F397820

General Info

Members Datasets Scaffolds Average Seq Length
304 214 304 130

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0199860|Ga0495619_0199860_889_1293
Length 134
Sequence MDATMILIDSDAELARARALVDRLWDSNDPADIARLEAQARLIAAYEELKWPRGQPPSIADLIRHLMDQYGLTRADMVPILGTPSRVSEVLRGKKGLSMAMMQRLRARFRVPADLLLPPPKKAQARRGTKGVAA

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
65 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
66 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
93 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
102 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
103 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
104 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
105 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
150 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
201 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
202 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
205 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
206 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
207 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
208 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
209 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
210 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
211 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 9.54
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10009365 3300003659 Bacteria 2093
2 Ga0070690_101718979 3300005330 Unclassified 510
3 Ga0068869_101225159 3300005334 Unclassified 660
4 Ga0068868_100911987 3300005338 Bacteria 799
5 Ga0070689_100198632 3300005340 Bacteria 1636
6 Ga0070671_100412763 3300005355 Bacteria 1156
7 Ga0070674_100351746 3300005356 Bacteria 1190
8 Ga0070667_101950171 3300005367 Unclassified 553
9 Ga0070709_10777319 3300005434 Unclassified 750
10 Ga0070709_11077723 3300005434 Bacteria 642
11 Ga0070714_100842078 3300005435 Bacteria 889
12 Ga0070714_101868330 3300005435 Bacteria 586
13 Ga0070714_102089348 3300005435 Bacteria 552
14 Ga0070713_100709002 3300005436 Bacteria 961
15 Ga0070713_100746970 3300005436 Bacteria 936
16 Ga0070713_100988784 3300005436 Unclassified 811
17 Ga0070710_10086228 3300005437 Bacteria 1843
18 Ga0070710_10398119 3300005437 Bacteria 922
19 Ga0070710_11543529 3300005437 Unclassified 500
20 Ga0070711_100342994 3300005439 Unclassified 1199
21 Ga0070708_100374866 3300005445 Bacteria 1342
22 Ga0070681_10495662 3300005458 Bacteria 1135
23 Ga0070679_100313692 3300005530 Bacteria 1518
24 Ga0068853_100377649 3300005539 Bacteria 1323
25 Ga0068853_100803649 3300005539 Bacteria 901
26 Ga0070686_100211025 3300005544 Bacteria 1398
27 Ga0070686_100718858 3300005544 Bacteria 798
28 Ga0068855_100592973 3300005563 Bacteria 1196
29 Ga0068856_100453966 3300005614 Bacteria 1303
30 Ga0068852_100187319 3300005616 Bacteria 1950
31 Ga0068864_101315392 3300005618 Bacteria 723
32 Ga0068866_10098578 3300005718 Bacteria 1607
33 Ga0068861_101351259 3300005719 Unclassified 694
34 Ga0068858_100595687 3300005842 Bacteria 1072
35 Ga0081455_10444893 3300005937 Unclassified 887
36 Ga0081538_10061909 3300005981 Bacteria 2138
37 Ga0081540_1008711 3300005983 Bacteria 7061
38 Ga0081540_1064336 3300005983 Bacteria 1731
39 Ga0070715_10133154 3300006163 Bacteria 1199
40 Ga0070715_10668915 3300006163 Bacteria 617
41 Ga0070712_100130855 3300006175 Bacteria 1901
42 Ga0070712_101063060 3300006175 Bacteria 702
43 Ga0070712_101262834 3300006175 Bacteria 643
44 Ga0097621_100228706 3300006237 Bacteria 1623
45 Ga0068871_100914141 3300006358 Unclassified 814
46 Ga0075428_100065811 3300006844 Bacteria 3969
47 Ga0075430_100036091 3300006846 Bacteria 4192
48 Ga0075431_100037255 3300006847 Bacteria 5012
49 Ga0075429_100191095 3300006880 Unclassified 1794
50 Ga0097620_101635058 3300006931 Bacteria 711
51 Ga0099794_10018243 3300007265 Bacteria 3144
52 Ga0099795_10021264 3300007788 Bacteria 2125
53 Ga0099795_10046333 3300007788 Bacteria 1566
54 Ga0099795_10171600 3300007788 Bacteria 901
55 Ga0099795_10499829 3300007788 Unclassified 567
56 Ga0099795_10540752 3300007788 Unclassified 548
57 Ga0105240_10287451 3300009093 Bacteria 1886
58 Ga0105240_12055944 3300009093 Bacteria 593
59 Ga0105245_11292264 3300009098 Bacteria 778
60 Ga0114129_11336154 3300009147 Unclassified 887
61 Ga0114129_11454565 3300009147 Bacteria 844
62 Ga0114129_12267986 3300009147 Bacteria 652
63 Ga0105242_10221986 3300009176 Bacteria 1689
64 Ga0105248_10186799 3300009177 Bacteria 2335
65 Ga0105248_12182999 3300009177 Unclassified 630
66 Ga0105237_10345124 3300009545 Bacteria 1493
67 Ga0105237_10834377 3300009545 Bacteria 928
68 Ga0105238_10070585 3300009551 Bacteria 3492
69 Ga0105238_10461615 3300009551 Bacteria 1268
70 Ga0105238_11422763 3300009551 Bacteria 721
71 Ga0105249_11850105 3300009553 Bacteria 676
72 Ga0105249_12460170 3300009553 Bacteria 593
73 Ga0099796_10119640 3300010159 Bacteria 1011
74 Ga0099796_10174559 3300010159 Bacteria 859
75 Ga0105239_10066442 3300010375 Bacteria 3961
76 Ga0105246_11074887 3300011119 Bacteria 733
77 Ga0157378_10694142 3300013297 Bacteria 1037
78 Ga0157378_11219507 3300013297 Bacteria 792
79 Ga0163162_10590911 3300013306 Bacteria 1237
80 Ga0157372_10058995 3300013307 Bacteria 4291
81 Ga0157375_10501401 3300013308 Bacteria 1378
82 Ga0157375_12892203 3300013308 Bacteria 574
83 Ga0163163_11875728 3300014325 Unclassified 659
84 Ga0157380_10894013 3300014326 Bacteria 914
85 Ga0157379_10298954 3300014968 Unclassified 1467
86 Ga0157379_10323798 3300014968 Bacteria 1407
87 Ga0157379_11949556 3300014968 Unclassified 580
88 Ga0157376_10260544 3300014969 Bacteria 1624
89 Ga0182005_1064297 3300015265 Bacteria 1003
90 Ga0163161_10401167 3300017792 Bacteria 1099
91 Ga0206356_10768386 3300020070 Bacteria 607
92 Ga0213874_10040030 3300021377 Bacteria 1398
93 Ga0213875_10000007 3300021388 Bacteria 562717
94 Ga0213871_10076355 3300021441 Bacteria 954
95 Ga0224572_1000526 3300024225 Bacteria 4636
96 Ga0228598_1005907 3300024227 Bacteria 2544
97 Ga0207692_10044560 3300025898 Bacteria 2214
98 Ga0207692_10283376 3300025898 Bacteria 1003
99 Ga0207707_10048565 3300025912 Bacteria 3697
100 Ga0207693_10043249 3300025915 Bacteria 3544
101 Ga0207693_10600531 3300025915 Bacteria 857
102 Ga0207663_11094357 3300025916 Bacteria 640
103 Ga0207652_10091867 3300025921 Bacteria 2669
104 Ga0207652_11469482 3300025921 Bacteria 585
105 Ga0207694_10158540 3300025924 Bacteria 1827
106 Ga0207694_10443497 3300025924 Bacteria 1083
107 Ga0207700_10468772 3300025928 Bacteria 1112
108 Ga0207664_10075834 3300025929 Bacteria 2720
109 Ga0207664_10360214 3300025929 Bacteria 1288
110 Ga0207686_10154405 3300025934 Bacteria 1602
111 Ga0207670_10528997 3300025936 Unclassified 961
112 Ga0207665_10160656 3300025939 Bacteria 1616
113 Ga0207711_10604612 3300025941 Bacteria 1023
114 Ga0207658_10495115 3300025986 Bacteria 1088
115 Ga0207677_10273018 3300026023 Bacteria 1384
116 Ga0207639_10422876 3300026041 Bacteria 1205
117 Ga0207702_10284639 3300026078 Bacteria 1564
118 Ga0207698_10430332 3300026142 Bacteria 1269
119 Ga0209179_1006209 3300027512 Bacteria 1913
120 Ga0268265_12090378 3300028380 Unclassified 573
121 Ga0268264_10850171 3300028381 Bacteria 914
122 Ga0265338_10005513 3300028800 Bacteria 16493
123 Ga0265763_1005552 3300030763 Bacteria 1061
124 Ga0265770_1130552 3300030878 Bacteria 536
125 Ga0265760_10015549 3300031090 Bacteria 2181
126 Ga0265325_10093701 3300031241 Bacteria 1477
127 Ga0265339_10000126 3300031249 Bacteria 63942
128 Ga0265331_10027344 3300031250 Plasmid 2860
129 Ga0265313_10000844 3300031595 Bacteria 30856
130 Ga0307508_10015607 3300031616 Bacteria 6920
131 Ga0316579_10226552 3300031691 Bacteria 904
132 Ga0265342_10026554 3300031712 Bacteria 3626
133 Ga0307507_10500502 3300033179 Bacteria 655
134 Ga0316215_1031735 3300033544 Bacteria 549
135 Ga0373930_0035963 3300034816 Bacteria 1037
136 Ga0373938_0022603 3300034957 Bacteria 1286
137 Ga0373938_0083973 3300034957 Bacteria 779
138 Ga0373928_0145175 3300035084 Bacteria 653
139 Ga0373929_0005279 3300035085 Bacteria 2322
140 Ga0373934_0023916 3300035086 Bacteria 2362
141 Ga0373951_0040551 3300035091 Unclassified 1122
142 Ga0373939_0002944 3300035114 Bacteria 4002
143 Ga0373939_0046986 3300035114 Bacteria 1324
144 Ga0373941_0168740 3300035115 Bacteria 814
145 Ga0373941_0212320 3300035115 Bacteria 740
146 Ga0373945_0284555 3300035116 Bacteria 705
147 Ga0373945_0306932 3300035116 Bacteria 681
148 Ga0373953_0035850 3300035117 Bacteria 1951
149 Ga0373954_0529917 3300035118 Unclassified 584
150 Ga0373943_0127945 3300035170 Bacteria 1357
151 Ga0373955_0431922 3300035172 Unclassified 802
152 Ga0373955_0436960 3300035172 Unclassified 797
153 Ga0373955_0498631 3300035172 Bacteria 744
154 Ga0373961_0159293 3300035241 Unclassified 774
155 Ga0373962_0364639 3300035242 Unclassified 525
156 Ga0373931_0001430 3300035691 Bacteria 10240
157 Ga0373931_0075858 3300035691 Bacteria 1845
158 Ga0373935_0156881 3300035692 Bacteria 1549
159 Ga0373927_0064012 3300035695 Bacteria 2379
160 Ga0373927_0198785 3300035695 Bacteria 1316
161 Ga0373933_0565409 3300035724 Unclassified 746
162 Ga0373937_0000611 3300036401 Bacteria 31552
163 Ga0373937_0140518 3300036401 Bacteria 2259
164 Ga0373937_0772039 3300036401 Bacteria 909
165 Ga0373925_0161560 3300037068 Bacteria 1765
166 Ga0436364_0461857 3300037853 Bacteria 19352
167 Ga0436364_0951384 3300037853 Bacteria 2577
168 Ga0436364_1401923 3300037853 Bacteria 822
169 Ga0436365_0607713 3300039437 Unclassified 731
170 Ga0436365_1053035 3300039437 Bacteria 2856
171 Ga0436365_1549035 3300039437 Bacteria 786
172 Ga0436360_0955792 3300039438 Bacteria 2160
173 Ga0436360_1240312 3300039438 Bacteria 633
174 Ga0436360_1360743 3300039438 Bacteria 536
175 Ga0436363_0250208 3300039450 Bacteria 1656
176 Ga0436363_0606097 3300039450 Unclassified 559
177 Ga0495629_0374063 3300046459 Bacteria 970
178 Ga0495651_0265567 3300046462 Bacteria 1166
179 Ga0495653_0261140 3300046463 Bacteria 1145
180 Ga0495653_0689107 3300046463 Unclassified 621
181 Ga0495664_0076576 3300046477 Bacteria 2002
182 Ga0495664_0547476 3300046477 Unclassified 690
183 Ga0495584_0264265 3300046491 Unclassified 875
184 Ga0495584_0482455 3300046491 Unclassified 631
185 Ga0495618_0204787 3300046514 Bacteria 1248
186 Ga0495628_0754950 3300046516 Bacteria 683
187 Ga0495631_0319483 3300046518 Unclassified 661
188 Ga0495644_0090797 3300046523 Bacteria 1153
189 Ga0495652_0206569 3300046529 Unclassified 1487
190 Ga0495652_0791083 3300046529 Bacteria 632
191 Ga0495665_0040485 3300046531 Unclassified 2481
192 Ga0495665_0657498 3300046531 Unclassified 521
193 Ga0495640_0521314 3300046533 Bacteria 722
194 Ga0495587_0174080 3300046536 Bacteria 1222
195 Ga0495645_0038372 3300046543 Bacteria 3493
196 Ga0495645_0713155 3300046543 Unclassified 608
197 Ga0495667_0353668 3300046559 Bacteria 928
198 Ga0495667_0417799 3300046559 Bacteria 844
199 Ga0495667_0480634 3300046559 Bacteria 779
200 Ga0495634_0090336 3300046642 Unclassified 1990
201 Ga0495635_0423700 3300046663 Bacteria 882
202 Ga0495599_0137593 3300046678 Bacteria 1516
203 Ga0495669_0516598 3300046684 Unclassified 581
204 Ga0495670_0560253 3300046691 Unclassified 622
205 Ga0495581_0180590 3300047315 Bacteria 1234
206 Ga0495604_0121643 3300047317 Unclassified 1889
207 Ga0495604_0222783 3300047317 Bacteria 1298
208 Ga0495674_0063264 3300047319 Bacteria 3219
209 Ga0495680_0335141 3300047322 Bacteria 1056
210 Ga0495680_0349262 3300047322 Unclassified 1030
211 Ga0495683_0251797 3300047323 Bacteria 775
212 Ga0495675_0165614 3300047444 Bacteria 1360
213 Ga0495677_0300643 3300047445 Unclassified 631
214 Ga0495684_0056478 3300047471 Bacteria 2993
215 Ga0495684_0087236 3300047471 Bacteria 2365
216 Ga0495602_0161421 3300048088 Bacteria 1749
217 Ga0495602_0685117 3300048088 Unclassified 697
218 Ga0496100_0410176 3300048903 Bacteria 1033
219 Ga0496100_1138260 3300048903 Bacteria 615
220 Ga0496101_0143648 3300048904 Bacteria 1821
221 Ga0496101_0187693 3300048904 Bacteria 1594
222 Ga0496102_0222385 3300048905 Bacteria 1780
223 Ga0496102_0583342 3300048905 Bacteria 1041
224 Ga0496103_0023090 3300048906 Bacteria 3750
225 Ga0496104_0042284 3300048907 Bacteria 4275
226 Ga0496104_0100000 3300048907 Bacteria 2776
227 Ga0496104_0425038 3300048907 Bacteria 1240
228 Ga0496105_0080548 3300048908 Bacteria 2690
229 Ga0496106_0134256 3300048909 Bacteria 1942
230 Ga0496106_0609376 3300048909 Bacteria 874
231 Ga0496107_0026942 3300048910 Bacteria 4079
232 Ga0496107_0476043 3300048910 Bacteria 927
233 Ga0496108_0022664 3300048911 Bacteria 5165
234 Ga0496109_0187408 3300048912 Bacteria 1944
235 Ga0496109_0347388 3300048912 Bacteria 1401
236 Ga0496110_0086389 3300048913 Bacteria 2801
237 Ga0496110_0252807 3300048913 Bacteria 1604
238 Ga0496112_0038584 3300048915 Bacteria 4664
239 Ga0496112_1741428 3300048915 Unclassified 535
240 Ga0496113_0003109 3300048916 Bacteria 9866
241 Ga0496114_0277721 3300048917 Bacteria 1476
242 Ga0496114_0319077 3300048917 Bacteria 1373
243 Ga0496114_0915531 3300048917 Bacteria 758
244 Ga0496115_0256899 3300048918 Bacteria 1437
245 Ga0496115_0451540 3300048918 Bacteria 1038
246 Ga0496115_0635628 3300048918 Bacteria 845
247 Ga0496119_0003530 3300048922 Bacteria 16147
248 Ga0496120_0037945 3300048923 Bacteria 2854
249 Ga0496121_0108250 3300048924 Bacteria 2126
250 Ga0496125_0005198 3300048928 Bacteria 14617
251 Ga0496126_0128411 3300048929 Bacteria 2192
252 Ga0501036_0628159 3300049572 Unclassified 890
253 Ga0501040_0124597 3300049576 Bacteria 1810
254 Ga0501041_0795671 3300049577 Unclassified 606
255 Ga0501070_0645594 3300049586 Bacteria 841
256 Ga0501071_1163358 3300049587 Unclassified 596
257 Ga0501072_0440912 3300049588 Unclassified 1032
258 Ga0501073_1237468 3300049589 Bacteria 512
259 Ga0501074_0220336 3300049590 Unclassified 1351
260 Ga0501075_0733473 3300049591 Unclassified 752
261 Ga0501075_1387054 3300049591 Unclassified 532
262 Ga0501076_1327119 3300049592 Unclassified 591
263 Ga0501077_0100587 3300049593 Bacteria 1832
264 Ga0501079_0634422 3300049741 Unclassified 841
265 Ga0501081_1001428 3300049743 Unclassified 631
266 nmdc:mga0k408_756419_c1 3300050493 Bacteria 567
267 nmdc:mga09592_6317_c1 3300050508 Bacteria 9657
268 nmdc:mga0qj67_32500_c1 3300050509 Bacteria 4069
269 nmdc:mga06r32_3828_c1 3300050510 Bacteria 13475
270 nmdc:mga0n895_147142_c1 3300050512 Bacteria 2385
271 Ga0495601_0318594 3300053077 Bacteria 1012
272 Ga0495601_0583473 3300053077 Bacteria 718
273 Ga0495601_0823477 3300053077 Unclassified 589
274 Ga0495612_0045397 3300053078 Bacteria 1798
275 Ga0495595_0141574 3300053084 Bacteria 1180
276 Ga0495619_0104865 3300053085 Bacteria 1927
277 Ga0495619_0199860 3300053085 Unclassified 1384
278 Ga0495619_0240549 3300053085 Bacteria 1254
279 Ga0500647_0048715 3300053091 Bacteria 2037
280 Ga0500566_0003744 3300053094 Bacteria 9080
281 Ga0500648_354758 3300053097 Unclassified 595
282 Ga0500572_000770 3300053111 Bacteria 10284
283 Ga0500572_007265 3300053111 Bacteria 2563
284 Ga0500591_142101 3300053115 Unclassified 945
285 Ga0500608_066206 3300053122 Bacteria 1723
286 Ga0500608_145901 3300053122 Bacteria 1043
287 Ga0500614_097272 3300053123 Unclassified 844
288 Ga0500559_0000466 3300053136 Bacteria 28794
289 Ga0500559_0018380 3300053136 Bacteria 2954
290 Ga0500603_003607 3300053150 Bacteria 3314
291 Ga0500630_066170 3300053159 Bacteria 1718
292 Ga0500638_058031 3300053162 Bacteria 1864
293 Ga0500639_009420 3300053163 Bacteria 5104
294 Ga0500639_018768 3300053163 Bacteria 3648
295 Ga0500637_0370710 3300053178 Unclassified 754
296 Ga0500576_190832 3300053725 Unclassified 710
297 Ga0500596_004208 3300053735 Bacteria 2661
298 Ga0500601_019704 3300053737 Unclassified 776
299 Ga0501084_0573178 3300054114 Unclassified 954
300 Ga0501082_0483614 3300060353 Unclassified 1082
301 Ga0501082_0979532 3300060353 Bacteria 739
302 Ga0530510_0008351 3300061734 Bacteria 7220
303 Ga0530510_0090719 3300061734 Bacteria 2229
304 Ga0530510_0430571 3300061734 Bacteria 996

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_102089348 Ga0070714_1020893481 111
2 3300039450 Ga0436363_0606097 Ga0436363_0606097_86_433 114
3 3300035086 Ga0373934_0023916 Ga0373934_0023916_814_1215 115
4 3300035116 Ga0373945_0284555 Ga0373945_0284555_247_648 115
5 3300035117 Ga0373953_0035850 Ga0373953_0035850_1180_1581 115
6 3300035118 Ga0373954_0529917 Ga0373954_0529917_65_466 115
7 3300035692 Ga0373935_0156881 Ga0373935_0156881_666_1067 115
8 3300035724 Ga0373933_0565409 Ga0373933_0565409_288_689 115
9 3300036401 Ga0373937_0000611 Ga0373937_0000611_22531_22932 115
10 3300036401 Ga0373937_0140518 Ga0373937_0140518_504_905 115
11 3300046462 Ga0495651_0265567 Ga0495651_0265567_64_465 115
12 3300046463 Ga0495653_0261140 Ga0495653_0261140_248_649 115
13 3300046477 Ga0495664_0547476 Ga0495664_0547476_97_498 115
14 3300046516 Ga0495628_0754950 Ga0495628_0754950_51_452 115
15 3300046529 Ga0495652_0206569 Ga0495652_0206569_903_1304 115
16 3300046543 Ga0495645_0713155 Ga0495645_0713155_137_538 115
17 3300046559 Ga0495667_0353668 Ga0495667_0353668_288_689 115
18 3300046559 Ga0495667_0480634 Ga0495667_0480634_98_499 115
19 3300046642 Ga0495634_0090336 Ga0495634_0090336_79_480 115
20 3300047317 Ga0495604_0121643 Ga0495604_0121643_1009_1410 115
21 3300047322 Ga0495680_0335141 Ga0495680_0335141_306_707 115
22 3300047471 Ga0495684_0087236 Ga0495684_0087236_223_624 115
23 3300048088 Ga0495602_0685117 Ga0495602_0685117_55_459 115
24 3300053077 Ga0495601_0583473 Ga0495601_0583473_171_572 115
25 3300053085 Ga0495619_0104865 Ga0495619_0104865_760_1161 115
26 3300005445 Ga0070708_100374866 Ga0070708_1003748663 116
27 3300049577 Ga0501041_0795671 Ga0501041_0795671_118_519 116
28 3300013297 Ga0157378_10694142 Ga0157378_106941422 117
29 3300053091 Ga0500647_0048715 Ga0500647_0048715_51_452 117
30 3300053094 Ga0500566_0003744 Ga0500566_0003744_6991_7392 117
31 3300053097 Ga0500648_354758 Ga0500648_354758_144_545 117
32 3300053111 Ga0500572_007265 Ga0500572_007265_1221_1622 117
33 3300053115 Ga0500591_142101 Ga0500591_142101_231_632 117
34 3300053122 Ga0500608_066206 Ga0500608_066206_331_732 117
35 3300053123 Ga0500614_097272 Ga0500614_097272_360_761 117
36 3300053136 Ga0500559_0018380 Ga0500559_0018380_328_729 117
37 3300053150 Ga0500603_003607 Ga0500603_003607_2289_2690 117
38 3300053159 Ga0500630_066170 Ga0500630_066170_502_903 117
39 3300053162 Ga0500638_058031 Ga0500638_058031_1101_1502 117
40 3300053163 Ga0500639_009420 Ga0500639_009420_1814_2215 117
41 3300053178 Ga0500637_0370710 Ga0500637_0370710_232_633 117
42 3300053725 Ga0500576_190832 Ga0500576_190832_149_550 117
43 3300053737 Ga0500601_019704 Ga0500601_019704_145_546 117
44 3300005435 Ga0070714_101868330 Ga0070714_1018683301 118
45 3300025939 Ga0207665_10160656 Ga0207665_101606562 119
46 3300049589 Ga0501073_1237468 Ga0501073_1237468_15_428 120
47 3300037853 Ga0436364_1401923 Ga0436364_1401923_303_695 122
48 3300013307 Ga0157372_10058995 Ga0157372_100589953 123
49 3300021377 Ga0213874_10040030 Ga0213874_100400302 123
50 3300039450 Ga0436363_0250208 Ga0436363_0250208_516_911 123
51 3300048922 Ga0496119_0003530 Ga0496119_0003530_11852_12229 124
52 3300048923 Ga0496120_0037945 Ga0496120_0037945_1844_2221 124
53 3300048924 Ga0496121_0108250 Ga0496121_0108250_1499_1876 124
54 3300048928 Ga0496125_0005198 Ga0496125_0005198_5388_5765 124
55 3300048929 Ga0496126_0128411 Ga0496126_0128411_360_737 124
56 3300005539 Ga0068853_100377649 Ga0068853_1003776492 125
57 3300007788 Ga0099795_10499829 Ga0099795_104998291 125
58 3300009551 Ga0105238_11422763 Ga0105238_114227631 125
59 3300039438 Ga0436360_1240312 Ga0436360_1240312_12_392 125
60 3300050493 nmdc:mga0k408_756419_c1 nmdc:mga0k408_756419_c1_108_488 125
61 3300009098 Ga0105245_11292264 Ga0105245_112922642 126
62 3300005436 Ga0070713_100709002 Ga0070713_1007090022 127
63 3300005437 Ga0070710_10398119 Ga0070710_103981191 127
64 3300006175 Ga0070712_101063060 Ga0070712_1010630602 127
65 3300026041 Ga0207639_10422876 Ga0207639_104228762 127
66 3300031691 Ga0316579_10226552 Ga0316579_102265523 127
67 3300035172 Ga0373955_0431922 Ga0373955_0431922_281_679 127
68 3300047322 Ga0495680_0349262 Ga0495680_0349262_592_981 128
69 3300005719 Ga0068861_101351259 Ga0068861_1013512592 129
70 3300009553 Ga0105249_12460170 Ga0105249_124601701 129
71 3300005439 Ga0070711_100342994 Ga0070711_1003429943 130
72 3300006163 Ga0070715_10668915 Ga0070715_106689152 130
73 3300006175 Ga0070712_100130855 Ga0070712_1001308552 130
74 3300006844 Ga0075428_100065811 Ga0075428_1000658113 130
75 3300006846 Ga0075430_100036091 Ga0075430_1000360918 130
76 3300006847 Ga0075431_100037255 Ga0075431_1000372558 130
77 3300006880 Ga0075429_100191095 Ga0075429_1001910952 130
78 3300006931 Ga0097620_101635058 Ga0097620_1016350582 130
79 3300007788 Ga0099795_10171600 Ga0099795_101716002 130
80 3300009147 Ga0114129_11454565 Ga0114129_114545652 130
81 3300009551 Ga0105238_10070585 Ga0105238_100705853 130
82 3300010159 Ga0099796_10119640 Ga0099796_101196402 130
83 3300014325 Ga0163163_11875728 Ga0163163_118757282 130
84 3300014968 Ga0157379_10298954 Ga0157379_102989543 130
85 3300025898 Ga0207692_10283376 Ga0207692_102833762 130
86 3300025915 Ga0207693_10043249 Ga0207693_100432492 130
87 3300025916 Ga0207663_11094357 Ga0207663_110943572 130
88 3300025924 Ga0207694_10443497 Ga0207694_104434971 130
89 3300028380 Ga0268265_12090378 Ga0268265_120903781 130
90 3300035172 Ga0373955_0498631 Ga0373955_0498631_302_697 130
91 3300035695 Ga0373927_0064012 Ga0373927_0064012_759_1154 130
92 3300037853 Ga0436364_0951384 Ga0436364_0951384_1204_1599 130
93 3300039437 Ga0436365_0607713 Ga0436365_0607713_13_408 130
94 3300039437 Ga0436365_1053035 Ga0436365_1053035_1562_1960 130
95 3300039438 Ga0436360_1360743 Ga0436360_1360743_62_457 130
96 3300046514 Ga0495618_0204787 Ga0495618_0204787_277_672 130
97 3300046531 Ga0495665_0040485 Ga0495665_0040485_1324_1719 130
98 3300046663 Ga0495635_0423700 Ga0495635_0423700_428_823 130
99 3300047315 Ga0495581_0180590 Ga0495581_0180590_104_499 130
100 3300047471 Ga0495684_0056478 Ga0495684_0056478_1862_2257 130
101 3300048915 Ga0496112_1741428 Ga0496112_1741428_43_438 130
102 3300049572 Ga0501036_0628159 Ga0501036_0628159_177_572 130
103 3300049587 Ga0501071_1163358 Ga0501071_1163358_81_476 130
104 3300049588 Ga0501072_0440912 Ga0501072_0440912_621_1016 130
105 3300049590 Ga0501074_0220336 Ga0501074_0220336_485_880 130
106 3300049591 Ga0501075_0733473 Ga0501075_0733473_275_670 130
107 3300049591 Ga0501075_1387054 Ga0501075_1387054_33_431 130
108 3300049592 Ga0501076_1327119 Ga0501076_1327119_93_488 130
109 3300049593 Ga0501077_0100587 Ga0501077_0100587_1100_1495 130
110 3300049741 Ga0501079_0634422 Ga0501079_0634422_296_691 130
111 3300049743 Ga0501081_1001428 Ga0501081_1001428_147_542 130
112 3300050508 nmdc:mga09592_6317_c1 nmdc:mga09592_6317_c1_8279_8674 130
113 3300050509 nmdc:mga0qj67_32500_c1 nmdc:mga0qj67_32500_c1_1225_1620 130
114 3300050510 nmdc:mga06r32_3828_c1 nmdc:mga06r32_3828_c1_6681_7076 130
115 3300054114 Ga0501084_0573178 Ga0501084_0573178_207_602 130
116 3300060353 Ga0501082_0483614 Ga0501082_0483614_379_774 130
117 3300060353 Ga0501082_0979532 Ga0501082_0979532_243_641 130
118 3300061734 Ga0530510_0008351 Ga0530510_0008351_1074_1469 130
119 3300061734 Ga0530510_0090719 Ga0530510_0090719_22_417 130
120 3300061734 Ga0530510_0430571 Ga0530510_0430571_443_841 130
121 3300005434 Ga0070709_10777319 Ga0070709_107773192 131
122 3300005437 Ga0070710_10086228 Ga0070710_100862282 131
123 3300005458 Ga0070681_10495662 Ga0070681_104956622 131
124 3300005530 Ga0070679_100313692 Ga0070679_1003136922 131
125 3300005563 Ga0068855_100592973 Ga0068855_1005929731 131
126 3300005981 Ga0081538_10061909 Ga0081538_100619094 131
127 3300009093 Ga0105240_12055944 Ga0105240_120559442 131
128 3300025898 Ga0207692_10044560 Ga0207692_100445603 131
129 3300025912 Ga0207707_10048565 Ga0207707_100485655 131
130 3300025921 Ga0207652_10091867 Ga0207652_100918674 131
131 3300025929 Ga0207664_10075834 Ga0207664_100758345 131
132 3300035114 Ga0373939_0002944 Ga0373939_0002944_2125_2523 131
133 3300046477 Ga0495664_0076576 Ga0495664_0076576_1145_1543 131
134 3300046543 Ga0495645_0038372 Ga0495645_0038372_2089_2487 131
135 3300050512 nmdc:mga0n895_147142_c1 nmdc:mga0n895_147142_c1_635_1033 131
136 3300053078 Ga0495612_0045397 Ga0495612_0045397_194_592 131
137 3300003659 JGI25404J52841_10009365 JGI25404J52841_100093654 132
138 3300005330 Ga0070690_101718979 Ga0070690_1017189791 132
139 3300005334 Ga0068869_101225159 Ga0068869_1012251592 132
140 3300005338 Ga0068868_100911987 Ga0068868_1009119872 132
141 3300005340 Ga0070689_100198632 Ga0070689_1001986323 132
142 3300005355 Ga0070671_100412763 Ga0070671_1004127633 132
143 3300005356 Ga0070674_100351746 Ga0070674_1003517461 132
144 3300005367 Ga0070667_101950171 Ga0070667_1019501711 132
145 3300005434 Ga0070709_11077723 Ga0070709_110777231 132
146 3300005435 Ga0070714_100842078 Ga0070714_1008420781 132
147 3300005436 Ga0070713_100746970 Ga0070713_1007469702 132
148 3300005436 Ga0070713_100988784 Ga0070713_1009887842 132
149 3300005437 Ga0070710_11543529 Ga0070710_115435291 132
150 3300005539 Ga0068853_100803649 Ga0068853_1008036492 132
151 3300005544 Ga0070686_100211025 Ga0070686_1002110253 132
152 3300005544 Ga0070686_100718858 Ga0070686_1007188581 132
153 3300005614 Ga0068856_100453966 Ga0068856_1004539662 132
154 3300005616 Ga0068852_100187319 Ga0068852_1001873193 132
155 3300005618 Ga0068864_101315392 Ga0068864_1013153922 132
156 3300005718 Ga0068866_10098578 Ga0068866_100985781 132
157 3300005842 Ga0068858_100595687 Ga0068858_1005956872 132
158 3300005937 Ga0081455_10444893 Ga0081455_104448932 132
159 3300005983 Ga0081540_1008711 Ga0081540_10087113 132
160 3300005983 Ga0081540_1064336 Ga0081540_10643362 132
161 3300006163 Ga0070715_10133154 Ga0070715_101331542 132
162 3300006175 Ga0070712_101262834 Ga0070712_1012628341 132
163 3300006237 Ga0097621_100228706 Ga0097621_1002287062 132
164 3300006358 Ga0068871_100914141 Ga0068871_1009141412 132
165 3300007265 Ga0099794_10018243 Ga0099794_100182435 132
166 3300007788 Ga0099795_10021264 Ga0099795_100212642 132
167 3300007788 Ga0099795_10046333 Ga0099795_100463332 132
168 3300007788 Ga0099795_10540752 Ga0099795_105407521 132
169 3300009093 Ga0105240_10287451 Ga0105240_102874513 132
170 3300009147 Ga0114129_11336154 Ga0114129_113361542 132
171 3300009147 Ga0114129_12267986 Ga0114129_122679862 132
172 3300009176 Ga0105242_10221986 Ga0105242_102219863 132
173 3300009177 Ga0105248_10186799 Ga0105248_101867993 132
174 3300009177 Ga0105248_12182999 Ga0105248_121829991 132
175 3300009545 Ga0105237_10345124 Ga0105237_103451242 132
176 3300009545 Ga0105237_10834377 Ga0105237_108343771 132
177 3300009551 Ga0105238_10461615 Ga0105238_104616153 132
178 3300009553 Ga0105249_11850105 Ga0105249_118501052 132
179 3300010159 Ga0099796_10174559 Ga0099796_101745591 132
180 3300010375 Ga0105239_10066442 Ga0105239_100664423 132
181 3300011119 Ga0105246_11074887 Ga0105246_110748872 132
182 3300013297 Ga0157378_11219507 Ga0157378_112195071 132
183 3300013306 Ga0163162_10590911 Ga0163162_105909111 132
184 3300013308 Ga0157375_10501401 Ga0157375_105014012 132
185 3300013308 Ga0157375_12892203 Ga0157375_128922031 132
186 3300014326 Ga0157380_10894013 Ga0157380_108940132 132
187 3300014968 Ga0157379_10323798 Ga0157379_103237982 132
188 3300014968 Ga0157379_11949556 Ga0157379_119495561 132
189 3300014969 Ga0157376_10260544 Ga0157376_102605441 132
190 3300015265 Ga0182005_1064297 Ga0182005_10642972 132
191 3300017792 Ga0163161_10401167 Ga0163161_104011672 132
192 3300020070 Ga0206356_10768386 Ga0206356_107683862 132
193 3300021388 Ga0213875_10000007 Ga0213875_1000000791 132
194 3300021441 Ga0213871_10076355 Ga0213871_100763553 132
195 3300024225 Ga0224572_1000526 Ga0224572_10005264 132
196 3300024227 Ga0228598_1005907 Ga0228598_10059073 132
197 3300025915 Ga0207693_10600531 Ga0207693_106005312 132
198 3300025921 Ga0207652_11469482 Ga0207652_114694821 132
199 3300025924 Ga0207694_10158540 Ga0207694_101585403 132
200 3300025928 Ga0207700_10468772 Ga0207700_104687722 132
201 3300025929 Ga0207664_10360214 Ga0207664_103602142 132
202 3300025934 Ga0207686_10154405 Ga0207686_101544053 132
203 3300025936 Ga0207670_10528997 Ga0207670_105289972 132
204 3300025941 Ga0207711_10604612 Ga0207711_106046122 132
205 3300025986 Ga0207658_10495115 Ga0207658_104951153 132
206 3300026023 Ga0207677_10273018 Ga0207677_102730182 132
207 3300026078 Ga0207702_10284639 Ga0207702_102846392 132
208 3300026142 Ga0207698_10430332 Ga0207698_104303322 132
209 3300027512 Ga0209179_1006209 Ga0209179_10062092 132
210 3300028381 Ga0268264_10850171 Ga0268264_108501712 132
211 3300028800 Ga0265338_10005513 Ga0265338_100055134 132
212 3300030763 Ga0265763_1005552 Ga0265763_10055522 132
213 3300030878 Ga0265770_1130552 Ga0265770_11305521 132
214 3300031090 Ga0265760_10015549 Ga0265760_100155493 132
215 3300031241 Ga0265325_10093701 Ga0265325_100937012 132
216 3300031249 Ga0265339_10000126 Ga0265339_1000012627 132
217 3300031250 Ga0265331_10027344 Ga0265331_100273442 132
218 3300031595 Ga0265313_10000844 Ga0265313_1000084426 132
219 3300031616 Ga0307508_10015607 Ga0307508_100156076 132
220 3300031712 Ga0265342_10026554 Ga0265342_100265547 132
221 3300033179 Ga0307507_10500502 Ga0307507_105005021 132
222 3300033544 Ga0316215_1031735 Ga0316215_10317351 132
223 3300034816 Ga0373930_0035963 Ga0373930_0035963_483_884 132
224 3300034957 Ga0373938_0022603 Ga0373938_0022603_626_1027 132
225 3300034957 Ga0373938_0083973 Ga0373938_0083973_110_511 132
226 3300035084 Ga0373928_0145175 Ga0373928_0145175_127_528 132
227 3300035085 Ga0373929_0005279 Ga0373929_0005279_1707_2108 132
228 3300035091 Ga0373951_0040551 Ga0373951_0040551_122_523 132
229 3300035114 Ga0373939_0046986 Ga0373939_0046986_460_861 132
230 3300035115 Ga0373941_0168740 Ga0373941_0168740_340_741 132
231 3300035115 Ga0373941_0212320 Ga0373941_0212320_212_613 132
232 3300035116 Ga0373945_0306932 Ga0373945_0306932_126_527 132
233 3300035170 Ga0373943_0127945 Ga0373943_0127945_330_731 132
234 3300035172 Ga0373955_0436960 Ga0373955_0436960_72_473 132
235 3300035241 Ga0373961_0159293 Ga0373961_0159293_248_649 132
236 3300035242 Ga0373962_0364639 Ga0373962_0364639_107_508 132
237 3300035691 Ga0373931_0001430 Ga0373931_0001430_1892_2293 132
238 3300035691 Ga0373931_0075858 Ga0373931_0075858_720_1121 132
239 3300035695 Ga0373927_0198785 Ga0373927_0198785_376_777 132
240 3300036401 Ga0373937_0772039 Ga0373937_0772039_34_435 132
241 3300037068 Ga0373925_0161560 Ga0373925_0161560_320_721 132
242 3300037853 Ga0436364_0461857 Ga0436364_0461857_1896_2294 132
243 3300039437 Ga0436365_1549035 Ga0436365_1549035_54_455 132
244 3300039438 Ga0436360_0955792 Ga0436360_0955792_1350_1757 132
245 3300046459 Ga0495629_0374063 Ga0495629_0374063_372_773 132
246 3300046463 Ga0495653_0689107 Ga0495653_0689107_135_536 132
247 3300046491 Ga0495584_0264265 Ga0495584_0264265_228_629 132
248 3300046491 Ga0495584_0482455 Ga0495584_0482455_179_580 132
249 3300046518 Ga0495631_0319483 Ga0495631_0319483_231_632 132
250 3300046523 Ga0495644_0090797 Ga0495644_0090797_637_1038 132
251 3300046529 Ga0495652_0791083 Ga0495652_0791083_101_502 132
252 3300046531 Ga0495665_0657498 Ga0495665_0657498_41_442 132
253 3300046533 Ga0495640_0521314 Ga0495640_0521314_234_635 132
254 3300046536 Ga0495587_0174080 Ga0495587_0174080_386_787 132
255 3300046559 Ga0495667_0417799 Ga0495667_0417799_415_816 132
256 3300046678 Ga0495599_0137593 Ga0495599_0137593_437_838 132
257 3300046684 Ga0495669_0516598 Ga0495669_0516598_108_506 132
258 3300046691 Ga0495670_0560253 Ga0495670_0560253_73_474 132
259 3300047317 Ga0495604_0222783 Ga0495604_0222783_132_533 132
260 3300047319 Ga0495674_0063264 Ga0495674_0063264_2179_2580 132
261 3300047323 Ga0495683_0251797 Ga0495683_0251797_44_442 132
262 3300047444 Ga0495675_0165614 Ga0495675_0165614_789_1190 132
263 3300047445 Ga0495677_0300643 Ga0495677_0300643_160_561 132
264 3300048088 Ga0495602_0161421 Ga0495602_0161421_178_579 132
265 3300048903 Ga0496100_0410176 Ga0496100_0410176_453_854 132
266 3300048903 Ga0496100_1138260 Ga0496100_1138260_129_530 132
267 3300048904 Ga0496101_0143648 Ga0496101_0143648_167_568 132
268 3300048904 Ga0496101_0187693 Ga0496101_0187693_755_1156 132
269 3300048905 Ga0496102_0222385 Ga0496102_0222385_512_913 132
270 3300048905 Ga0496102_0583342 Ga0496102_0583342_112_513 132
271 3300048906 Ga0496103_0023090 Ga0496103_0023090_1962_2363 132
272 3300048907 Ga0496104_0042284 Ga0496104_0042284_1687_2088 132
273 3300048907 Ga0496104_0100000 Ga0496104_0100000_1844_2245 132
274 3300048907 Ga0496104_0425038 Ga0496104_0425038_329_730 132
275 3300048908 Ga0496105_0080548 Ga0496105_0080548_2039_2440 132
276 3300048909 Ga0496106_0134256 Ga0496106_0134256_1429_1830 132
277 3300048909 Ga0496106_0609376 Ga0496106_0609376_230_631 132
278 3300048910 Ga0496107_0026942 Ga0496107_0026942_139_540 132
279 3300048910 Ga0496107_0476043 Ga0496107_0476043_233_634 132
280 3300048911 Ga0496108_0022664 Ga0496108_0022664_4119_4520 132
281 3300048912 Ga0496109_0187408 Ga0496109_0187408_512_913 132
282 3300048912 Ga0496109_0347388 Ga0496109_0347388_376_777 132
283 3300048913 Ga0496110_0086389 Ga0496110_0086389_1612_2013 132
284 3300048913 Ga0496110_0252807 Ga0496110_0252807_692_1093 132
285 3300048915 Ga0496112_0038584 Ga0496112_0038584_2696_3097 132
286 3300048916 Ga0496113_0003109 Ga0496113_0003109_2234_2635 132
287 3300048917 Ga0496114_0277721 Ga0496114_0277721_759_1160 132
288 3300048917 Ga0496114_0319077 Ga0496114_0319077_516_917 132
289 3300048917 Ga0496114_0915531 Ga0496114_0915531_48_449 132
290 3300048918 Ga0496115_0256899 Ga0496115_0256899_705_1106 132
291 3300048918 Ga0496115_0451540 Ga0496115_0451540_450_851 132
292 3300048918 Ga0496115_0635628 Ga0496115_0635628_326_727 132
293 3300049576 Ga0501040_0124597 Ga0501040_0124597_755_1153 132
294 3300049586 Ga0501070_0645594 Ga0501070_0645594_140_541 132
295 3300053077 Ga0495601_0318594 Ga0495601_0318594_59_460 132
296 3300053077 Ga0495601_0823477 Ga0495601_0823477_154_558 132
297 3300053084 Ga0495595_0141574 Ga0495595_0141574_454_855 132
298 3300053085 Ga0495619_0199860 Ga0495619_0199860_889_1293 132
299 3300053085 Ga0495619_0240549 Ga0495619_0240549_812_1213 132
300 3300053111 Ga0500572_000770 Ga0500572_000770_1727_2128 132
301 3300053122 Ga0500608_145901 Ga0500608_145901_491_892 132
302 3300053136 Ga0500559_0000466 Ga0500559_0000466_13881_14282 132
303 3300053163 Ga0500639_018768 Ga0500639_018768_2170_2571 132
304 3300053735 Ga0500596_004208 Ga0500596_004208_1482_1883 132

Structural Annotation

Top 5 Hits

ID Description Score Start End
3op9-assembly1.cif.gz_A crystal structure of transcriptional regulator from listeria innocua 0.8792 57 116
2icp-assembly1.cif.gz_A crystal structure of the bacterial antitoxin higa from escherichia coli at ph 4.0. northeast structural genomics consortium target er390. 0.8535 57 106
4yba-assembly1.cif.gz_A the structure of the c.kpn2i controller protein 0.8416 59 109
3jxc-assembly1.cif.gz_L crystal structure of the p22 c2 repressor protein in complex with synthetic operator 9t in the presence of tl+ 0.8342 56 116
2ict-assembly1.cif.gz_A crystal structure of the bacterial antitoxin higa from escherichia coli at ph 8.5. northeast structural genomics target er390. 0.8323 55 115
ID Description Score Start End Superfamily
3op9A01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.857 57 116 1.10.260.40
4ybaA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8416 59 109 1.10.260.40
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8365 56 116 1.10.260.40
2r1jL00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8315 56 116 1.10.260.40
1adrA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8297 53 115 1.10.260.40
ID Description Score Start End GO Terms
AF-E6QNZ6-F1-model_v4 Putative DNA-binding transcriptional regulator 0.9816 63 116 GO:0003677
AF-E6QNZ6-F1-model_v4 Putative DNA-binding transcriptional regulator 0.9473 63 116 GO:0003677
AF-A0A2V9GTB9-F1-model_v4 Transcriptional regulator 0.9462 56 116 GO:0001046
GO:0006355
AF-A0A1J5Q6A4-F1-model_v4 Antitoxin HigA 0.9422 53 116 GO:0001046
GO:0006355
AF-A0A6I7WRQ1-F1-model_v4 Transcriptional regulator 0.931 59 118 GO:0001046
GO:0006355

Feature Viewer

pLDDT pTM Quality
80.7 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map