | Bacteria | 607 |
| 92 | Ga0213874_10040030 | 3300021377 | Bacteria | 1398 |
| 93 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 94 | Ga0213871_10076355 | 3300021441 | Bacteria | 954 |
| 95 | Ga0224572_1000526 | 3300024225 | Bacteria | 4636 |
| 96 | Ga0228598_1005907 | 3300024227 | Bacteria | 2544 |
| 97 | Ga0207692_10044560 | 3300025898 | Bacteria | 2214 |
| 98 | Ga0207692_10283376 | 3300025898 | Bacteria | 1003 |
| 99 | Ga0207707_10048565 | 3300025912 | Bacteria | 3697 |
| 100 | Ga0207693_10043249 | 3300025915 | Bacteria | 3544 |
| 101 | Ga0207693_10600531 | 3300025915 | Bacteria | 857 |
| 102 | Ga0207663_11094357 | 3300025916 | Bacteria | 640 |
| 103 | Ga0207652_10091867 | 3300025921 | Bacteria | 2669 |
| 104 | Ga0207652_11469482 | 3300025921 | Bacteria | 585 |
| 105 | Ga0207694_10158540 | 3300025924 | Bacteria | 1827 |
| 106 | Ga0207694_10443497 | 3300025924 | Bacteria | 1083 |
| 107 | Ga0207700_10468772 | 3300025928 | Bacteria | 1112 |
| 108 | Ga0207664_10075834 | 3300025929 | Bacteria | 2720 |
| 109 | Ga0207664_10360214 | 3300025929 | Bacteria | 1288 |
| 110 | Ga0207686_10154405 | 3300025934 | Bacteria | 1602 |
| 111 | Ga0207670_10528997 | 3300025936 | Unclassified | 961 |
| 112 | Ga0207665_10160656 | 3300025939 | Bacteria | 1616 |
| 113 | Ga0207711_10604612 | 3300025941 | Bacteria | 1023 |
| 114 | Ga0207658_10495115 | 3300025986 | Bacteria | 1088 |
| 115 | Ga0207677_10273018 | 3300026023 | Bacteria | 1384 |
| 116 | Ga0207639_10422876 | 3300026041 | Bacteria | 1205 |
| 117 | Ga0207702_10284639 | 3300026078 | Bacteria | 1564 |
| 118 | Ga0207698_10430332 | 3300026142 | Bacteria | 1269 |
| 119 | Ga0209179_1006209 | 3300027512 | Bacteria | 1913 |
| 120 | Ga0268265_12090378 | 3300028380 | Unclassified | 573 |
| 121 | Ga0268264_10850171 | 3300028381 | Bacteria | 914 |
| 122 | Ga0265338_10005513 | 3300028800 | Bacteria | 16493 |
| 123 | Ga0265763_1005552 | 3300030763 | Bacteria | 1061 |
| 124 | Ga0265770_1130552 | 3300030878 | Bacteria | 536 |
| 125 | Ga0265760_10015549 | 3300031090 | Bacteria | 2181 |
| 126 | Ga0265325_10093701 | 3300031241 | Bacteria | 1477 |
| 127 | Ga0265339_10000126 | 3300031249 | Bacteria | 63942 |
| 128 | Ga0265331_10027344 | 3300031250 | Plasmid | 2860 |
| 129 | Ga0265313_10000844 | 3300031595 | Bacteria | 30856 |
| 130 | Ga0307508_10015607 | 3300031616 | Bacteria | 6920 |
| 131 | Ga0316579_10226552 | 3300031691 | Bacteria | 904 |
| 132 | Ga0265342_10026554 | 3300031712 | Bacteria | 3626 |
| 133 | Ga0307507_10500502 | 3300033179 | Bacteria | 655 |
| 134 | Ga0316215_1031735 | 3300033544 | Bacteria | 549 |
| 135 | Ga0373930_0035963 | 3300034816 | Bacteria | 1037 |
| 136 | Ga0373938_0022603 | 3300034957 | Bacteria | 1286 |
| 137 | Ga0373938_0083973 | 3300034957 | Bacteria | 779 |
| 138 | Ga0373928_0145175 | 3300035084 | Bacteria | 653 |
| 139 | Ga0373929_0005279 | 3300035085 | Bacteria | 2322 |
| 140 | Ga0373934_0023916 | 3300035086 | Bacteria | 2362 |
| 141 | Ga0373951_0040551 | 3300035091 | Unclassified | 1122 |
| 142 | Ga0373939_0002944 | 3300035114 | Bacteria | 4002 |
| 143 | Ga0373939_0046986 | 3300035114 | Bacteria | 1324 |
| 144 | Ga0373941_0168740 | 3300035115 | Bacteria | 814 |
| 145 | Ga0373941_0212320 | 3300035115 | Bacteria | 740 |
| 146 | Ga0373945_0284555 | 3300035116 | Bacteria | 705 |
| 147 | Ga0373945_0306932 | 3300035116 | Bacteria | 681 |
| 148 | Ga0373953_0035850 | 3300035117 | Bacteria | 1951 |
| 149 | Ga0373954_0529917 | 3300035118 | Unclassified | 584 |
| 150 | Ga0373943_0127945 | 3300035170 | Bacteria | 1357 |
| 151 | Ga0373955_0431922 | 3300035172 | Unclassified | 802 |
| 152 | Ga0373955_0436960 | 3300035172 | Unclassified | 797 |
| 153 | Ga0373955_0498631 | 3300035172 | Bacteria | 744 |
| 154 | Ga0373961_0159293 | 3300035241 | Unclassified | 774 |
| 155 | Ga0373962_0364639 | 3300035242 | Unclassified | 525 |
| 156 | Ga0373931_0001430 | 3300035691 | Bacteria | 10240 |
| 157 | Ga0373931_0075858 | 3300035691 | Bacteria | 1845 |
| 158 | Ga0373935_0156881 | 3300035692 | Bacteria | 1549 |
| 159 | Ga0373927_0064012 | 3300035695 | Bacteria | 2379 |
| 160 | Ga0373927_0198785 | 3300035695 | Bacteria | 1316 |
| 161 | Ga0373933_0565409 | 3300035724 | Unclassified | 746 |
| 162 | Ga0373937_0000611 | 3300036401 | Bacteria | 31552 |
| 163 | Ga0373937_0140518 | 3300036401 | Bacteria | 2259 |
| 164 | Ga0373937_0772039 | 3300036401 | Bacteria | 909 |
| 165 | Ga0373925_0161560 | 3300037068 | Bacteria | 1765 |
| 166 | Ga0436364_0461857 | 3300037853 | Bacteria | 19352 |
| 167 | Ga0436364_0951384 | 3300037853 | Bacteria | 2577 |
| 168 | Ga0436364_1401923 | 3300037853 | Bacteria | 822 |
| 169 | Ga0436365_0607713 | 3300039437 | Unclassified | 731 |
| 170 | Ga0436365_1053035 | 3300039437 | Bacteria | 2856 |
| 171 | Ga0436365_1549035 | 3300039437 | Bacteria | 786 |
| 172 | Ga0436360_0955792 | 3300039438 | Bacteria | 2160 |
| 173 | Ga0436360_1240312 | 3300039438 | Bacteria | 633 |
| 174 | Ga0436360_1360743 | 3300039438 | Bacteria | 536 |
| 175 | Ga0436363_0250208 | 3300039450 | Bacteria | 1656 |
| 176 | Ga0436363_0606097 | 3300039450 | Unclassified | 559 |
| 177 | Ga0495629_0374063 | 3300046459 | Bacteria | 970 |
| 178 | Ga0495651_0265567 | 3300046462 | Bacteria | 1166 |
| 179 | Ga0495653_0261140 | 3300046463 | Bacteria | 1145 |
| 180 | Ga0495653_0689107 | 3300046463 | Unclassified | 621 |
| 181 | Ga0495664_0076576 | 3300046477 | Bacteria | 2002 |
| 182 | Ga0495664_0547476 | 3300046477 | Unclassified | 690 |
| 183 | Ga0495584_0264265 | 3300046491 | Unclassified | 875 |
| 184 | Ga0495584_0482455 | 3300046491 | Unclassified | 631 |
| 185 | Ga0495618_0204787 | 3300046514 | Bacteria | 1248 |
| 186 | Ga0495628_0754950 | 3300046516 | Bacteria | 683 |
| 187 | Ga0495631_0319483 | 3300046518 | Unclassified | 661 |
| 188 | Ga0495644_0090797 | 3300046523 | Bacteria | 1153 |
| 189 | Ga0495652_0206569 | 3300046529 | Unclassified | 1487 |
| 190 | Ga0495652_0791083 | 3300046529 | Bacteria | 632 |
| 191 | Ga0495665_0040485 | 3300046531 | Unclassified | 2481 |
| 192 | Ga0495665_0657498 | 3300046531 | Unclassified | 521 |
| 193 | Ga0495640_0521314 | 3300046533 | Bacteria | 722 |
| 194 | Ga0495587_0174080 | 3300046536 | Bacteria | 1222 |
| 195 | Ga0495645_0038372 | 3300046543 | Bacteria | 3493 |
| 196 | Ga0495645_0713155 | 3300046543 | Unclassified | 608 |
| 197 | Ga0495667_0353668 | 3300046559 | Bacteria | 928 |
| 198 | Ga0495667_0417799 | 3300046559 | Bacteria | 844 |
| 199 | Ga0495667_0480634 | 3300046559 | Bacteria | 779 |
| 200 | Ga0495634_0090336 | 3300046642 | Unclassified | 1990 |
| 201 | Ga0495635_0423700 | 3300046663 | Bacteria | 882 |
| 202 | Ga0495599_0137593 | 3300046678 | Bacteria | 1516 |
| 203 | Ga0495669_0516598 | 3300046684 | Unclassified | 581 |
| 204 | Ga0495670_0560253 | 3300046691 | Unclassified | 622 |
| 205 | Ga0495581_0180590 | 3300047315 | Bacteria | 1234 |
| 206 | Ga0495604_0121643 | 3300047317 | Unclassified | 1889 |
| 207 | Ga0495604_0222783 | 3300047317 | Bacteria | 1298 |
| 208 | Ga0495674_0063264 | 3300047319 | Bacteria | 3219 |
| 209 | Ga0495680_0335141 | 3300047322 | Bacteria | 1056 |
| 210 | Ga0495680_0349262 | 3300047322 | Unclassified | 1030 |
| 211 | Ga0495683_0251797 | 3300047323 | Bacteria | 775 |
| 212 | Ga0495675_0165614 | 3300047444 | Bacteria | 1360 |
| 213 | Ga0495677_0300643 | 3300047445 | Unclassified | 631 |
| 214 | Ga0495684_0056478 | 3300047471 | Bacteria | 2993 |
| 215 | Ga0495684_0087236 | 3300047471 | Bacteria | 2365 |
| 216 | Ga0495602_0161421 | 3300048088 | Bacteria | 1749 |
| 217 | Ga0495602_0685117 | 3300048088 | Unclassified | 697 |
| 218 | Ga0496100_0410176 | 3300048903 | Bacteria | 1033 |
| 219 | Ga0496100_1138260 | 3300048903 | Bacteria | 615 |
| 220 | Ga0496101_0143648 | 3300048904 | Bacteria | 1821 |
| 221 | Ga0496101_0187693 | 3300048904 | Bacteria | 1594 |
| 222 | Ga0496102_0222385 | 3300048905 | Bacteria | 1780 |
| 223 | Ga0496102_0583342 | 3300048905 | Bacteria | 1041 |
| 224 | Ga0496103_0023090 | 3300048906 | Bacteria | 3750 |
| 225 | Ga0496104_0042284 | 3300048907 | Bacteria | 4275 |
| 226 | Ga0496104_0100000 | 3300048907 | Bacteria | 2776 |
| 227 | Ga0496104_0425038 | 3300048907 | Bacteria | 1240 |
| 228 | Ga0496105_0080548 | 3300048908 | Bacteria | 2690 |
| 229 | Ga0496106_0134256 | 3300048909 | Bacteria | 1942 |
| 230 | Ga0496106_0609376 | 3300048909 | Bacteria | 874 |
| 231 | Ga0496107_0026942 | 3300048910 | Bacteria | 4079 |
| 232 | Ga0496107_0476043 | 3300048910 | Bacteria | 927 |
| 233 | Ga0496108_0022664 | 3300048911 | Bacteria | 5165 |
| 234 | Ga0496109_0187408 | 3300048912 | Bacteria | 1944 |
| 235 | Ga0496109_0347388 | 3300048912 | Bacteria | 1401 |
| 236 | Ga0496110_0086389 | 3300048913 | Bacteria | 2801 |
| 237 | Ga0496110_0252807 | 3300048913 | Bacteria | 1604 |
| 238 | Ga0496112_0038584 | 3300048915 | Bacteria | 4664 |
| 239 | Ga0496112_1741428 | 3300048915 | Unclassified | 535 |
| 240 | Ga0496113_0003109 | 3300048916 | Bacteria | 9866 |
| 241 | Ga0496114_0277721 | 3300048917 | Bacteria | 1476 |
| 242 | Ga0496114_0319077 | 3300048917 | Bacteria | 1373 |
| 243 | Ga0496114_0915531 | 3300048917 | Bacteria | 758 |
| 244 | Ga0496115_0256899 | 3300048918 | Bacteria | 1437 |
| 245 | Ga0496115_0451540 | 3300048918 | Bacteria | 1038 |
| 246 | Ga0496115_0635628 | 3300048918 | Bacteria | 845 |
| 247 | Ga0496119_0003530 | 3300048922 | Bacteria | 16147 |
| 248 | Ga0496120_0037945 | 3300048923 | Bacteria | 2854 |
| 249 | Ga0496121_0108250 | 3300048924 | Bacteria | 2126 |
| 250 | Ga0496125_0005198 | 3300048928 | Bacteria | 14617 |
| 251 | Ga0496126_0128411 | 3300048929 | Bacteria | 2192 |
| 252 | Ga0501036_0628159 | 3300049572 | Unclassified | 890 |
| 253 | Ga0501040_0124597 | 3300049576 | Bacteria | 1810 |
| 254 | Ga0501041_0795671 | 3300049577 | Unclassified | 606 |
| 255 | Ga0501070_0645594 | 3300049586 | Bacteria | 841 |
| 256 | Ga0501071_1163358 | 3300049587 | Unclassified | 596 |
| 257 | Ga0501072_0440912 | 3300049588 | Unclassified | 1032 |
| 258 | Ga0501073_1237468 | 3300049589 | Bacteria | 512 |
| 259 | Ga0501074_0220336 | 3300049590 | Unclassified | 1351 |
| 260 | Ga0501075_0733473 | 3300049591 | Unclassified | 752 |
| 261 | Ga0501075_1387054 | 3300049591 | Unclassified | 532 |
| 262 | Ga0501076_1327119 | 3300049592 | Unclassified | 591 |
| 263 | Ga0501077_0100587 | 3300049593 | Bacteria | 1832 |
| 264 | Ga0501079_0634422 | 3300049741 | Unclassified | 841 |
| 265 | Ga0501081_1001428 | 3300049743 | Unclassified | 631 |
| 266 | nmdc:mga0k408_756419_c1 | 3300050493 | Bacteria | 567 |
| 267 | nmdc:mga09592_6317_c1 | 3300050508 | Bacteria | 9657 |
| 268 | nmdc:mga0qj67_32500_c1 | 3300050509 | Bacteria | 4069 |
| 269 | nmdc:mga06r32_3828_c1 | 3300050510 | Bacteria | 13475 |
| 270 | nmdc:mga0n895_147142_c1 | 3300050512 | Bacteria | 2385 |
| 271 | Ga0495601_0318594 | 3300053077 | Bacteria | 1012 |
| 272 | Ga0495601_0583473 | 3300053077 | Bacteria | 718 |
| 273 | Ga0495601_0823477 | 3300053077 | Unclassified | 589 |
| 274 | Ga0495612_0045397 | 3300053078 | Bacteria | 1798 |
| 275 | Ga0495595_0141574 | 3300053084 | Bacteria | 1180 |
| 276 | Ga0495619_0104865 | 3300053085 | Bacteria | 1927 |
| 277 | Ga0495619_0199860 | 3300053085 | Unclassified | 1384 |
| 278 | Ga0495619_0240549 | 3300053085 | Bacteria | 1254 |
| 279 | Ga0500647_0048715 | 3300053091 | Bacteria | 2037 |
| 280 | Ga0500566_0003744 | 3300053094 | Bacteria | 9080 |
| 281 | Ga0500648_354758 | 3300053097 | Unclassified | 595 |
| 282 | Ga0500572_000770 | 3300053111 | Bacteria | 10284 |
| 283 | Ga0500572_007265 | 3300053111 | Bacteria | 2563 |
| 284 | Ga0500591_142101 | 3300053115 | Unclassified | 945 |
| 285 | Ga0500608_066206 | 3300053122 | Bacteria | 1723 |
| 286 | Ga0500608_145901 | 3300053122 | Bacteria | 1043 |
| 287 | Ga0500614_097272 | 3300053123 | Unclassified | 844 |
| 288 | Ga0500559_0000466 | 3300053136 | Bacteria | 28794 |
| 289 | Ga0500559_0018380 | 3300053136 | Bacteria | 2954 |
| 290 | Ga0500603_003607 | 3300053150 | Bacteria | 3314 |
| 291 | Ga0500630_066170 | 3300053159 | Bacteria | 1718 |
| 292 | Ga0500638_058031 | 3300053162 | Bacteria | 1864 |
| 293 | Ga0500639_009420 | 3300053163 | Bacteria | 5104 |
| 294 | Ga0500639_018768 | 3300053163 | Bacteria | 3648 |
| 295 | Ga0500637_0370710 | 3300053178 | Unclassified | 754 |
| 296 | Ga0500576_190832 | 3300053725 | Unclassified | 710 |
| 297 | Ga0500596_004208 | 3300053735 | Bacteria | 2661 |
| 298 | Ga0500601_019704 | 3300053737 | Unclassified | 776 |
| 299 | Ga0501084_0573178 | 3300054114 | Unclassified | 954 |
| 300 | Ga0501082_0483614 | 3300060353 | Unclassified | 1082 |
| 301 | Ga0501082_0979532 | 3300060353 | Bacteria | 739 |
| 302 | Ga0530510_0008351 | 3300061734 | Bacteria | 7220 |
| 303 | Ga0530510_0090719 | 3300061734 | Bacteria | 2229 |
| 304 | Ga0530510_0430571 | 3300061734 | Bacteria | 996 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_102089348 | Ga0070714_1020893481 | 111 |
| 2 | 3300039450 | Ga0436363_0606097 | Ga0436363_0606097_86_433 | 114 |
| 3 | 3300035086 | Ga0373934_0023916 | Ga0373934_0023916_814_1215 | 115 |
| 4 | 3300035116 | Ga0373945_0284555 | Ga0373945_0284555_247_648 | 115 |
| 5 | 3300035117 | Ga0373953_0035850 | Ga0373953_0035850_1180_1581 | 115 |
| 6 | 3300035118 | Ga0373954_0529917 | Ga0373954_0529917_65_466 | 115 |
| 7 | 3300035692 | Ga0373935_0156881 | Ga0373935_0156881_666_1067 | 115 |
| 8 | 3300035724 | Ga0373933_0565409 | Ga0373933_0565409_288_689 | 115 |
| 9 | 3300036401 | Ga0373937_0000611 | Ga0373937_0000611_22531_22932 | 115 |
| 10 | 3300036401 | Ga0373937_0140518 | Ga0373937_0140518_504_905 | 115 |
| 11 | 3300046462 | Ga0495651_0265567 | Ga0495651_0265567_64_465 | 115 |
| 12 | 3300046463 | Ga0495653_0261140 | Ga0495653_0261140_248_649 | 115 |
| 13 | 3300046477 | Ga0495664_0547476 | Ga0495664_0547476_97_498 | 115 |
| 14 | 3300046516 | Ga0495628_0754950 | Ga0495628_0754950_51_452 | 115 |
| 15 | 3300046529 | Ga0495652_0206569 | Ga0495652_0206569_903_1304 | 115 |
| 16 | 3300046543 | Ga0495645_0713155 | Ga0495645_0713155_137_538 | 115 |
| 17 | 3300046559 | Ga0495667_0353668 | Ga0495667_0353668_288_689 | 115 |
| 18 | 3300046559 | Ga0495667_0480634 | Ga0495667_0480634_98_499 | 115 |
| 19 | 3300046642 | Ga0495634_0090336 | Ga0495634_0090336_79_480 | 115 |
| 20 | 3300047317 | Ga0495604_0121643 | Ga0495604_0121643_1009_1410 | 115 |
| 21 | 3300047322 | Ga0495680_0335141 | Ga0495680_0335141_306_707 | 115 |
| 22 | 3300047471 | Ga0495684_0087236 | Ga0495684_0087236_223_624 | 115 |
| 23 | 3300048088 | Ga0495602_0685117 | Ga0495602_0685117_55_459 | 115 |
| 24 | 3300053077 | Ga0495601_0583473 | Ga0495601_0583473_171_572 | 115 |
| 25 | 3300053085 | Ga0495619_0104865 | Ga0495619_0104865_760_1161 | 115 |
| 26 | 3300005445 | Ga0070708_100374866 | Ga0070708_1003748663 | 116 |
| 27 | 3300049577 | Ga0501041_0795671 | Ga0501041_0795671_118_519 | 116 |
| 28 | 3300013297 | Ga0157378_10694142 | Ga0157378_106941422 | 117 |
| 29 | 3300053091 | Ga0500647_0048715 | Ga0500647_0048715_51_452 | 117 |
| 30 | 3300053094 | Ga0500566_0003744 | Ga0500566_0003744_6991_7392 | 117 |
| 31 | 3300053097 | Ga0500648_354758 | Ga0500648_354758_144_545 | 117 |
| 32 | 3300053111 | Ga0500572_007265 | Ga0500572_007265_1221_1622 | 117 |
| 33 | 3300053115 | Ga0500591_142101 | Ga0500591_142101_231_632 | 117 |
| 34 | 3300053122 | Ga0500608_066206 | Ga0500608_066206_331_732 | 117 |
| 35 | 3300053123 | Ga0500614_097272 | Ga0500614_097272_360_761 | 117 |
| 36 | 3300053136 | Ga0500559_0018380 | Ga0500559_0018380_328_729 | 117 |
| 37 | 3300053150 | Ga0500603_003607 | Ga0500603_003607_2289_2690 | 117 |
| 38 | 3300053159 | Ga0500630_066170 | Ga0500630_066170_502_903 | 117 |
| 39 | 3300053162 | Ga0500638_058031 | Ga0500638_058031_1101_1502 | 117 |
| 40 | 3300053163 | Ga0500639_009420 | Ga0500639_009420_1814_2215 | 117 |
| 41 | 3300053178 | Ga0500637_0370710 | Ga0500637_0370710_232_633 | 117 |
| 42 | 3300053725 | Ga0500576_190832 | Ga0500576_190832_149_550 | 117 |
| 43 | 3300053737 | Ga0500601_019704 | Ga0500601_019704_145_546 | 117 |
| 44 | 3300005435 | Ga0070714_101868330 | Ga0070714_1018683301 | 118 |
| 45 | 3300025939 | Ga0207665_10160656 | Ga0207665_101606562 | 119 |
| 46 | 3300049589 | Ga0501073_1237468 | Ga0501073_1237468_15_428 | 120 |
| 47 | 3300037853 | Ga0436364_1401923 | Ga0436364_1401923_303_695 | 122 |
| 48 | 3300013307 | Ga0157372_10058995 | Ga0157372_100589953 | 123 |
| 49 | 3300021377 | Ga0213874_10040030 | Ga0213874_100400302 | 123 |
| 50 | 3300039450 | Ga0436363_0250208 | Ga0436363_0250208_516_911 | 123 |
| 51 | 3300048922 | Ga0496119_0003530 | Ga0496119_0003530_11852_12229 | 124 |
| 52 | 3300048923 | Ga0496120_0037945 | Ga0496120_0037945_1844_2221 | 124 |
| 53 | 3300048924 | Ga0496121_0108250 | Ga0496121_0108250_1499_1876 | 124 |
| 54 | 3300048928 | Ga0496125_0005198 | Ga0496125_0005198_5388_5765 | 124 |
| 55 | 3300048929 | Ga0496126_0128411 | Ga0496126_0128411_360_737 | 124 |
| 56 | 3300005539 | Ga0068853_100377649 | Ga0068853_1003776492 | 125 |
| 57 | 3300007788 | Ga0099795_10499829 | Ga0099795_104998291 | 125 |
| 58 | 3300009551 | Ga0105238_11422763 | Ga0105238_114227631 | 125 |
| 59 | 3300039438 | Ga0436360_1240312 | Ga0436360_1240312_12_392 | 125 |
| 60 | 3300050493 | nmdc:mga0k408_756419_c1 | nmdc:mga0k408_756419_c1_108_488 | 125 |
| 61 | 3300009098 | Ga0105245_11292264 | Ga0105245_112922642 | 126 |
| 62 | 3300005436 | Ga0070713_100709002 | Ga0070713_1007090022 | 127 |
| 63 | 3300005437 | Ga0070710_10398119 | Ga0070710_103981191 | 127 |
| 64 | 3300006175 | Ga0070712_101063060 | Ga0070712_1010630602 | 127 |
| 65 | 3300026041 | Ga0207639_10422876 | Ga0207639_104228762 | 127 |
| 66 | 3300031691 | Ga0316579_10226552 | Ga0316579_102265523 | 127 |
| 67 | 3300035172 | Ga0373955_0431922 | Ga0373955_0431922_281_679 | 127 |
| 68 | 3300047322 | Ga0495680_0349262 | Ga0495680_0349262_592_981 | 128 |
| 69 | 3300005719 | Ga0068861_101351259 | Ga0068861_1013512592 | 129 |
| 70 | 3300009553 | Ga0105249_12460170 | Ga0105249_124601701 | 129 |
| 71 | 3300005439 | Ga0070711_100342994 | Ga0070711_1003429943 | 130 |
| 72 | 3300006163 | Ga0070715_10668915 | Ga0070715_106689152 | 130 |
| 73 | 3300006175 | Ga0070712_100130855 | Ga0070712_1001308552 | 130 |
| 74 | 3300006844 | Ga0075428_100065811 | Ga0075428_1000658113 | 130 |
| 75 | 3300006846 | Ga0075430_100036091 | Ga0075430_1000360918 | 130 |
| 76 | 3300006847 | Ga0075431_100037255 | Ga0075431_1000372558 | 130 |
| 77 | 3300006880 | Ga0075429_100191095 | Ga0075429_1001910952 | 130 |
| 78 | 3300006931 | Ga0097620_101635058 | Ga0097620_1016350582 | 130 |
| 79 | 3300007788 | Ga0099795_10171600 | Ga0099795_101716002 | 130 |
| 80 | 3300009147 | Ga0114129_11454565 | Ga0114129_114545652 | 130 |
| 81 | 3300009551 | Ga0105238_10070585 | Ga0105238_100705853 | 130 |
| 82 | 3300010159 | Ga0099796_10119640 | Ga0099796_101196402 | 130 |
| 83 | 3300014325 | Ga0163163_11875728 | Ga0163163_118757282 | 130 |
| 84 | 3300014968 | Ga0157379_10298954 | Ga0157379_102989543 | 130 |
| 85 | 3300025898 | Ga0207692_10283376 | Ga0207692_102833762 | 130 |
| 86 | 3300025915 | Ga0207693_10043249 | Ga0207693_100432492 | 130 |
| 87 | 3300025916 | Ga0207663_11094357 | Ga0207663_110943572 | 130 |
| 88 | 3300025924 | Ga0207694_10443497 | Ga0207694_104434971 | 130 |
| 89 | 3300028380 | Ga0268265_12090378 | Ga0268265_120903781 | 130 |
| 90 | 3300035172 | Ga0373955_0498631 | Ga0373955_0498631_302_697 | 130 |
| 91 | 3300035695 | Ga0373927_0064012 | Ga0373927_0064012_759_1154 | 130 |
| 92 | 3300037853 | Ga0436364_0951384 | Ga0436364_0951384_1204_1599 | 130 |
| 93 | 3300039437 | Ga0436365_0607713 | Ga0436365_0607713_13_408 | 130 |
| 94 | 3300039437 | Ga0436365_1053035 | Ga0436365_1053035_1562_1960 | 130 |
| 95 | 3300039438 | Ga0436360_1360743 | Ga0436360_1360743_62_457 | 130 |
| 96 | 3300046514 | Ga0495618_0204787 | Ga0495618_0204787_277_672 | 130 |
| 97 | 3300046531 | Ga0495665_0040485 | Ga0495665_0040485_1324_1719 | 130 |
| 98 | 3300046663 | Ga0495635_0423700 | Ga0495635_0423700_428_823 | 130 |
| 99 | 3300047315 | Ga0495581_0180590 | Ga0495581_0180590_104_499 | 130 |
| 100 | 3300047471 | Ga0495684_0056478 | Ga0495684_0056478_1862_2257 | 130 |
| 101 | 3300048915 | Ga0496112_1741428 | Ga0496112_1741428_43_438 | 130 |
| 102 | 3300049572 | Ga0501036_0628159 | Ga0501036_0628159_177_572 | 130 |
| 103 | 3300049587 | Ga0501071_1163358 | Ga0501071_1163358_81_476 | 130 |
| 104 | 3300049588 | Ga0501072_0440912 | Ga0501072_0440912_621_1016 | 130 |
| 105 | 3300049590 | Ga0501074_0220336 | Ga0501074_0220336_485_880 | 130 |
| 106 | 3300049591 | Ga0501075_0733473 | Ga0501075_0733473_275_670 | 130 |
| 107 | 3300049591 | Ga0501075_1387054 | Ga0501075_1387054_33_431 | 130 |
| 108 | 3300049592 | Ga0501076_1327119 | Ga0501076_1327119_93_488 | 130 |
| 109 | 3300049593 | Ga0501077_0100587 | Ga0501077_0100587_1100_1495 | 130 |
| 110 | 3300049741 | Ga0501079_0634422 | Ga0501079_0634422_296_691 | 130 |
| 111 | 3300049743 | Ga0501081_1001428 | Ga0501081_1001428_147_542 | 130 |
| 112 | 3300050508 | nmdc:mga09592_6317_c1 | nmdc:mga09592_6317_c1_8279_8674 | 130 |
| 113 | 3300050509 | nmdc:mga0qj67_32500_c1 | nmdc:mga0qj67_32500_c1_1225_1620 | 130 |
| 114 | 3300050510 | nmdc:mga06r32_3828_c1 | nmdc:mga06r32_3828_c1_6681_7076 | 130 |
| 115 | 3300054114 | Ga0501084_0573178 | Ga0501084_0573178_207_602 | 130 |
| 116 | 3300060353 | Ga0501082_0483614 | Ga0501082_0483614_379_774 | 130 |
| 117 | 3300060353 | Ga0501082_0979532 | Ga0501082_0979532_243_641 | 130 |
| 118 | 3300061734 | Ga0530510_0008351 | Ga0530510_0008351_1074_1469 | 130 |
| 119 | 3300061734 | Ga0530510_0090719 | Ga0530510_0090719_22_417 | 130 |
| 120 | 3300061734 | Ga0530510_0430571 | Ga0530510_0430571_443_841 | 130 |
| 121 | 3300005434 | Ga0070709_10777319 | Ga0070709_107773192 | 131 |
| 122 | 3300005437 | Ga0070710_10086228 | Ga0070710_100862282 | 131 |
| 123 | 3300005458 | Ga0070681_10495662 | Ga0070681_104956622 | 131 |
| 124 | 3300005530 | Ga0070679_100313692 | Ga0070679_1003136922 | 131 |
| 125 | 3300005563 | Ga0068855_100592973 | Ga0068855_1005929731 | 131 |
| 126 | 3300005981 | Ga0081538_10061909 | Ga0081538_100619094 | 131 |
| 127 | 3300009093 | Ga0105240_12055944 | Ga0105240_120559442 | 131 |
| 128 | 3300025898 | Ga0207692_10044560 | Ga0207692_100445603 | 131 |
| 129 | 3300025912 | Ga0207707_10048565 | Ga0207707_100485655 | 131 |
| 130 | 3300025921 | Ga0207652_10091867 | Ga0207652_100918674 | 131 |
| 131 | 3300025929 | Ga0207664_10075834 | Ga0207664_100758345 | 131 |
| 132 | 3300035114 | Ga0373939_0002944 | Ga0373939_0002944_2125_2523 | 131 |
| 133 | 3300046477 | Ga0495664_0076576 | Ga0495664_0076576_1145_1543 | 131 |
| 134 | 3300046543 | Ga0495645_0038372 | Ga0495645_0038372_2089_2487 | 131 |
| 135 | 3300050512 | nmdc:mga0n895_147142_c1 | nmdc:mga0n895_147142_c1_635_1033 | 131 |
| 136 | 3300053078 | Ga0495612_0045397 | Ga0495612_0045397_194_592 | 131 |
| 137 | 3300003659 | JGI25404J52841_10009365 | JGI25404J52841_100093654 | 132 |
| 138 | 3300005330 | Ga0070690_101718979 | Ga0070690_1017189791 | 132 |
| 139 | 3300005334 | Ga0068869_101225159 | Ga0068869_1012251592 | 132 |
| 140 | 3300005338 | Ga0068868_100911987 | Ga0068868_1009119872 | 132 |
| 141 | 3300005340 | Ga0070689_100198632 | Ga0070689_1001986323 | 132 |
| 142 | 3300005355 | Ga0070671_100412763 | Ga0070671_1004127633 | 132 |
| 143 | 3300005356 | Ga0070674_100351746 | Ga0070674_1003517461 | 132 |
| 144 | 3300005367 | Ga0070667_101950171 | Ga0070667_1019501711 | 132 |
| 145 | 3300005434 | Ga0070709_11077723 | Ga0070709_110777231 | 132 |
| 146 | 3300005435 | Ga0070714_100842078 | Ga0070714_1008420781 | 132 |
| 147 | 3300005436 | Ga0070713_100746970 | Ga0070713_1007469702 | 132 |
| 148 | 3300005436 | Ga0070713_100988784 | Ga0070713_1009887842 | 132 |
| 149 | 3300005437 | Ga0070710_11543529 | Ga0070710_115435291 | 132 |
| 150 | 3300005539 | Ga0068853_100803649 | Ga0068853_1008036492 | 132 |
| 151 | 3300005544 | Ga0070686_100211025 | Ga0070686_1002110253 | 132 |
| 152 | 3300005544 | Ga0070686_100718858 | Ga0070686_1007188581 | 132 |
| 153 | 3300005614 | Ga0068856_100453966 | Ga0068856_1004539662 | 132 |
| 154 | 3300005616 | Ga0068852_100187319 | Ga0068852_1001873193 | 132 |
| 155 | 3300005618 | Ga0068864_101315392 | Ga0068864_1013153922 | 132 |
| 156 | 3300005718 | Ga0068866_10098578 | Ga0068866_100985781 | 132 |
| 157 | 3300005842 | Ga0068858_100595687 | Ga0068858_1005956872 | 132 |
| 158 | 3300005937 | Ga0081455_10444893 | Ga0081455_104448932 | 132 |
| 159 | 3300005983 | Ga0081540_1008711 | Ga0081540_10087113 | 132 |
| 160 | 3300005983 | Ga0081540_1064336 | Ga0081540_10643362 | 132 |
| 161 | 3300006163 | Ga0070715_10133154 | Ga0070715_101331542 | 132 |
| 162 | 3300006175 | Ga0070712_101262834 | Ga0070712_1012628341 | 132 |
| 163 | 3300006237 | Ga0097621_100228706 | Ga0097621_1002287062 | 132 |
| 164 | 3300006358 | Ga0068871_100914141 | Ga0068871_1009141412 | 132 |
| 165 | 3300007265 | Ga0099794_10018243 | Ga0099794_100182435 | 132 |
| 166 | 3300007788 | Ga0099795_10021264 | Ga0099795_100212642 | 132 |
| 167 | 3300007788 | Ga0099795_10046333 | Ga0099795_100463332 | 132 |
| 168 | 3300007788 | Ga0099795_10540752 | Ga0099795_105407521 | 132 |
| 169 | 3300009093 | Ga0105240_10287451 | Ga0105240_102874513 | 132 |
| 170 | 3300009147 | Ga0114129_11336154 | Ga0114129_113361542 | 132 |
| 171 | 3300009147 | Ga0114129_12267986 | Ga0114129_122679862 | 132 |
| 172 | 3300009176 | Ga0105242_10221986 | Ga0105242_102219863 | 132 |
| 173 | 3300009177 | Ga0105248_10186799 | Ga0105248_101867993 | 132 |
| 174 | 3300009177 | Ga0105248_12182999 | Ga0105248_121829991 | 132 |
| 175 | 3300009545 | Ga0105237_10345124 | Ga0105237_103451242 | 132 |
| 176 | 3300009545 | Ga0105237_10834377 | Ga0105237_108343771 | 132 |
| 177 | 3300009551 | Ga0105238_10461615 | Ga0105238_104616153 | 132 |
| 178 | 3300009553 | Ga0105249_11850105 | Ga0105249_118501052 | 132 |
| 179 | 3300010159 | Ga0099796_10174559 | Ga0099796_101745591 | 132 |
| 180 | 3300010375 | Ga0105239_10066442 | Ga0105239_100664423 | 132 |
| 181 | 3300011119 | Ga0105246_11074887 | Ga0105246_110748872 | 132 |
| 182 | 3300013297 | Ga0157378_11219507 | Ga0157378_112195071 | 132 |
| 183 | 3300013306 | Ga0163162_10590911 | Ga0163162_105909111 | 132 |
| 184 | 3300013308 | Ga0157375_10501401 | Ga0157375_105014012 | 132 |
| 185 | 3300013308 | Ga0157375_12892203 | Ga0157375_128922031 | 132 |
| 186 | 3300014326 | Ga0157380_10894013 | Ga0157380_108940132 | 132 |
| 187 | 3300014968 | Ga0157379_10323798 | Ga0157379_103237982 | 132 |
| 188 | 3300014968 | Ga0157379_11949556 | Ga0157379_119495561 | 132 |
| 189 | 3300014969 | Ga0157376_10260544 | Ga0157376_102605441 | 132 |
| 190 | 3300015265 | Ga0182005_1064297 | Ga0182005_10642972 | 132 |
| 191 | 3300017792 | Ga0163161_10401167 | Ga0163161_104011672 | 132 |
| 192 | 3300020070 | Ga0206356_10768386 | Ga0206356_107683862 | 132 |
| 193 | 3300021388 | Ga0213875_10000007 | Ga0213875_1000000791 | 132 |
| 194 | 3300021441 | Ga0213871_10076355 | Ga0213871_100763553 | 132 |
| 195 | 3300024225 | Ga0224572_1000526 | Ga0224572_10005264 | 132 |
| 196 | 3300024227 | Ga0228598_1005907 | Ga0228598_10059073 | 132 |
| 197 | 3300025915 | Ga0207693_10600531 | Ga0207693_106005312 | 132 |
| 198 | 3300025921 | Ga0207652_11469482 | Ga0207652_114694821 | 132 |
| 199 | 3300025924 | Ga0207694_10158540 | Ga0207694_101585403 | 132 |
| 200 | 3300025928 | Ga0207700_10468772 | Ga0207700_104687722 | 132 |
| 201 | 3300025929 | Ga0207664_10360214 | Ga0207664_103602142 | 132 |
| 202 | 3300025934 | Ga0207686_10154405 | Ga0207686_101544053 | 132 |
| 203 | 3300025936 | Ga0207670_10528997 | Ga0207670_105289972 | 132 |
| 204 | 3300025941 | Ga0207711_10604612 | Ga0207711_106046122 | 132 |
| 205 | 3300025986 | Ga0207658_10495115 | Ga0207658_104951153 | 132 |
| 206 | 3300026023 | Ga0207677_10273018 | Ga0207677_102730182 | 132 |
| 207 | 3300026078 | Ga0207702_10284639 | Ga0207702_102846392 | 132 |
| 208 | 3300026142 | Ga0207698_10430332 | Ga0207698_104303322 | 132 |
| 209 | 3300027512 | Ga0209179_1006209 | Ga0209179_10062092 | 132 |
| 210 | 3300028381 | Ga0268264_10850171 | Ga0268264_108501712 | 132 |
| 211 | 3300028800 | Ga0265338_10005513 | Ga0265338_100055134 | 132 |
| 212 | 3300030763 | Ga0265763_1005552 | Ga0265763_10055522 | 132 |
| 213 | 3300030878 | Ga0265770_1130552 | Ga0265770_11305521 | 132 |
| 214 | 3300031090 | Ga0265760_10015549 | Ga0265760_100155493 | 132 |
| 215 | 3300031241 | Ga0265325_10093701 | Ga0265325_100937012 | 132 |
| 216 | 3300031249 | Ga0265339_10000126 | Ga0265339_1000012627 | 132 |
| 217 | 3300031250 | Ga0265331_10027344 | Ga0265331_100273442 | 132 |
| 218 | 3300031595 | Ga0265313_10000844 | Ga0265313_1000084426 | 132 |
| 219 | 3300031616 | Ga0307508_10015607 | Ga0307508_100156076 | 132 |
| 220 | 3300031712 | Ga0265342_10026554 | Ga0265342_100265547 | 132 |
| 221 | 3300033179 | Ga0307507_10500502 | Ga0307507_105005021 | 132 |
| 222 | 3300033544 | Ga0316215_1031735 | Ga0316215_10317351 | 132 |
| 223 | 3300034816 | Ga0373930_0035963 | Ga0373930_0035963_483_884 | 132 |
| 224 | 3300034957 | Ga0373938_0022603 | Ga0373938_0022603_626_1027 | 132 |
| 225 | 3300034957 | Ga0373938_0083973 | Ga0373938_0083973_110_511 | 132 |
| 226 | 3300035084 | Ga0373928_0145175 | Ga0373928_0145175_127_528 | 132 |
| 227 | 3300035085 | Ga0373929_0005279 | Ga0373929_0005279_1707_2108 | 132 |
| 228 | 3300035091 | Ga0373951_0040551 | Ga0373951_0040551_122_523 | 132 |
| 229 | 3300035114 | Ga0373939_0046986 | Ga0373939_0046986_460_861 | 132 |
| 230 | 3300035115 | Ga0373941_0168740 | Ga0373941_0168740_340_741 | 132 |
| 231 | 3300035115 | Ga0373941_0212320 | Ga0373941_0212320_212_613 | 132 |
| 232 | 3300035116 | Ga0373945_0306932 | Ga0373945_0306932_126_527 | 132 |
| 233 | 3300035170 | Ga0373943_0127945 | Ga0373943_0127945_330_731 | 132 |
| 234 | 3300035172 | Ga0373955_0436960 | Ga0373955_0436960_72_473 | 132 |
| 235 | 3300035241 | Ga0373961_0159293 | Ga0373961_0159293_248_649 | 132 |
| 236 | 3300035242 | Ga0373962_0364639 | Ga0373962_0364639_107_508 | 132 |
| 237 | 3300035691 | Ga0373931_0001430 | Ga0373931_0001430_1892_2293 | 132 |
| 238 | 3300035691 | Ga0373931_0075858 | Ga0373931_0075858_720_1121 | 132 |
| 239 | 3300035695 | Ga0373927_0198785 | Ga0373927_0198785_376_777 | 132 |
| 240 | 3300036401 | Ga0373937_0772039 | Ga0373937_0772039_34_435 | 132 |
| 241 | 3300037068 | Ga0373925_0161560 | Ga0373925_0161560_320_721 | 132 |
| 242 | 3300037853 | Ga0436364_0461857 | Ga0436364_0461857_1896_2294 | 132 |
| 243 | 3300039437 | Ga0436365_1549035 | Ga0436365_1549035_54_455 | 132 |
| 244 | 3300039438 | Ga0436360_0955792 | Ga0436360_0955792_1350_1757 | 132 |
| 245 | 3300046459 | Ga0495629_0374063 | Ga0495629_0374063_372_773 | 132 |
| 246 | 3300046463 | Ga0495653_0689107 | Ga0495653_0689107_135_536 | 132 |
| 247 | 3300046491 | Ga0495584_0264265 | Ga0495584_0264265_228_629 | 132 |
| 248 | 3300046491 | Ga0495584_0482455 | Ga0495584_0482455_179_580 | 132 |
| 249 | 3300046518 | Ga0495631_0319483 | Ga0495631_0319483_231_632 | 132 |
| 250 | 3300046523 | Ga0495644_0090797 | Ga0495644_0090797_637_1038 | 132 |
| 251 | 3300046529 | Ga0495652_0791083 | Ga0495652_0791083_101_502 | 132 |
| 252 | 3300046531 | Ga0495665_0657498 | Ga0495665_0657498_41_442 | 132 |
| 253 | 3300046533 | Ga0495640_0521314 | Ga0495640_0521314_234_635 | 132 |
| 254 | 3300046536 | Ga0495587_0174080 | Ga0495587_0174080_386_787 | 132 |
| 255 | 3300046559 | Ga0495667_0417799 | Ga0495667_0417799_415_816 | 132 |
| 256 | 3300046678 | Ga0495599_0137593 | Ga0495599_0137593_437_838 | 132 |
| 257 | 3300046684 | Ga0495669_0516598 | Ga0495669_0516598_108_506 | 132 |
| 258 | 3300046691 | Ga0495670_0560253 | Ga0495670_0560253_73_474 | 132 |
| 259 | 3300047317 | Ga0495604_0222783 | Ga0495604_0222783_132_533 | 132 |
| 260 | 3300047319 | Ga0495674_0063264 | Ga0495674_0063264_2179_2580 | 132 |
| 261 | 3300047323 | Ga0495683_0251797 | Ga0495683_0251797_44_442 | 132 |
| 262 | 3300047444 | Ga0495675_0165614 | Ga0495675_0165614_789_1190 | 132 |
| 263 | 3300047445 | Ga0495677_0300643 | Ga0495677_0300643_160_561 | 132 |
| 264 | 3300048088 | Ga0495602_0161421 | Ga0495602_0161421_178_579 | 132 |
| 265 | 3300048903 | Ga0496100_0410176 | Ga0496100_0410176_453_854 | 132 |
| 266 | 3300048903 | Ga0496100_1138260 | Ga0496100_1138260_129_530 | 132 |
| 267 | 3300048904 | Ga0496101_0143648 | Ga0496101_0143648_167_568 | 132 |
| 268 | 3300048904 | Ga0496101_0187693 | Ga0496101_0187693_755_1156 | 132 |
| 269 | 3300048905 | Ga0496102_0222385 | Ga0496102_0222385_512_913 | 132 |
| 270 | 3300048905 | Ga0496102_0583342 | Ga0496102_0583342_112_513 | 132 |
| 271 | 3300048906 | Ga0496103_0023090 | Ga0496103_0023090_1962_2363 | 132 |
| 272 | 3300048907 | Ga0496104_0042284 | Ga0496104_0042284_1687_2088 | 132 |
| 273 | 3300048907 | Ga0496104_0100000 | Ga0496104_0100000_1844_2245 | 132 |
| 274 | 3300048907 | Ga0496104_0425038 | Ga0496104_0425038_329_730 | 132 |
| 275 | 3300048908 | Ga0496105_0080548 | Ga0496105_0080548_2039_2440 | 132 |
| 276 | 3300048909 | Ga0496106_0134256 | Ga0496106_0134256_1429_1830 | 132 |
| 277 | 3300048909 | Ga0496106_0609376 | Ga0496106_0609376_230_631 | 132 |
| 278 | 3300048910 | Ga0496107_0026942 | Ga0496107_0026942_139_540 | 132 |
| 279 | 3300048910 | Ga0496107_0476043 | Ga0496107_0476043_233_634 | 132 |
| 280 | 3300048911 | Ga0496108_0022664 | Ga0496108_0022664_4119_4520 | 132 |
| 281 | 3300048912 | Ga0496109_0187408 | Ga0496109_0187408_512_913 | 132 |
| 282 | 3300048912 | Ga0496109_0347388 | Ga0496109_0347388_376_777 | 132 |
| 283 | 3300048913 | Ga0496110_0086389 | Ga0496110_0086389_1612_2013 | 132 |
| 284 | 3300048913 | Ga0496110_0252807 | Ga0496110_0252807_692_1093 | 132 |
| 285 | 3300048915 | Ga0496112_0038584 | Ga0496112_0038584_2696_3097 | 132 |
| 286 | 3300048916 | Ga0496113_0003109 | Ga0496113_0003109_2234_2635 | 132 |
| 287 | 3300048917 | Ga0496114_0277721 | Ga0496114_0277721_759_1160 | 132 |
| 288 | 3300048917 | Ga0496114_0319077 | Ga0496114_0319077_516_917 | 132 |
| 289 | 3300048917 | Ga0496114_0915531 | Ga0496114_0915531_48_449 | 132 |
| 290 | 3300048918 | Ga0496115_0256899 | Ga0496115_0256899_705_1106 | 132 |
| 291 | 3300048918 | Ga0496115_0451540 | Ga0496115_0451540_450_851 | 132 |
| 292 | 3300048918 | Ga0496115_0635628 | Ga0496115_0635628_326_727 | 132 |
| 293 | 3300049576 | Ga0501040_0124597 | Ga0501040_0124597_755_1153 | 132 |
| 294 | 3300049586 | Ga0501070_0645594 | Ga0501070_0645594_140_541 | 132 |
| 295 | 3300053077 | Ga0495601_0318594 | Ga0495601_0318594_59_460 | 132 |
| 296 | 3300053077 | Ga0495601_0823477 | Ga0495601_0823477_154_558 | 132 |
| 297 | 3300053084 | Ga0495595_0141574 | Ga0495595_0141574_454_855 | 132 |
| 298 | 3300053085 | Ga0495619_0199860 | Ga0495619_0199860_889_1293 | 132 |
| 299 | 3300053085 | Ga0495619_0240549 | Ga0495619_0240549_812_1213 | 132 |
| 300 | 3300053111 | Ga0500572_000770 | Ga0500572_000770_1727_2128 | 132 |
| 301 | 3300053122 | Ga0500608_145901 | Ga0500608_145901_491_892 | 132 |
| 302 | 3300053136 | Ga0500559_0000466 | Ga0500559_0000466_13881_14282 | 132 |
| 303 | 3300053163 | Ga0500639_018768 | Ga0500639_018768_2170_2571 | 132 |
| 304 | 3300053735 | Ga0500596_004208 | Ga0500596_004208_1482_1883 | 132 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3op9-assembly1.cif.gz_A | crystal structure of transcriptional regulator from listeria innocua | 0.8792 | 57 | 116 |
| 2icp-assembly1.cif.gz_A | crystal structure of the bacterial antitoxin higa from escherichia coli at ph 4.0. northeast structural genomics consortium target er390. | 0.8535 | 57 | 106 |
| 4yba-assembly1.cif.gz_A | the structure of the c.kpn2i controller protein | 0.8416 | 59 | 109 |
| 3jxc-assembly1.cif.gz_L | crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ | 0.8342 | 56 | 116 |
| 2ict-assembly1.cif.gz_A | crystal structure of the bacterial antitoxin higa from escherichia coli at ph 8.5. northeast structural genomics target er390. | 0.8323 | 55 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3op9A01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.857 | 57 | 116 | 1.10.260.40 |
| 4ybaA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8416 | 59 | 109 | 1.10.260.40 |
| 3jxbD00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8365 | 56 | 116 | 1.10.260.40 |
| 2r1jL00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8315 | 56 | 116 | 1.10.260.40 |
| 1adrA00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8297 | 53 | 115 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-E6QNZ6-F1-model_v4 | Putative DNA-binding transcriptional regulator | 0.9816 | 63 | 116 |
GO:0003677
|
| AF-E6QNZ6-F1-model_v4 | Putative DNA-binding transcriptional regulator | 0.9473 | 63 | 116 |
GO:0003677
|
| AF-A0A2V9GTB9-F1-model_v4 | Transcriptional regulator | 0.9462 | 56 | 116 |
GO:0001046
GO:0006355 |
| AF-A0A1J5Q6A4-F1-model_v4 | Antitoxin HigA | 0.9422 | 53 | 116 |
GO:0001046
GO:0006355 |
| AF-A0A6I7WRQ1-F1-model_v4 | Transcriptional regulator | 0.931 | 59 | 118 |
GO:0001046
GO:0006355 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar