F397777

General Info

Members Datasets Scaffolds Average Seq Length
304 190 608 468

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0160525|Ga0496109_0160525_77_1534
Length 485
Sequence MVEGDQDDRGQRKEPGMAQLATDGKGQPGDVLVIFGITGDLAKVMTFRSLYRLEKRELLTCPVVGVSVADWSQDDLVEHARSAILGAGEKIDEEVFERLASRLSYVKGDFADSATYKAVGEAIKGRETPVFYLEIPPFLFGRVVQGLSEAKLTKNARIVVEKPFGHDKQSATELADELHQYIDESQLYRIDHYLGKMGLEEILFLRFGNAVLEPLWSRNFLDSVQITMAEDFGVEDRGHFYDPVGALRDVVVNHLLQVTAAAAMEPPSRGDPNTLKDSQVALFRAVVEADPANYVRGQYDGYLDIDGVADKSQTETYAALRLDIENWRWSGVPFFIRTGKKLPVMQTELRLVFKRPPRLGFTPDGFQADPNQLVIRLDPSTGIRFEVLANRADTGIGAIDLDMEFSAEGGEGPTPYEVLLHAALIGNNTRFTRQDTVEEQWRIMQPLLDSAPPVHSYKPGTWGPSAAEALTSDVGGWHAPWMPPT

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
114 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 18.09
Rhizosphere 80.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0160525 3300048912 Bacteria 2106
2 JGI24740J21852_10008184 3300001979 Bacteria 4191
3 JGI24739J22299_10037793 3300001989 Bacteria 1625
4 JGI24737J22298_10004314 3300001990 Bacteria 4966
5 Ga0070658_10077320 3300005327 Bacteria 2730
6 Ga0070683_100207183 3300005329 Bacteria 1862
7 Ga0070682_100001659 3300005337 Bacteria 12385
8 Ga0070682_100081010 3300005337 Bacteria 2101
9 Ga0070659_100111405 3300005366 Bacteria 2210
10 Ga0070667_100185521 3300005367 Bacteria 1841
11 Ga0070709_10001115 3300005434 Bacteria 14818
12 Ga0070714_100013214 3300005435 Bacteria 6609
13 Ga0070714_100019914 3300005435 Bacteria 5474
14 Ga0070714_100055622 3300005435 Bacteria 3382
15 Ga0070713_100028026 3300005436 Bacteria 4443
16 Ga0070713_100145811 3300005436 Bacteria 2101
17 Ga0070710_10003867 3300005437 Bacteria 7083
18 Ga0070710_10017162 3300005437 Bacteria 3699
19 Ga0070681_10005595 3300005458 Bacteria 12139
20 Ga0070681_10099968 3300005458 Bacteria 2846
21 Ga0068867_100018464 3300005459 Bacteria 4958
22 Ga0070679_100015484 3300005530 Bacteria 7329
23 Ga0070679_100119108 3300005530 Bacteria 2625
24 Ga0070684_100008390 3300005535 Bacteria 8072
25 Ga0070684_100035667 3300005535 Bacteria 4258
26 Ga0068855_100228253 3300005563 Bacteria 2086
27 Ga0070664_100026164 3300005564 Bacteria 4839
28 Ga0068857_100011220 3300005577 Bacteria 7793
29 Ga0068856_100022671 3300005614 Bacteria 6104
30 Ga0081455_10020036 3300005937 Bacteria 6312
31 Ga0081455_10022633 3300005937 Bacteria 5868
32 Ga0081455_10119939 3300005937 Bacteria 2073
33 Ga0081539_10017624 3300005985 Bacteria 5002
34 Ga0070717_10005581 3300006028 Bacteria 9179
35 Ga0070716_100001357 3300006173 Bacteria 10852
36 Ga0070712_100017447 3300006175 Bacteria 4648
37 Ga0075428_100000490 3300006844 Bacteria 39945
38 Ga0075428_100028409 3300006844 Bacteria 6187
39 Ga0075428_100160339 3300006844 Bacteria 2441
40 Ga0075430_100007246 3300006846 Bacteria 9367
41 Ga0075430_100052698 3300006846 Bacteria 3428
42 Ga0075431_100030264 3300006847 Bacteria 5576
43 Ga0075431_100048712 3300006847 Bacteria 4370
44 Ga0075429_100014653 3300006880 Bacteria 6797
45 Ga0075435_100080973 3300007076 Bacteria 2667
46 Ga0111539_10030052 3300009094 Bacteria 6609
47 Ga0111539_10052224 3300009094 Bacteria 4866
48 Ga0111539_10081578 3300009094 Bacteria 3804
49 Ga0105245_10079105 3300009098 Bacteria 3001
50 Ga0114129_10010100 3300009147 Bacteria 13459
51 Ga0114129_10032928 3300009147 Bacteria 7324
52 Ga0114129_10040710 3300009147 Bacteria 6549
53 Ga0105249_10162706 3300009553 Bacteria 2158
54 Ga0105239_10136056 3300010375 Bacteria 2736
55 Ga0105246_10024262 3300011119 Bacteria 3938
56 Ga0157371_10084544 3300013102 Bacteria 2248
57 Ga0157369_10035389 3300013105 Bacteria 5475
58 Ga0157374_10094015 3300013296 Bacteria 2864
59 Ga0163162_10064419 3300013306 Bacteria 3710
60 Ga0157372_10007788 3300013307 Bacteria 11378
61 Ga0157372_10174153 3300013307 Bacteria 2490
62 Ga0157372_10214823 3300013307 Bacteria 2229
63 Ga0157375_10023722 3300013308 Bacteria 5666
64 Ga0157375_10226378 3300013308 Bacteria 2029
65 Ga0163163_10131971 3300014325 Bacteria 2538
66 Ga0157380_10081783 3300014326 Bacteria 2643
67 Ga0157376_10062913 3300014969 Bacteria 3124
68 Ga0163161_10041124 3300017792 Bacteria 3321
69 Ga0206356_10402549 3300020070 Bacteria 3612
70 Ga0207653_10031124 3300025885 Bacteria 1723
71 Ga0207692_10003647 3300025898 Bacteria 6030
72 Ga0207692_10003675 3300025898 Bacteria 6012
73 Ga0207647_10007637 3300025904 Bacteria 7794
74 Ga0207699_10001363 3300025906 Bacteria 11623
75 Ga0207699_10032158 3300025906 Bacteria 2954
76 Ga0207707_10005297 3300025912 Bacteria 11283
77 Ga0207693_10001722 3300025915 Bacteria 19240
78 Ga0207693_10006000 3300025915 Bacteria 10071
79 Ga0207663_10005478 3300025916 Bacteria 6398
80 Ga0207663_10015216 3300025916 Bacteria 4238
81 Ga0207660_10087508 3300025917 Bacteria 2302
82 Ga0207649_10037908 3300025920 Bacteria 2915
83 Ga0207652_10043497 3300025921 Bacteria 3824
84 Ga0207646_10002790 3300025922 Bacteria 20372
85 Ga0207687_10013046 3300025927 Bacteria 5429
86 Ga0207700_10020874 3300025928 Bacteria 4459
87 Ga0207664_10004027 3300025929 Bacteria 9907
88 Ga0207664_10020336 3300025929 Bacteria 4918
89 Ga0207664_10030168 3300025929 Bacteria 4139
90 Ga0207690_10050308 3300025932 Bacteria 2781
91 Ga0207686_10074225 3300025934 Bacteria 2197
92 Ga0207669_10172767 3300025937 Bacteria 1540
93 Ga0207665_10003028 3300025939 Bacteria 11284
94 Ga0207661_10001205 3300025944 Bacteria 17301
95 Ga0207661_10042550 3300025944 Bacteria 3582
96 Ga0207708_10094309 3300026075 Bacteria 2310
97 Ga0207702_10015535 3300026078 Bacteria 6302
98 Ga0207648_10219869 3300026089 Bacteria 1688
99 Ga0207674_10017168 3300026116 Bacteria 7900
100 Ga0207428_10001218 3300027907 Bacteria 27593
101 Ga0265327_10025849 3300031251 Bacteria 3413
102 Ga0307513_10163712 3300031456 Bacteria 2112
103 Ga0307405_10000507 3300031731 Bacteria 14693
104 Ga0307407_10051510 3300031903 Bacteria 2360
105 Ga0307409_100002551 3300031995 Bacteria 9557
106 Ga0307415_100000058 3300032126 Bacteria 46761
107 Ga0373945_0054434 3300035116 Bacteria 1479
108 Ga0373943_0019594 3300035170 Bacteria 3111
109 Ga0373946_0019544 3300035171 Bacteria 2611
110 Ga0373924_0042951 3300035410 Bacteria 1856
111 Ga0373935_0051263 3300035692 Bacteria 2621
112 Ga0373927_0017401 3300035695 Bacteria 4730
113 Ga0373947_0006016 3300035725 Bacteria 7074
114 Ga0373937_0018127 3300036401 Bacteria 6280
115 Ga0395898_0009654 3300037466 Bacteria 10131
116 Ga0395898_0047744 3300037466 Bacteria 4200
117 Ga0436364_1533268 3300037853 Bacteria 22684
118 Ga0395901_0033615 3300038443 Bacteria 5295
119 Ga0395901_0058111 3300038443 Bacteria 4023
120 Ga0436365_0369725 3300039437 Bacteria 8493
121 Ga0466969_0090036 3300044656 Bacteria 1455
122 Ga0466961_0035289 3300044693 Bacteria 3212
123 Ga0466963_0003130 3300044694 Bacteria 9384
124 Ga0466968_0029877 3300044735 Bacteria 2256
125 Ga0466970_0039039 3300044765 Bacteria 2519
126 Ga0466957_0001241 3300044842 Bacteria 13295
127 Ga0466960_0094539 3300044901 Bacteria 1529
128 Ga0466959_0013810 3300045049 Bacteria 5864
129 Ga0466958_0005904 3300045836 Bacteria 6619
130 Ga0466967_0008600 3300045976 Bacteria 7502
131 Ga0495592_0000220 3300046454 Bacteria 49173
132 Ga0495592_0006980 3300046454 Bacteria 8439
133 Ga0495603_0012991 3300046455 Bacteria 5034
134 Ga0495641_0029288 3300046461 Bacteria 2654
135 Ga0495651_0000034 3300046462 Bacteria 99213
136 Ga0495653_0000669 3300046463 Bacteria 26191
137 Ga0495653_0013314 3300046463 Bacteria 6704
138 Ga0495653_0052627 3300046463 Bacteria 3119
139 Ga0495582_0010651 3300046473 Bacteria 5057
140 Ga0495582_0047583 3300046473 Bacteria 2362
141 Ga0495639_0003482 3300046475 Bacteria 6808
142 Ga0495662_0009815 3300046476 Bacteria 4702
143 Ga0495664_0010642 3300046477 Bacteria 5163
144 Ga0495664_0028273 3300046477 Bacteria 3274
145 Ga0495584_0016357 3300046491 Bacteria 3783
146 Ga0495585_0031142 3300046492 Bacteria 3031
147 Ga0495607_0071745 3300046501 Bacteria 1930
148 Ga0495608_0000584 3300046511 Bacteria 25040
149 Ga0495608_0054025 3300046511 Bacteria 2656
150 Ga0495618_0020556 3300046514 Bacteria 4064
151 Ga0495628_0000040 3300046516 Bacteria 104506
152 Ga0495628_0077195 3300046516 Bacteria 2591
153 Ga0495630_0041271 3300046517 Bacteria 3445
154 Ga0495630_0130750 3300046517 Bacteria 1906
155 Ga0495644_0019734 3300046523 Bacteria 2573
156 Ga0495666_0005679 3300046526 Bacteria 6286
157 Ga0495652_0002645 3300046529 Bacteria 18255
158 Ga0495652_0021474 3300046529 Bacteria 5738
159 Ga0495652_0038247 3300046529 Bacteria 4158
160 Ga0495640_0019662 3300046533 Bacteria 4981
161 Ga0495586_0030195 3300046535 Bacteria 2900
162 Ga0495587_0000055 3300046536 Bacteria 97024
163 Ga0495587_0011403 3300046536 Bacteria 5634
164 Ga0495645_0000073 3300046543 Bacteria 70164
165 Ga0495645_0027839 3300046543 Bacteria 4106
166 Ga0495656_0008453 3300046615 Bacteria 3674
167 Ga0495634_0053925 3300046642 Bacteria 2691
168 Ga0495634_0104066 3300046642 Bacteria 1831
169 Ga0495611_0015822 3300046648 Bacteria 3224
170 Ga0495635_0008226 3300046663 Bacteria 7281
171 Ga0495635_0042203 3300046663 Bacteria 3150
172 Ga0495635_0082739 3300046663 Bacteria 2196
173 Ga0495635_0118745 3300046663 Bacteria 1804
174 Ga0495657_0025390 3300046675 Bacteria 4208
175 Ga0495599_0000173 3300046678 Bacteria 42460
176 Ga0495599_0008156 3300046678 Bacteria 6361
177 Ga0495623_0000101 3300046679 Bacteria 52470
178 Ga0495646_0010006 3300046680 Bacteria 6029
179 Ga0495646_0015776 3300046680 Bacteria 4796
180 Ga0495647_0014510 3300046681 Bacteria 2746
181 Ga0495658_0047879 3300046683 Bacteria 2409
182 Ga0495613_0020215 3300046689 Bacteria 4962
183 Ga0495613_0124352 3300046689 Bacteria 1850
184 Ga0495624_0013959 3300046690 Bacteria 5467
185 Ga0495624_0047074 3300046690 Bacteria 2741
186 Ga0495600_0005458 3300046809 Bacteria 7667
187 Ga0495600_0024709 3300046809 Bacteria 3869
188 Ga0495581_0001193 3300047315 Bacteria 14265
189 Ga0495604_0000120 3300047317 Bacteria 66462
190 Ga0495604_0126706 3300047317 Bacteria 1840
191 Ga0495674_0099530 3300047319 Bacteria 2475
192 Ga0495680_0018763 3300047322 Bacteria 5862
193 Ga0495680_0076271 3300047322 Bacteria 2542
194 Ga0495675_0000029 3300047444 Bacteria 105305
195 Ga0495684_0021670 3300047471 Bacteria 4947
196 Ga0495602_0001081 3300048088 Bacteria 26704
197 Ga0495614_0003150 3300048089 Bacteria 7361
198 Ga0496100_0003284 3300048903 Bacteria 8408
199 Ga0496100_0029413 3300048903 Bacteria 3398
200 Ga0496101_0001042 3300048904 Bacteria 16370
201 Ga0496101_0019319 3300048904 Bacteria 4651
202 Ga0496101_0034255 3300048904 Bacteria 3586
203 Ga0496102_0005753 3300048905 Bacteria 10535
204 Ga0496102_0012312 3300048905 Bacteria 7398
205 Ga0496102_0096466 3300048905 Bacteria 2741
206 Ga0496103_0017930 3300048906 Bacteria 4242
207 Ga0496104_0002848 3300048907 Bacteria 14912
208 Ga0496104_0003669 3300048907 Bacteria 13256
209 Ga0496104_0012893 3300048907 Bacteria 7529
210 Ga0496104_0162630 3300048907 Bacteria 2141
211 Ga0496105_0002216 3300048908 Bacteria 14080
212 Ga0496105_0018569 3300048908 Bacteria 5596
213 Ga0496105_0022770 3300048908 Bacteria 5076
214 Ga0496105_0135518 3300048908 Bacteria 2028
215 Ga0496106_0032329 3300048909 Bacteria 3900
216 Ga0496107_0000993 3300048910 Bacteria 16893
217 Ga0496107_0009707 3300048910 Bacteria 6673
218 Ga0496108_0002305 3300048911 Bacteria 15282
219 Ga0496108_0008805 3300048911 Bacteria 8180
220 Ga0496108_0019114 3300048911 Bacteria 5621
221 Ga0496108_0059284 3300048911 Bacteria 3218
222 Ga0496108_0088491 3300048911 Bacteria 2631
223 Ga0496108_0093234 3300048911 Bacteria 2561
224 Ga0496109_0002141 3300048912 Bacteria 16434
225 Ga0496109_0005030 3300048912 Bacteria 11045
226 Ga0496109_0008137 3300048912 Bacteria 8891
227 Ga0496109_0015900 3300048912 Bacteria 6572
228 Ga0496109_0046877 3300048912 Bacteria 3927
229 Ga0496109_0047323 3300048912 Bacteria 3910
230 Ga0496109_0095313 3300048912 Bacteria 2755
231 Ga0496109_0109043 3300048912 Bacteria 2573
232 Ga0496109_0147360 3300048912 Bacteria 2203
233 Ga0496110_0023817 3300048913 Bacteria 5211
234 Ga0496110_0040416 3300048913 Bacteria 4065
235 Ga0496110_0130494 3300048913 Bacteria 2269
236 Ga0496110_0217808 3300048913 Bacteria 1736
237 Ga0496111_0011032 3300048914 Bacteria 6080
238 Ga0496111_0013902 3300048914 Bacteria 5490
239 Ga0496111_0031399 3300048914 Bacteria 3783
240 Ga0496112_0136253 3300048915 Bacteria 2425
241 Ga0496113_0023171 3300048916 Bacteria 4401
242 Ga0496113_0049925 3300048916 Bacteria 3117
243 Ga0496114_0001373 3300048917 Bacteria 18423
244 Ga0496114_0001629 3300048917 Bacteria 17041
245 Ga0496114_0017332 3300048917 Bacteria 5812
246 Ga0496114_0024391 3300048917 Bacteria 4937
247 Ga0496114_0029641 3300048917 Bacteria 4500
248 Ga0496114_0081590 3300048917 Bacteria 2732
249 Ga0496114_0121210 3300048917 Bacteria 2249
250 Ga0496115_0005928 3300048918 Bacteria 8916
251 Ga0496115_0006437 3300048918 Bacteria 8605
252 Ga0501036_0029518 3300049572 Bacteria 4632
253 Ga0501036_0158453 3300049572 Bacteria 1909
254 Ga0501039_0009464 3300049575 Bacteria 7427
255 Ga0501039_0067668 3300049575 Bacteria 2773
256 Ga0501040_0014151 3300049576 Bacteria 5251
257 Ga0501041_0030150 3300049577 Bacteria 3274
258 Ga0501042_0114444 3300049578 Bacteria 1942
259 Ga0501046_0026749 3300049580 Bacteria 4712
260 Ga0501046_0056255 3300049580 Bacteria 3089
261 Ga0501046_0100562 3300049580 Bacteria 2219
262 Ga0501047_0054652 3300049581 Bacteria 3862
263 Ga0501071_0006852 3300049587 Bacteria 7424
264 Ga0501072_0022879 3300049588 Bacteria 4850
265 Ga0501072_0051969 3300049588 Bacteria 3227
266 Ga0501074_0043224 3300049590 Bacteria 3261
267 Ga0501075_0006907 3300049591 Bacteria 7842
268 Ga0501075_0043852 3300049591 Bacteria 3354
269 Ga0501076_0002823 3300049592 Bacteria 12012
270 Ga0501076_0009263 3300049592 Bacteria 7264
271 Ga0501077_0010958 3300049593 Bacteria 5651
272 Ga0501079_0005606 3300049741 Bacteria 9369
273 Ga0501079_0101598 3300049741 Bacteria 2230
274 Ga0501080_0076495 3300049742 Bacteria 3113
275 Ga0501081_0004486 3300049743 Bacteria 8959
276 Ga0501081_0050022 3300049743 Bacteria 2879
277 nmdc:mga05p37_1861_c1 3300050507 Bacteria 24578
278 nmdc:mga05p37_348665_c1 3300050507 Bacteria 1744
279 nmdc:mga09592_24430_c1 3300050508 Bacteria 4998
280 nmdc:mga0qj67_2257_c1 3300050509 Bacteria 13698
281 nmdc:mga06r32_908_c1 3300050510 Bacteria 26354
282 nmdc:mga08y16_18241_c1 3300050511 Bacteria 7395
283 nmdc:mga08y16_19037_c1 3300050511 Bacteria 7232
284 nmdc:mga0n895_12944_c1 3300050512 Bacteria 7501
285 nmdc:mga0rr50_48534_c1 3300050513 Bacteria 3138
286 nmdc:mga0a205_225680_c1 3300050515 Bacteria 1758
287 nmdc:mga0a205_70592_c1 3300050515 Bacteria 3372
288 Ga0495601_0000110 3300053077 Bacteria 44959
289 Ga0495601_0024656 3300053077 Bacteria 3704
290 Ga0495601_0034125 3300053077 Bacteria 3172
291 Ga0495601_0058791 3300053077 Bacteria 2437
292 Ga0495612_0005408 3300053078 Bacteria 5278
293 Ga0495612_0017731 3300053078 Bacteria 2851
294 Ga0495612_0031321 3300053078 Bacteria 2144
295 Ga0495595_0003567 3300053084 Bacteria 6178
296 Ga0495595_0006773 3300053084 Bacteria 4675
297 Ga0495595_0045132 3300053084 Bacteria 2026
298 Ga0495595_0060134 3300053084 Bacteria 1778
299 Ga0495619_0009706 3300053085 Bacteria 6069
300 Ga0495619_0019027 3300053085 Bacteria 4362
301 Ga0495619_0091242 3300053085 Bacteria 2062
302 Ga0500566_0052925 3300053094 Bacteria 2318
303 Ga0501082_0022145 3300060353 Bacteria 5477
304 2884995278 2884994152 Bacteria 4492978
305 Ga0496109_0160525
306 JGI24740J21852_10008184
307 JGI24739J22299_10037793
308 JGI24737J22298_10004314
309 Ga0070658_10077320
310 Ga0070683_100207183
311 Ga0070682_100001659
312 Ga0070682_100081010
313 Ga0070659_100111405
314 Ga0070667_100185521
315 Ga0070709_10001115
316 Ga0070714_100013214
317 Ga0070714_100019914
318 Ga0070714_100055622
319 Ga0070713_100028026
320 Ga0070713_100145811
321 Ga0070710_10003867
322 Ga0070710_10017162
323 Ga0070681_10005595
324 Ga0070681_10099968
325 Ga0068867_100018464
326 Ga0070679_100015484
327 Ga0070679_100119108
328 Ga0070684_100008390
329 Ga0070684_100035667
330 Ga0068855_100228253
331 Ga0070664_100026164
332 Ga0068857_100011220
333 Ga0068856_100022671
334 Ga0081455_10020036
335 Ga0081455_10022633
336 Ga0081455_10119939
337 Ga0081539_10017624
338 Ga0070717_10005581
339 Ga0070716_100001357
340 Ga0070712_100017447
341 Ga0075428_100000490
342 Ga0075428_100028409
343 Ga0075428_100160339
344 Ga0075430_100007246
345 Ga0075430_100052698
346 Ga0075431_100030264
347 Ga0075431_100048712
348 Ga0075429_100014653
349 Ga0075435_100080973
350 Ga0111539_10030052
351 Ga0111539_10052224
352 Ga0111539_10081578
353 Ga0105245_10079105
354 Ga0114129_10010100
355 Ga0114129_10032928
356 Ga0114129_10040710
357 Ga0105249_10162706
358 Ga0105239_10136056
359 Ga0105246_10024262
360 Ga0157371_10084544
361 Ga0157369_10035389
362 Ga0157374_10094015
363 Ga0163162_10064419
364 Ga0157372_10007788
365 Ga0157372_10174153
366 Ga0157372_10214823
367 Ga0157375_10023722
368 Ga0157375_10226378
369 Ga0163163_10131971
370 Ga0157380_10081783
371 Ga0157376_10062913
372 Ga0163161_10041124
373 Ga0206356_10402549
374 Ga0207653_10031124
375 Ga0207692_10003647
376 Ga0207692_10003675
377 Ga0207647_10007637
378 Ga0207699_10001363
379 Ga0207699_10032158
380 Ga0207707_10005297
381 Ga0207693_10001722
382 Ga0207693_10006000
383 Ga0207663_10005478
384 Ga0207663_10015216
385 Ga0207660_10087508
386 Ga0207649_10037908
387 Ga0207652_10043497
388 Ga0207646_10002790
389 Ga0207687_10013046
390 Ga0207700_10020874
391 Ga0207664_10004027
392 Ga0207664_10020336
393 Ga0207664_10030168
394 Ga0207690_10050308
395 Ga0207686_10074225
396 Ga0207669_10172767
397 Ga0207665_10003028
398 Ga0207661_10001205
399 Ga0207661_10042550
400 Ga0207708_10094309
401 Ga0207702_10015535
402 Ga0207648_10219869
403 Ga0207674_10017168
404 Ga0207428_10001218
405 Ga0265327_10025849
406 Ga0307513_10163712
407 Ga0307405_10000507
408 Ga0307407_10051510
409 Ga0307409_100002551
410 Ga0307415_100000058
411 Ga0373945_0054434
412 Ga0373943_0019594
413 Ga0373946_0019544
414 Ga0373924_0042951
415 Ga0373935_0051263
416 Ga0373927_0017401
417 Ga0373947_0006016
418 Ga0373937_0018127
419 Ga0395898_0009654
420 Ga0395898_0047744
421 Ga0436364_1533268
422 Ga0395901_0033615
423 Ga0395901_0058111
424 Ga0436365_0369725
425 Ga0466969_0090036
426 Ga0466961_0035289
427 Ga0466963_0003130
428 Ga0466968_0029877
429 Ga0466970_0039039
430 Ga0466957_0001241
431 Ga0466960_0094539
432 Ga0466959_0013810
433 Ga0466958_0005904
434 Ga0466967_0008600
435 Ga0495592_0000220
436 Ga0495592_0006980
437 Ga0495603_0012991
438 Ga0495641_0029288
439 Ga0495651_0000034
440 Ga0495653_0000669
441 Ga0495653_0013314
442 Ga0495653_0052627
443 Ga0495582_0010651
444 Ga0495582_0047583
445 Ga0495639_0003482
446 Ga0495662_0009815
447 Ga0495664_0010642
448 Ga0495664_0028273
449 Ga0495584_0016357
450 Ga0495585_0031142
451 Ga0495607_0071745
452 Ga0495608_0000584
453 Ga0495608_0054025
454 Ga0495618_0020556
455 Ga0495628_0000040
456 Ga0495628_0077195
457 Ga0495630_0041271
458 Ga0495630_0130750
459 Ga0495644_0019734
460 Ga0495666_0005679
461 Ga0495652_0002645
462 Ga0495652_0021474
463 Ga0495652_0038247
464 Ga0495640_0019662
465 Ga0495586_0030195
466 Ga0495587_0000055
467 Ga0495587_0011403
468 Ga0495645_0000073
469 Ga0495645_0027839
470 Ga0495656_0008453
471 Ga0495634_0053925
472 Ga0495634_0104066
473 Ga0495611_0015822
474 Ga0495635_0008226
475 Ga0495635_0042203
476 Ga0495635_0082739
477 Ga0495635_0118745
478 Ga0495657_0025390
479 Ga0495599_0000173
480 Ga0495599_0008156
481 Ga0495623_0000101
482 Ga0495646_0010006
483 Ga0495646_0015776
484 Ga0495647_0014510
485 Ga0495658_0047879
486 Ga0495613_0020215
487 Ga0495613_0124352
488 Ga0495624_0013959
489 Ga0495624_0047074
490 Ga0495600_0005458
491 Ga0495600_0024709
492 Ga0495581_0001193
493 Ga0495604_0000120
494 Ga0495604_0126706
495 Ga0495674_0099530
496 Ga0495680_0018763
497 Ga0495680_0076271
498 Ga0495675_0000029
499 Ga0495684_0021670
500 Ga0495602_0001081
501 Ga0495614_0003150
502 Ga0496100_0003284
503 Ga0496100_0029413
504 Ga0496101_0001042
505 Ga0496101_0019319
506 Ga0496101_0034255
507 Ga0496102_0005753
508 Ga0496102_0012312
509 Ga0496102_0096466
510 Ga0496103_0017930
511 Ga0496104_0002848
512 Ga0496104_0003669
513 Ga0496104_0012893
514 Ga0496104_0162630
515 Ga0496105_0002216
516 Ga0496105_0018569
517 Ga0496105_0022770
518 Ga0496105_0135518
519 Ga0496106_0032329
520 Ga0496107_0000993
521 Ga0496107_0009707
522 Ga0496108_0002305
523 Ga0496108_0008805
524 Ga0496108_0019114
525 Ga0496108_0059284
526 Ga0496108_0088491
527 Ga0496108_0093234
528 Ga0496109_0002141
529 Ga0496109_0005030
530 Ga0496109_0008137
531 Ga0496109_0015900
532 Ga0496109_0046877
533 Ga0496109_0047323
534 Ga0496109_0095313
535 Ga0496109_0109043
536 Ga0496109_0147360
537 Ga0496110_0023817
538 Ga0496110_0040416
539 Ga0496110_0130494
540 Ga0496110_0217808
541 Ga0496111_0011032
542 Ga0496111_0013902
543 Ga0496111_0031399
544 Ga0496112_0136253
545 Ga0496113_0023171
546 Ga0496113_0049925
547 Ga0496114_0001373
548 Ga0496114_0001629
549 Ga0496114_0017332
550 Ga0496114_0024391
551 Ga0496114_0029641
552 Ga0496114_0081590
553 Ga0496114_0121210
554 Ga0496115_0005928
555 Ga0496115_0006437
556 Ga0501036_0029518
557 Ga0501036_0158453
558 Ga0501039_0009464
559 Ga0501039_0067668
560 Ga0501040_0014151
561 Ga0501041_0030150
562 Ga0501042_0114444
563 Ga0501046_0026749
564 Ga0501046_0056255
565 Ga0501046_0100562
566 Ga0501047_0054652
567 Ga0501071_0006852
568 Ga0501072_0022879
569 Ga0501072_0051969
570 Ga0501074_0043224
571 Ga0501075_0006907
572 Ga0501075_0043852
573 Ga0501076_0002823
574 Ga0501076_0009263
575 Ga0501077_0010958
576 Ga0501079_0005606
577 Ga0501079_0101598
578 Ga0501080_0076495
579 Ga0501081_0004486
580 Ga0501081_0050022
581 nmdc:mga05p37_1861_c1
582 nmdc:mga05p37_348665_c1
583 nmdc:mga09592_24430_c1
584 nmdc:mga0qj67_2257_c1
585 nmdc:mga06r32_908_c1
586 nmdc:mga08y16_18241_c1
587 nmdc:mga08y16_19037_c1
588 nmdc:mga0n895_12944_c1
589 nmdc:mga0rr50_48534_c1
590 nmdc:mga0a205_225680_c1
591 nmdc:mga0a205_70592_c1
592 Ga0495601_0000110
593 Ga0495601_0024656
594 Ga0495601_0034125
595 Ga0495601_0058791
596 Ga0495612_0005408
597 Ga0495612_0017731
598 Ga0495612_0031321
599 Ga0495595_0003567
600 Ga0495595_0006773
601 Ga0495595_0045132
602 Ga0495595_0060134
603 Ga0495619_0009706
604 Ga0495619_0019027
605 Ga0495619_0091242
606 Ga0500566_0052925
607 Ga0501082_0022145
608 2884995278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

33

200

0.95

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

203

479

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9462 10 467
4lgv-assembly1.cif.gz_B x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9402 10 467
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9349 10 467
4lgv-assembly1.cif.gz_D x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9347 11 466
4lgv-assembly1.cif.gz_A x-ray crystal structure of glucose-6-phosphate 1-dehydrogenase from mycobacterium avium 0.9309 10 467
ID Description Score Start End Superfamily
4lgvD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9853 11 171 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9799 10 169 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 10 169 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9438 16 170 3.40.50.720
4lgvC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9352 173 467 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9931 212 327 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-T0ZPI7-F1-model_v4 Glucose-6-phosphate dehydrogenase (EC 1.1.1.49) 0.9856 10 115 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-T1BPA3-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase 0.9781 207 375 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A5R2MZ40-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9728 77 168 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A6L6ARS4-F1-model_v4 Glucose-6-phosphate 1-dehydrogenase (G6PD) (EC 1.1.1.49) 0.9713 10 463 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map