F397812

General Info

Members Datasets Scaffolds Average Seq Length
304 179 608 281

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_15766_c1|nmdc:mga0n895_15766_c1_1949_2983
Length 344
Sequence MIVDSHQHFWRVGQFDYPWMTPQVELLCRDYLPPMLTPILSRSRVDKTILVQASNSIEETRWLLELADENSFIGGVVGWVDLQSDDVARQLDEFTAHPKFKGVRHLVESEAADDWLTQASVIRGLRELGSRGLVYDLLVHTRHLKHAESAVNQCPDLRFVIDHMAKPPIAHGEIDEWSRALKQMAAHPNISCKLSGLVTEANWANWRVEDLKPYVEAALECFGPKRMMFGSDWPVCLLAATYERVLESFEMLLAGLDEKDKRRVFSESAIEFYRIDNGEIWSAEARRRFRRARILRAGRGHPGRIWLINRQAGCLRTARKDACAPRCLKLISSLARRAASARGL

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 2808606372 Agromyces sp. 23-23 Isolate Unclassified
175 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
176 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
177 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
178 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
179 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.99
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 13.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_15766_c1 3300050512 Bacteria 6908
2 MBSR1b_contig_10257325 2162886012 Bacteria 1589
3 JGI24034J14986_100484 3300001432 Bacteria 2330
4 JGI24748J21848_1000027 3300002074 Bacteria 93866
5 JGI24034J26672_10000009 3300002239 Bacteria 160533
6 JGI24034J26672_10000029 3300002239 Bacteria 101926
7 Ga0065712_10109751 3300005290 Bacteria 1850
8 Ga0065715_10153266 3300005293 Bacteria 1705
9 Ga0065715_10248537 3300005293 Unclassified 1175
10 Ga0065707_10087529 3300005295 Bacteria 4988
11 Ga0065707_10107832 3300005295 Unclassified 2525
12 Ga0065707_10224053 3300005295 Bacteria 1214
13 Ga0065707_10289756 3300005295 Bacteria 1028
14 Ga0070676_10017321 3300005328 Bacteria 3988
15 Ga0070690_100014710 3300005330 Unclassified 4647
16 Ga0068869_100054881 3300005334 Bacteria 2902
17 Ga0068868_100006189 3300005338 Bacteria 8465
18 Ga0068868_100030775 3300005338 Unclassified 4116
19 Ga0070689_100040540 3300005340 Bacteria 3571
20 Ga0070689_100041743 3300005340 Bacteria 3521
21 Ga0070692_10049621 3300005345 Unclassified 2177
22 Ga0070692_10268330 3300005345 Bacteria 1029
23 Ga0070669_100074243 3300005353 Bacteria 2521
24 Ga0070675_100196497 3300005354 Bacteria 1749
25 Ga0070673_100061199 3300005364 Bacteria 2986
26 Ga0070673_100065862 3300005364 Bacteria 2892
27 Ga0070703_10000152 3300005406 Bacteria 35286
28 Ga0070714_100064811 3300005435 Bacteria 3146
29 Ga0070713_100217654 3300005436 Bacteria 1731
30 Ga0070701_10004313 3300005438 Bacteria 5741
31 Ga0070701_10232698 3300005438 Unclassified 1104
32 Ga0070705_100017655 3300005440 Bacteria 3727
33 Ga0070694_100009640 3300005444 Bacteria 5926
34 Ga0070694_100010320 3300005444 Bacteria 5759
35 Ga0070694_100170918 3300005444 Unclassified 1601
36 Ga0070694_100185373 3300005444 Unclassified 1542
37 Ga0070708_100000865 3300005445 Bacteria 22857
38 Ga0070708_100043973 3300005445 Bacteria 3926
39 Ga0070708_100231734 3300005445 Bacteria 1733
40 Ga0070662_100024932 3300005457 Bacteria 4126
41 Ga0070681_10002169 3300005458 Bacteria 17858
42 Ga0070681_10004012 3300005458 Bacteria 13891
43 Ga0070681_10092092 3300005458 Bacteria 2981
44 Ga0070685_10101777 3300005466 Bacteria 1755
45 Ga0070706_100038186 3300005467 Bacteria 4433
46 Ga0070706_100065784 3300005467 Bacteria 3353
47 Ga0070707_100057984 3300005468 Bacteria 3715
48 Ga0070707_100061473 3300005468 Bacteria 3602
49 Ga0070707_100162543 3300005468 Bacteria 2176
50 Ga0070707_100237363 3300005468 Bacteria 1775
51 Ga0070698_100037363 3300005471 Bacteria 5007
52 Ga0070698_100085123 3300005471 Bacteria 3149
53 Ga0070699_100003708 3300005518 Bacteria 13505
54 Ga0070699_100048246 3300005518 Bacteria 3684
55 Ga0070679_100007285 3300005530 Bacteria 10330
56 Ga0070679_100050019 3300005530 Bacteria 4163
57 Ga0070684_100053707 3300005535 Bacteria 3509
58 Ga0070697_100000076 3300005536 Bacteria 79138
59 Ga0070697_100017185 3300005536 Bacteria 5687
60 Ga0068853_100046246 3300005539 Bacteria 3731
61 Ga0070672_100143511 3300005543 Unclassified 1971
62 Ga0070672_100219769 3300005543 Bacteria 1593
63 Ga0070696_100116619 3300005546 Unclassified 1929
64 Ga0070696_100147393 3300005546 Bacteria 1725
65 Ga0070693_100230627 3300005547 Unclassified 1218
66 Ga0070665_100093904 3300005548 Bacteria 3005
67 Ga0070704_100004374 3300005549 Bacteria 8161
68 Ga0068855_100352637 3300005563 Bacteria 1620
69 Ga0070664_100011106 3300005564 Bacteria 7302
70 Ga0068857_100004188 3300005577 Bacteria 12143
71 Ga0068856_100023244 3300005614 Bacteria 6028
72 Ga0068859_100016285 3300005617 Bacteria 7468
73 Ga0068859_100146425 3300005617 Bacteria 2437
74 Ga0068864_100009134 3300005618 Bacteria 8172
75 Ga0068864_100070817 3300005618 Unclassified 3035
76 Ga0068864_100086798 3300005618 Unclassified 2753
77 Ga0068861_100031895 3300005719 Bacteria 3875
78 Ga0068863_100165661 3300005841 Bacteria 2119
79 Ga0068863_100299047 3300005841 Unclassified 1561
80 Ga0068863_100379980 3300005841 Bacteria 1379
81 Ga0068858_100000085 3300005842 Bacteria 97757
82 Ga0068858_100023238 3300005842 Bacteria 5780
83 Ga0068858_100077188 3300005842 Bacteria 3094
84 Ga0068860_100098458 3300005843 Bacteria 2789
85 Ga0068860_100107382 3300005843 Bacteria 2667
86 Ga0068860_100228690 3300005843 Bacteria 1807
87 Ga0068860_100437503 3300005843 Unclassified 1299
88 Ga0068862_100421170 3300005844 Bacteria 1253
89 Ga0075363_100186090 3300006048 Bacteria 1183
90 Ga0070716_100005934 3300006173 Bacteria 5945
91 Ga0070716_100229448 3300006173 Unclassified 1252
92 Ga0097621_100012198 3300006237 Bacteria 6358
93 Ga0097621_100021465 3300006237 Bacteria 4996
94 Ga0068871_100012493 3300006358 Bacteria 6264
95 Ga0068871_100020802 3300006358 Bacteria 5032
96 Ga0068871_100119278 3300006358 Bacteria 2226
97 Ga0075430_100005175 3300006846 Bacteria 10986
98 Ga0075430_100013534 3300006846 Bacteria 6955
99 Ga0075430_100427273 3300006846 Bacteria 1093
100 Ga0075431_100063287 3300006847 Bacteria 3818
101 Ga0075431_100223726 3300006847 Bacteria 1919
102 Ga0075431_100577595 3300006847 Bacteria 1110
103 Ga0075433_10156717 3300006852 Bacteria 2026
104 Ga0075433_10494608 3300006852 Bacteria 1077
105 Ga0075434_100104533 3300006871 Bacteria 2841
106 Ga0075434_100114005 3300006871 Bacteria 2716
107 Ga0075434_100337953 3300006871 Bacteria 1526
108 Ga0075434_100493002 3300006871 Unclassified 1246
109 Ga0068865_100050252 3300006881 Bacteria 2879
110 Ga0075436_100000008 3300006914 Bacteria 279288
111 Ga0097620_100016287 3300006931 Bacteria 7468
112 Ga0097620_100146432 3300006931 Bacteria 2437
113 Ga0075435_100000381 3300007076 Bacteria 27138
114 Ga0075435_100038283 3300007076 Bacteria 3823
115 Ga0099794_10001881 3300007265 Bacteria 7533
116 Ga0111539_10013558 3300009094 Bacteria 10190
117 Ga0111539_10026133 3300009094 Bacteria 7146
118 Ga0111539_10598135 3300009094 Bacteria 1284
119 Ga0105245_10082194 3300009098 Bacteria 2946
120 Ga0105245_10535705 3300009098 Bacteria 1191
121 Ga0105247_10000039 3300009101 Bacteria 160675
122 Ga0114129_10003442 3300009147 Bacteria 22256
123 Ga0114129_10016018 3300009147 Bacteria 10662
124 Ga0114129_10051448 3300009147 Bacteria 5783
125 Ga0114129_10072032 3300009147 Bacteria 4818
126 Ga0105243_10000119 3300009148 Bacteria 91258
127 Ga0105243_10002987 3300009148 Bacteria 13979
128 Ga0105243_10011085 3300009148 Bacteria 6820
129 Ga0105243_10618371 3300009148 Unclassified 1045
130 Ga0105241_10526187 3300009174 Bacteria 1058
131 Ga0105242_10000514 3300009176 Bacteria 30424
132 Ga0105242_10002809 3300009176 Bacteria 13641
133 Ga0105242_10309922 3300009176 Unclassified 1444
134 Ga0105248_10004972 3300009177 Bacteria 14692
135 Ga0105248_10611800 3300009177 Bacteria 1229
136 Ga0105237_10123848 3300009545 Bacteria 2580
137 Ga0105237_10520231 3300009545 Unclassified 1196
138 Ga0105238_10428720 3300009551 Bacteria 1318
139 Ga0105249_10016831 3300009553 Bacteria 6488
140 Ga0105249_10101980 3300009553 Bacteria 2700
141 Ga0105249_10148461 3300009553 Bacteria 2254
142 Ga0105249_10274148 3300009553 Unclassified 1682
143 Ga0105239_10095037 3300010375 Bacteria 3293
144 Ga0105239_10220726 3300010375 Unclassified 2126
145 Ga0105246_10142988 3300011119 Bacteria 1801
146 Ga0157373_10002373 3300013100 Bacteria 14303
147 Ga0157373_10032407 3300013100 Unclassified 3761
148 Ga0157374_10031731 3300013296 Bacteria 4805
149 Ga0157378_10002134 3300013297 Bacteria 17569
150 Ga0157378_10019816 3300013297 Bacteria 5915
151 Ga0163162_10002798 3300013306 Bacteria 16586
152 Ga0163162_10092477 3300013306 Unclassified 3108
153 Ga0163162_10103265 3300013306 Bacteria 2944
154 Ga0163162_10160396 3300013306 Bacteria 2370
155 Ga0157372_10035382 3300013307 Bacteria 5498
156 Ga0157372_10170970 3300013307 Bacteria 2514
157 Ga0157372_10260465 3300013307 Bacteria 2014
158 Ga0157375_10051794 3300013308 Bacteria 4034
159 Ga0157375_10165150 3300013308 Bacteria 2358
160 Ga0157375_10571223 3300013308 Bacteria 1291
161 Ga0163163_10004532 3300014325 Bacteria 11861
162 Ga0163163_10004786 3300014325 Bacteria 11619
163 Ga0163163_10011145 3300014325 Bacteria 8139
164 Ga0163163_10018465 3300014325 Bacteria 6530
165 Ga0163163_10086562 3300014325 Bacteria 3143
166 Ga0157380_10004575 3300014326 Bacteria 9604
167 Ga0157380_10052254 3300014326 Bacteria 3235
168 Ga0157380_10127415 3300014326 Bacteria 2166
169 Ga0157377_10070213 3300014745 Unclassified 2023
170 Ga0157379_10064889 3300014968 Bacteria 3263
171 Ga0157379_10130702 3300014968 Bacteria 2260
172 Ga0157376_10018549 3300014969 Bacteria 5338
173 Ga0157376_10101183 3300014969 Bacteria 2518
174 Ga0213875_10000656 3300021388 Bacteria 27417
175 Ga0207672_1000092 3300025223 Bacteria 11953
176 Ga0209646_1000175 3300025246 Bacteria 84336
177 Ga0207697_10029933 3300025315 Bacteria 2228
178 Ga0207653_10000395 3300025885 Bacteria 19475
179 Ga0207710_10000001 3300025900 Bacteria 1797433
180 Ga0207680_10014664 3300025903 Bacteria 4066
181 Ga0207647_10102629 3300025904 Bacteria 1696
182 Ga0207699_10443974 3300025906 Bacteria 930
183 Ga0207684_10035921 3300025910 Bacteria 4206
184 Ga0207684_10114816 3300025910 Bacteria 2306
185 Ga0207707_10000007 3300025912 Bacteria 368555
186 Ga0207707_10123619 3300025912 Bacteria 2263
187 Ga0207671_10026373 3300025914 Bacteria 4357
188 Ga0207693_10003829 3300025915 Bacteria 12814
189 Ga0207663_10012855 3300025916 Bacteria 4537
190 Ga0207662_10009045 3300025918 Bacteria 5471
191 Ga0207652_10001408 3300025921 Bacteria 21345
192 Ga0207652_10180846 3300025921 Bacteria 1895
193 Ga0207646_10037242 3300025922 Bacteria 4386
194 Ga0207646_10174151 3300025922 Bacteria 1943
195 Ga0207646_10200207 3300025922 Bacteria 1804
196 Ga0207681_10214799 3300025923 Unclassified 1485
197 Ga0207659_10183933 3300025926 Unclassified 1658
198 Ga0207700_10053557 3300025928 Bacteria 3024
199 Ga0207664_10096182 3300025929 Bacteria 2437
200 Ga0207644_10000295 3300025931 Bacteria 32742
201 Ga0207644_10142809 3300025931 Bacteria 1845
202 Ga0207690_10016101 3300025932 Unclassified 4545
203 Ga0207686_10000114 3300025934 Bacteria 64832
204 Ga0207686_10000765 3300025934 Bacteria 19778
205 Ga0207709_10000162 3300025935 Bacteria 91279
206 Ga0207709_10004166 3300025935 Bacteria 8416
207 Ga0207704_10282613 3300025938 Unclassified 1262
208 Ga0207665_10010784 3300025939 Bacteria 6000
209 Ga0207665_10263854 3300025939 Bacteria 1277
210 Ga0207665_10445688 3300025939 Unclassified 993
211 Ga0207691_10058210 3300025940 Unclassified 3515
212 Ga0207691_10078104 3300025940 Bacteria 2980
213 Ga0207711_10022340 3300025941 Bacteria 5289
214 Ga0207711_10092993 3300025941 Unclassified 2655
215 Ga0207711_10450044 3300025941 Bacteria 1199
216 Ga0207689_10004034 3300025942 Bacteria 13342
217 Ga0207651_10315753 3300025960 Bacteria 1305
218 Ga0207712_10078655 3300025961 Unclassified 2394
219 Ga0207712_10080387 3300025961 Bacteria 2371
220 Ga0207712_10277895 3300025961 Bacteria 1365
221 Ga0207640_10131620 3300025981 Bacteria 1809
222 Ga0207677_10311022 3300026023 Unclassified 1305
223 Ga0207703_10000024 3300026035 Bacteria 217968
224 Ga0207703_10074632 3300026035 Bacteria 2809
225 Ga0207708_10006957 3300026075 Bacteria 8366
226 Ga0207708_10230457 3300026075 Bacteria 1487
227 Ga0207702_10093808 3300026078 Bacteria 2633
228 Ga0207641_10252614 3300026088 Unclassified 1647
229 Ga0207641_10381360 3300026088 Bacteria 1350
230 Ga0207676_10007349 3300026095 Bacteria 7813
231 Ga0207676_10023041 3300026095 Unclassified 4587
232 Ga0207676_10184277 3300026095 Unclassified 1831
233 Ga0207674_10002475 3300026116 Bacteria 23302
234 Ga0207675_100003364 3300026118 Bacteria 15627
235 Ga0207675_100005381 3300026118 Bacteria 12281
236 Ga0207675_100008722 3300026118 Bacteria 9526
237 Ga0207675_100376300 3300026118 Bacteria 1396
238 Ga0207683_10022384 3300026121 Bacteria 5424
239 Ga0207683_10389345 3300026121 Bacteria 1282
240 Ga0207428_10002297 3300027907 Bacteria 19157
241 Ga0207428_10011057 3300027907 Bacteria 8020
242 Ga0268265_10066973 3300028380 Bacteria 2778
243 Ga0268265_10620297 3300028380 Bacteria 1036
244 Ga0268264_10026180 3300028381 Bacteria 4764
245 Ga0268264_10050538 3300028381 Bacteria 3462
246 Ga0268264_10091239 3300028381 Unclassified 2628
247 Ga0265334_10006344 3300028573 Bacteria 5101
248 Ga0265318_10002546 3300028577 Bacteria 9672
249 Ga0265318_10017069 3300028577 Bacteria 2986
250 Ga0265324_10005578 3300029957 Bacteria 5409
251 Ga0265332_10023761 3300031238 Bacteria 2702
252 Ga0265328_10075804 3300031239 Bacteria 1237
253 Ga0265320_10001197 3300031240 Bacteria 19088
254 Ga0265325_10032805 3300031241 Bacteria 2771
255 Ga0265325_10165583 3300031241 Bacteria 1037
256 Ga0265340_10000684 3300031247 Bacteria 19034
257 Ga0265339_10008633 3300031249 Bacteria 6466
258 Ga0265331_10001822 3300031250 Bacteria 15105
259 Ga0265314_10001141 3300031711 Bacteria 30771
260 Ga0307409_100467540 3300031995 Bacteria 1221
261 Ga0395900_0157254 3300037418 Bacteria 2321
262 Ga0436364_1150724 3300037853 Bacteria 3203
263 Ga0436364_1522494 3300037853 Bacteria 60475
264 Ga0395901_0027386 3300038443 Bacteria 5857
265 Ga0451849_1221198 3300041505 Unclassified 1042
266 Ga0439442_003012 3300042002 Bacteria 3327
267 Ga0466967_0137875 3300045976 Bacteria 2270
268 Ga0495638_0007282 3300046460 Bacteria 7953
269 Ga0495582_0164643 3300046473 Bacteria 1262
270 Ga0495582_0192174 3300046473 Bacteria 1165
271 Ga0495639_0111683 3300046475 Bacteria 1298
272 Ga0495662_0059323 3300046476 Bacteria 1848
273 Ga0495598_0025172 3300046537 Bacteria 1621
274 Ga0495667_0270059 3300046559 Bacteria 1081
275 Ga0495599_0033531 3300046678 Bacteria 3227
276 Ga0495636_0001596 3300047318 Bacteria 8615
277 Ga0496104_0293707 3300048907 Bacteria 1538
278 Ga0496106_0002329 3300048909 Bacteria 14162
279 Ga0496112_0636569 3300048915 Bacteria 997
280 Ga0496121_0222883 3300048924 Unclassified 1327
281 Ga0501034_0288774 3300049571 Bacteria 1579
282 Ga0501038_0073090 3300049574 Bacteria 2905
283 Ga0501047_0313984 3300049581 Bacteria 1408
284 nmdc:mga05p37_87101_c1 3300050507 Bacteria 3849
285 nmdc:mga09592_463865_c1 3300050508 Bacteria 1092
286 nmdc:mga06r32_293455_c1 3300050510 Bacteria 1613
287 nmdc:mga08y16_149754_c1 3300050511 Bacteria 2426
288 nmdc:mga08y16_1685_c1 3300050511 Bacteria 22424
289 nmdc:mga08y16_303406_c1 3300050511 Bacteria 1646
290 nmdc:mga0n895_325952_c1 3300050512 Bacteria 1556
291 nmdc:mga0n895_47516_c1 3300050512 Bacteria 4196
292 nmdc:mga0rr50_124424_c1 3300050513 Bacteria 2057
293 nmdc:mga0rr50_217702_c1 3300050513 Bacteria 1576
294 nmdc:mga0rr50_293_c1 3300050513 Bacteria 27156
295 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
296 nmdc:mga0a205_19237_c1 3300050515 Bacteria 6436
297 nmdc:mga0a205_53226_c1 3300050515 Bacteria 3907
298 nmdc:mga0a205_69089_c1 3300050515 Bacteria 3412
299 2808900192 2808606372 Bacteria 4649509
300 2837273662 2837268691 Bacteria 7850704
301 2884700491 2884693830 Bacteria 11273186
302 2895430657 2895427314 Bacteria 13147766
303 2895450289 2895442618 Bacteria 11027144
304 8055177739 8055172936 Bacteria 9305943
305 nmdc:mga0n895_15766_c1
306 MBSR1b_contig_10257325
307 JGI24034J14986_100484
308 JGI24748J21848_1000027
309 JGI24034J26672_10000009
310 JGI24034J26672_10000029
311 Ga0065712_10109751
312 Ga0065715_10153266
313 Ga0065715_10248537
314 Ga0065707_10087529
315 Ga0065707_10107832
316 Ga0065707_10224053
317 Ga0065707_10289756
318 Ga0070676_10017321
319 Ga0070690_100014710
320 Ga0068869_100054881
321 Ga0068868_100006189
322 Ga0068868_100030775
323 Ga0070689_100040540
324 Ga0070689_100041743
325 Ga0070692_10049621
326 Ga0070692_10268330
327 Ga0070669_100074243
328 Ga0070675_100196497
329 Ga0070673_100061199
330 Ga0070673_100065862
331 Ga0070703_10000152
332 Ga0070714_100064811
333 Ga0070713_100217654
334 Ga0070701_10004313
335 Ga0070701_10232698
336 Ga0070705_100017655
337 Ga0070694_100009640
338 Ga0070694_100010320
339 Ga0070694_100170918
340 Ga0070694_100185373
341 Ga0070708_100000865
342 Ga0070708_100043973
343 Ga0070708_100231734
344 Ga0070662_100024932
345 Ga0070681_10002169
346 Ga0070681_10004012
347 Ga0070681_10092092
348 Ga0070685_10101777
349 Ga0070706_100038186
350 Ga0070706_100065784
351 Ga0070707_100057984
352 Ga0070707_100061473
353 Ga0070707_100162543
354 Ga0070707_100237363
355 Ga0070698_100037363
356 Ga0070698_100085123
357 Ga0070699_100003708
358 Ga0070699_100048246
359 Ga0070679_100007285
360 Ga0070679_100050019
361 Ga0070684_100053707
362 Ga0070697_100000076
363 Ga0070697_100017185
364 Ga0068853_100046246
365 Ga0070672_100143511
366 Ga0070672_100219769
367 Ga0070696_100116619
368 Ga0070696_100147393
369 Ga0070693_100230627
370 Ga0070665_100093904
371 Ga0070704_100004374
372 Ga0068855_100352637
373 Ga0070664_100011106
374 Ga0068857_100004188
375 Ga0068856_100023244
376 Ga0068859_100016285
377 Ga0068859_100146425
378 Ga0068864_100009134
379 Ga0068864_100070817
380 Ga0068864_100086798
381 Ga0068861_100031895
382 Ga0068863_100165661
383 Ga0068863_100299047
384 Ga0068863_100379980
385 Ga0068858_100000085
386 Ga0068858_100023238
387 Ga0068858_100077188
388 Ga0068860_100098458
389 Ga0068860_100107382
390 Ga0068860_100228690
391 Ga0068860_100437503
392 Ga0068862_100421170
393 Ga0075363_100186090
394 Ga0070716_100005934
395 Ga0070716_100229448
396 Ga0097621_100012198
397 Ga0097621_100021465
398 Ga0068871_100012493
399 Ga0068871_100020802
400 Ga0068871_100119278
401 Ga0075430_100005175
402 Ga0075430_100013534
403 Ga0075430_100427273
404 Ga0075431_100063287
405 Ga0075431_100223726
406 Ga0075431_100577595
407 Ga0075433_10156717
408 Ga0075433_10494608
409 Ga0075434_100104533
410 Ga0075434_100114005
411 Ga0075434_100337953
412 Ga0075434_100493002
413 Ga0068865_100050252
414 Ga0075436_100000008
415 Ga0097620_100016287
416 Ga0097620_100146432
417 Ga0075435_100000381
418 Ga0075435_100038283
419 Ga0099794_10001881
420 Ga0111539_10013558
421 Ga0111539_10026133
422 Ga0111539_10598135
423 Ga0105245_10082194
424 Ga0105245_10535705
425 Ga0105247_10000039
426 Ga0114129_10003442
427 Ga0114129_10016018
428 Ga0114129_10051448
429 Ga0114129_10072032
430 Ga0105243_10000119
431 Ga0105243_10002987
432 Ga0105243_10011085
433 Ga0105243_10618371
434 Ga0105241_10526187
435 Ga0105242_10000514
436 Ga0105242_10002809
437 Ga0105242_10309922
438 Ga0105248_10004972
439 Ga0105248_10611800
440 Ga0105237_10123848
441 Ga0105237_10520231
442 Ga0105238_10428720
443 Ga0105249_10016831
444 Ga0105249_10101980
445 Ga0105249_10148461
446 Ga0105249_10274148
447 Ga0105239_10095037
448 Ga0105239_10220726
449 Ga0105246_10142988
450 Ga0157373_10002373
451 Ga0157373_10032407
452 Ga0157374_10031731
453 Ga0157378_10002134
454 Ga0157378_10019816
455 Ga0163162_10002798
456 Ga0163162_10092477
457 Ga0163162_10103265
458 Ga0163162_10160396
459 Ga0157372_10035382
460 Ga0157372_10170970
461 Ga0157372_10260465
462 Ga0157375_10051794
463 Ga0157375_10165150
464 Ga0157375_10571223
465 Ga0163163_10004532
466 Ga0163163_10004786
467 Ga0163163_10011145
468 Ga0163163_10018465
469 Ga0163163_10086562
470 Ga0157380_10004575
471 Ga0157380_10052254
472 Ga0157380_10127415
473 Ga0157377_10070213
474 Ga0157379_10064889
475 Ga0157379_10130702
476 Ga0157376_10018549
477 Ga0157376_10101183
478 Ga0213875_10000656
479 Ga0207672_1000092
480 Ga0209646_1000175
481 Ga0207697_10029933
482 Ga0207653_10000395
483 Ga0207710_10000001
484 Ga0207680_10014664
485 Ga0207647_10102629
486 Ga0207699_10443974
487 Ga0207684_10035921
488 Ga0207684_10114816
489 Ga0207707_10000007
490 Ga0207707_10123619
491 Ga0207671_10026373
492 Ga0207693_10003829
493 Ga0207663_10012855
494 Ga0207662_10009045
495 Ga0207652_10001408
496 Ga0207652_10180846
497 Ga0207646_10037242
498 Ga0207646_10174151
499 Ga0207646_10200207
500 Ga0207681_10214799
501 Ga0207659_10183933
502 Ga0207700_10053557
503 Ga0207664_10096182
504 Ga0207644_10000295
505 Ga0207644_10142809
506 Ga0207690_10016101
507 Ga0207686_10000114
508 Ga0207686_10000765
509 Ga0207709_10000162
510 Ga0207709_10004166
511 Ga0207704_10282613
512 Ga0207665_10010784
513 Ga0207665_10263854
514 Ga0207665_10445688
515 Ga0207691_10058210
516 Ga0207691_10078104
517 Ga0207711_10022340
518 Ga0207711_10092993
519 Ga0207711_10450044
520 Ga0207689_10004034
521 Ga0207651_10315753
522 Ga0207712_10078655
523 Ga0207712_10080387
524 Ga0207712_10277895
525 Ga0207640_10131620
526 Ga0207677_10311022
527 Ga0207703_10000024
528 Ga0207703_10074632
529 Ga0207708_10006957
530 Ga0207708_10230457
531 Ga0207702_10093808
532 Ga0207641_10252614
533 Ga0207641_10381360
534 Ga0207676_10007349
535 Ga0207676_10023041
536 Ga0207676_10184277
537 Ga0207674_10002475
538 Ga0207675_100003364
539 Ga0207675_100005381
540 Ga0207675_100008722
541 Ga0207675_100376300
542 Ga0207683_10022384
543 Ga0207683_10389345
544 Ga0207428_10002297
545 Ga0207428_10011057
546 Ga0268265_10066973
547 Ga0268265_10620297
548 Ga0268264_10026180
549 Ga0268264_10050538
550 Ga0268264_10091239
551 Ga0265334_10006344
552 Ga0265318_10002546
553 Ga0265318_10017069
554 Ga0265324_10005578
555 Ga0265332_10023761
556 Ga0265328_10075804
557 Ga0265320_10001197
558 Ga0265325_10032805
559 Ga0265325_10165583
560 Ga0265340_10000684
561 Ga0265339_10008633
562 Ga0265331_10001822
563 Ga0265314_10001141
564 Ga0307409_100467540
565 Ga0395900_0157254
566 Ga0436364_1150724
567 Ga0436364_1522494
568 Ga0395901_0027386
569 Ga0451849_1221198
570 Ga0439442_003012
571 Ga0466967_0137875
572 Ga0495638_0007282
573 Ga0495582_0164643
574 Ga0495582_0192174
575 Ga0495639_0111683
576 Ga0495662_0059323
577 Ga0495598_0025172
578 Ga0495667_0270059
579 Ga0495599_0033531
580 Ga0495636_0001596
581 Ga0496104_0293707
582 Ga0496106_0002329
583 Ga0496112_0636569
584 Ga0496121_0222883
585 Ga0501034_0288774
586 Ga0501038_0073090
587 Ga0501047_0313984
588 nmdc:mga05p37_87101_c1
589 nmdc:mga09592_463865_c1
590 nmdc:mga06r32_293455_c1
591 nmdc:mga08y16_149754_c1
592 nmdc:mga08y16_1685_c1
593 nmdc:mga08y16_303406_c1
594 nmdc:mga0n895_325952_c1
595 nmdc:mga0n895_47516_c1
596 nmdc:mga0rr50_124424_c1
597 nmdc:mga0rr50_217702_c1
598 nmdc:mga0rr50_293_c1
599 nmdc:mga08x19_16_c1
600 nmdc:mga0a205_19237_c1
601 nmdc:mga0a205_53226_c1
602 nmdc:mga0a205_69089_c1
603 2808900192
604 2837273662
605 2884700491
606 2895430657
607 2895450289
608 8055177739

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

3

275

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.9589 1 276
4do7-assembly2.cif.gz_B crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group c2 0.9555 1 276
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.9517 1 276
4dnm-assembly1.cif.gz_A crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound hepes, space group p3221 0.9484 1 276
6uvz-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8322 2 276
ID Description Score Start End Superfamily
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9589 1 276 3.20.20.140
4do7B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9555 1 276 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8344 2 274 3.20.20.140
af_A0A0R0KUU2_4_202_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8297 62 262 3.20.20.140
af_A0A0P0W9I9_79_364_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8232 2 274 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A317I5I0-F1-model_v4 Amidohydrolase 0.9946 2 253 GO:0016787
AF-A0A2V9KJW9-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9913 2 276 GO:0016787
AF-A0A6A7MPT8-F1-model_v4 deleted 0.9912 160 276
AF-A0A4Q6A7L9-F1-model_v4 Amidohydrolase 0.9903 38 275 GO:0016787
AF-X1P4S4-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9897 64 276 GO:0016787

Map