F397680

General Info

Members Datasets Scaffolds Average Seq Length
304 199 608 267

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0046323|Ga0373947_0046323_705_1676
Length 323
Sequence MPAFICTACGAQFAPSEAPPAQCPICEDERQYVPPRGQTWTTLPALAASHFNSYREHAPGVIGIGTQPAFAIGQRALLLRTAGGNVLWDCISLLDAATVTLIGALGGIKAIAISHPHFYTGMVEWSRAFGGVPIHLHAADRAWIMRPDPAIRPWEGETLALMPGVTLVRCGGHFPGGTVLHWAEGAGGRGVLCAGDIAAVAPDRKWLAFMKSYPNFIPLSAGEVDGIAAALAPFQFDIIYGHYFDRVIPTGGKAVLAASVALSRRDRRPAAGLNEADTGQSRKPSTIIGHRTPILLQRPANWERAPAGCGQCQPPRSAHSKPF

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
88 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
91 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
94 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
95 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
96 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
195 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
196 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
197 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 5.26
Rhizosphere 89.14
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0046323 3300035725 Bacteria 2604
2 JGI25404J52841_10006864 3300003659 Bacteria 2393
3 JGI25405J52794_10008474 3300003911 Bacteria 1921
4 Ga0065712_10070433 3300005290 Bacteria 6010
5 Ga0070658_10007874 3300005327 Bacteria 8582
6 Ga0070658_10248064 3300005327 Bacteria 1510
7 Ga0070683_100314548 3300005329 Bacteria 1490
8 Ga0070670_100167255 3300005331 Bacteria 1907
9 Ga0070680_100081901 3300005336 Bacteria 2663
10 Ga0070680_100260682 3300005336 Bacteria 1466
11 Ga0070680_100574272 3300005336 Bacteria 967
12 Ga0070660_100099252 3300005339 Bacteria 2305
13 Ga0070660_100314710 3300005339 Bacteria 1285
14 Ga0070675_100066641 3300005354 Bacteria 2978
15 Ga0070671_100143111 3300005355 Bacteria 2018
16 Ga0070709_10188809 3300005434 Bacteria 1452
17 Ga0070714_100019188 3300005435 Bacteria 5565
18 Ga0070714_100058295 3300005435 Bacteria 3307
19 Ga0070713_100106946 3300005436 Bacteria 2433
20 Ga0070713_100682376 3300005436 Unclassified 980
21 Ga0070711_100014051 3300005439 Bacteria 5038
22 Ga0070700_100001479 3300005441 Bacteria 11696
23 Ga0070681_10058843 3300005458 Bacteria 3822
24 Ga0070681_10114022 3300005458 Bacteria 2642
25 Ga0070685_10079726 3300005466 Bacteria 1960
26 Ga0070707_100071696 3300005468 Bacteria 3337
27 Ga0070698_100003731 3300005471 Bacteria 16739
28 Ga0070699_100054242 3300005518 Bacteria 3469
29 Ga0070679_100110111 3300005530 Bacteria 2740
30 Ga0070679_100353151 3300005530 Bacteria 1418
31 Ga0070679_100368501 3300005530 Bacteria 1383
32 Ga0070697_100030866 3300005536 Bacteria 4307
33 Ga0070697_100205215 3300005536 Bacteria 1676
34 Ga0068853_100510117 3300005539 Bacteria 1136
35 Ga0070693_100460563 3300005547 Unclassified 894
36 Ga0068855_100041664 3300005563 Bacteria 5441
37 Ga0068855_100164426 3300005563 Bacteria 2516
38 Ga0068855_100526113 3300005563 Bacteria 1282
39 Ga0070664_100172884 3300005564 Bacteria 1917
40 Ga0070664_100194310 3300005564 Bacteria 1809
41 Ga0068856_100379931 3300005614 Bacteria 1432
42 Ga0068852_100061975 3300005616 Bacteria 3251
43 Ga0068852_100142231 3300005616 Bacteria 2222
44 Ga0068859_100008041 3300005617 Bacteria 10692
45 Ga0068859_100075510 3300005617 Bacteria 3411
46 Ga0081455_10000031 3300005937 Bacteria 146486
47 Ga0081455_10005956 3300005937 Bacteria 13223
48 Ga0081455_10014661 3300005937 Bacteria 7663
49 Ga0081455_10054090 3300005937 Bacteria 3424
50 Ga0081455_10067410 3300005937 Bacteria 2982
51 Ga0081538_10007058 3300005981 Bacteria 9767
52 Ga0081538_10008070 3300005981 Bacteria 8990
53 Ga0081538_10019479 3300005981 Bacteria 5040
54 Ga0081540_1001200 3300005983 Bacteria 22696
55 Ga0081540_1065179 3300005983 Bacteria 1714
56 Ga0070712_100042462 3300006175 Bacteria 3127
57 Ga0075367_10214089 3300006178 Unclassified 1205
58 Ga0075370_10067599 3300006353 Bacteria 2040
59 Ga0068871_100466773 3300006358 Bacteria 1133
60 Ga0075428_100297351 3300006844 Bacteria 1736
61 Ga0075434_100039278 3300006871 Bacteria 4689
62 Ga0075434_100463852 3300006871 Unclassified 1288
63 Ga0097620_100008041 3300006931 Bacteria 10692
64 Ga0097620_100075509 3300006931 Bacteria 3411
65 Ga0099794_10010561 3300007265 Plasmid 3926
66 Ga0111539_10068290 3300009094 Bacteria 4196
67 Ga0105247_10090667 3300009101 Bacteria 1940
68 Ga0114129_10025670 3300009147 Bacteria 8347
69 Ga0114129_10461860 3300009147 Bacteria 1664
70 Ga0114129_10614974 3300009147 Bacteria 1406
71 Ga0105248_10066779 3300009177 Bacteria 4038
72 Ga0105238_10090475 3300009551 Bacteria 3047
73 Ga0099796_10010685 3300010159 Bacteria 2533
74 Ga0157369_10269878 3300013105 Bacteria 1773
75 Ga0157378_10328020 3300013297 Bacteria 1489
76 Ga0163163_10078637 3300014325 Bacteria 3295
77 Ga0163163_10258168 3300014325 Unclassified 1793
78 Ga0157379_10127072 3300014968 Bacteria 2294
79 Ga0157376_10452885 3300014969 Bacteria 1252
80 Ga0206354_10798211 3300020081 Bacteria 986
81 Ga0206353_10980335 3300020082 Bacteria 1295
82 Ga0213876_10131612 3300021384 Bacteria 1329
83 Ga0207647_10005455 3300025904 Bacteria 9319
84 Ga0207705_10178857 3300025909 Bacteria 1600
85 Ga0207705_10214861 3300025909 Bacteria 1459
86 Ga0207707_10048511 3300025912 Bacteria 3698
87 Ga0207707_10282688 3300025912 Bacteria 1437
88 Ga0207695_10002359 3300025913 Bacteria 28068
89 Ga0207695_10309515 3300025913 Unclassified 1470
90 Ga0207695_10453642 3300025913 Bacteria 1165
91 Ga0207693_10330999 3300025915 Bacteria 1192
92 Ga0207660_10395763 3300025917 Bacteria 1112
93 Ga0207662_10054658 3300025918 Bacteria 2381
94 Ga0207657_10009131 3300025919 Bacteria 10005
95 Ga0207657_10249699 3300025919 Bacteria 1415
96 Ga0207652_10032169 3300025921 Bacteria 4407
97 Ga0207652_10100921 3300025921 Bacteria 2548
98 Ga0207652_10228983 3300025921 Bacteria 1675
99 Ga0207681_10009572 3300025923 Bacteria 5923
100 Ga0207694_10038909 3300025924 Bacteria 3658
101 Ga0207694_10391505 3300025924 Bacteria 1155
102 Ga0207650_10136398 3300025925 Bacteria 1925
103 Ga0207700_10267643 3300025928 Bacteria 1466
104 Ga0207700_10529708 3300025928 Bacteria 1044
105 Ga0207664_10015866 3300025929 Bacteria 5484
106 Ga0207664_10153980 3300025929 Bacteria 1955
107 Ga0207664_10258403 3300025929 Bacteria 1522
108 Ga0207664_10589562 3300025929 Bacteria 998
109 Ga0207670_10023023 3300025936 Bacteria 3870
110 Ga0207691_10038807 3300025940 Bacteria 4407
111 Ga0207711_10097898 3300025941 Bacteria 2591
112 Ga0207661_10169432 3300025944 Bacteria 1900
113 Ga0207679_10046232 3300025945 Bacteria 3154
114 Ga0207679_10132489 3300025945 Bacteria 2002
115 Ga0207667_10047725 3300025949 Bacteria 4531
116 Ga0207667_10414291 3300025949 Bacteria 1371
117 Ga0207667_10702035 3300025949 Bacteria 1014
118 Ga0207658_10051260 3300025986 Bacteria 3041
119 Ga0207708_10001296 3300026075 Bacteria 18801
120 Ga0207675_100058184 3300026118 Bacteria 3607
121 Ga0207698_10022747 3300026142 Bacteria 4365
122 Ga0207428_10313819 3300027907 Bacteria 1159
123 Ga0207428_10323861 3300027907 Bacteria 1138
124 Ga0265337_1003979 3300028556 Bacteria 6253
125 Ga0265325_10054981 3300031241 Bacteria 2037
126 Ga0265340_10012862 3300031247 Bacteria 4412
127 Ga0265313_10000577 3300031595 Bacteria 38251
128 Ga0265313_10065654 3300031595 Bacteria 1684
129 Ga0265314_10053185 3300031711 Bacteria 2810
130 Ga0265342_10000464 3300031712 Bacteria 43974
131 Ga0316583_10009929 3300032133 Bacteria 3429
132 Ga0307510_10045012 3300033180 Bacteria 4772
133 Ga0373944_0017604 3300035089 Bacteria 2031
134 Ga0373945_0003525 3300035116 Bacteria 4930
135 Ga0373953_0009710 3300035117 Bacteria 3322
136 Ga0373954_0014363 3300035118 Bacteria 3531
137 Ga0373956_0021026 3300035119 Bacteria 2781
138 Ga0373960_0007112 3300035121 Bacteria 2643
139 Ga0373943_0002092 3300035170 Bacteria 9063
140 Ga0373946_0006291 3300035171 Bacteria 4302
141 Ga0373955_0063781 3300035172 Bacteria 2040
142 Ga0373924_0044418 3300035410 Bacteria 1826
143 Ga0373931_0068097 3300035691 Bacteria 1937
144 Ga0373935_0008707 3300035692 Bacteria 6077
145 Ga0373935_0092923 3300035692 Bacteria 1978
146 Ga0373935_0242101 3300035692 Bacteria 1260
147 Ga0373927_0002617 3300035695 Bacteria 13120
148 Ga0373927_0034422 3300035695 Bacteria 3295
149 Ga0373927_0166533 3300035695 Bacteria 1444
150 Ga0373927_0220971 3300035695 Bacteria 1244
151 Ga0373933_0032376 3300035724 Bacteria 3039
152 Ga0373933_0140234 3300035724 Bacteria 1526
153 Ga0373947_0000303 3300035725 Bacteria 27751
154 Ga0373947_0066110 3300035725 Bacteria 2206
155 Ga0373947_0154914 3300035725 Bacteria 1478
156 Ga0373937_0032614 3300036401 Bacteria 4725
157 Ga0373937_0092165 3300036401 Bacteria 2808
158 Ga0373937_0101502 3300036401 Bacteria 2670
159 Ga0373937_0284543 3300036401 Unclassified 1562
160 Ga0373925_0049081 3300037068 Bacteria 3146
161 Ga0373925_0163540 3300037068 Bacteria 1754
162 Ga0436364_0931038 3300037853 Bacteria 1812
163 Ga0242420_009565 3300038996 Bacteria 1592
164 Ga0436365_1473399 3300039437 Bacteria 8261
165 Ga0436365_1703167 3300039437 Bacteria 2218
166 Ga0436360_0165678 3300039438 Bacteria 1002
167 Ga0436361_0829307 3300039447 Bacteria 1563
168 Ga0436363_1285858 3300039450 Bacteria 1161
169 Ga0466971_0171022 3300044719 Bacteria 1020
170 Ga0466960_0050236 3300044901 Bacteria 2010
171 Ga0466959_0235829 3300045049 Bacteria 1265
172 Ga0495592_0011187 3300046454 Bacteria 6779
173 Ga0495592_0322310 3300046454 Bacteria 998
174 Ga0495603_0040354 3300046455 Bacteria 2794
175 Ga0495603_0312928 3300046455 Bacteria 902
176 Ga0495629_0021736 3300046459 Bacteria 4578
177 Ga0495629_0150537 3300046459 Bacteria 1617
178 Ga0495651_0025932 3300046462 Bacteria 4564
179 Ga0495651_0051642 3300046462 Bacteria 3169
180 Ga0495651_0197468 3300046462 Bacteria 1411
181 Ga0495653_0049504 3300046463 Bacteria 3236
182 Ga0495580_0071122 3300046472 Bacteria 2430
183 Ga0495582_0061242 3300046473 Bacteria 2078
184 Ga0495639_0089919 3300046475 Bacteria 1439
185 Ga0495662_0007226 3300046476 Bacteria 5497
186 Ga0495664_0000202 3300046477 Bacteria 28893
187 Ga0495664_0311679 3300046477 Bacteria 949
188 Ga0495584_0117346 3300046491 Bacteria 1347
189 Ga0495608_0243620 3300046511 Bacteria 1122
190 Ga0495616_0081891 3300046513 Bacteria 1543
191 Ga0495618_0004996 3300046514 Bacteria 8105
192 Ga0495618_0015879 3300046514 Bacteria 4596
193 Ga0495648_0001044 3300046524 Bacteria 28102
194 Ga0495648_0006355 3300046524 Bacteria 9660
195 Ga0495666_0077509 3300046526 Bacteria 1575
196 Ga0495652_0019081 3300046529 Bacteria 6107
197 Ga0495652_0085601 3300046529 Bacteria 2590
198 Ga0495665_0033806 3300046531 Bacteria 2734
199 Ga0495665_0059616 3300046531 Bacteria 2014
200 Ga0495640_0001275 3300046533 Bacteria 19760
201 Ga0495640_0022955 3300046533 Bacteria 4556
202 Ga0495640_0111073 3300046533 Bacteria 1791
203 Ga0495586_0027053 3300046535 Bacteria 3069
204 Ga0495587_0014525 3300046536 Bacteria 4937
205 Ga0495587_0093623 3300046536 Bacteria 1735
206 Ga0495587_0130267 3300046536 Bacteria 1438
207 Ga0495645_0008678 3300046543 Bacteria 7099
208 Ga0495667_0010201 3300046559 Bacteria 6357
209 Ga0495656_0017589 3300046615 Bacteria 2730
210 Ga0495634_0003024 3300046642 Bacteria 13688
211 Ga0495634_0036286 3300046642 Bacteria 3372
212 Ga0495634_0050976 3300046642 Bacteria 2778
213 Ga0495635_0001332 3300046663 Bacteria 16434
214 Ga0495659_0041121 3300046664 Bacteria 1650
215 Ga0495657_0287555 3300046675 Bacteria 982
216 Ga0495599_0219071 3300046678 Bacteria 1165
217 Ga0495623_0138795 3300046679 Bacteria 1448
218 Ga0495623_0158977 3300046679 Bacteria 1329
219 Ga0495646_0017785 3300046680 Bacteria 4506
220 Ga0495658_0168716 3300046683 Bacteria 1353
221 Ga0495613_0066317 3300046689 Bacteria 2636
222 Ga0495613_0282783 3300046689 Bacteria 1152
223 Ga0495624_0010397 3300046690 Bacteria 6413
224 Ga0495624_0030534 3300046690 Bacteria 3509
225 Ga0495604_0057733 3300047317 Bacteria 2983
226 Ga0495604_0061971 3300047317 Bacteria 2859
227 Ga0495674_0065344 3300047319 Bacteria 3160
228 Ga0495680_0111769 3300047322 Bacteria 2024
229 Ga0495680_0173771 3300047322 Bacteria 1558
230 Ga0495675_0016456 3300047444 Bacteria 4678
231 Ga0495684_0010372 3300047471 Bacteria 7206
232 Ga0495684_0026865 3300047471 Bacteria 4422
233 Ga0495684_0140408 3300047471 Bacteria 1811
234 Ga0495684_0243515 3300047471 Bacteria 1310
235 Ga0495593_0042456 3300047673 Bacteria 2440
236 Ga0495602_0371668 3300048088 Bacteria 1026
237 Ga0496104_0083732 3300048907 Bacteria 3042
238 Ga0496104_0254980 3300048907 Bacteria 1667
239 Ga0496107_0069702 3300048910 Bacteria 2553
240 Ga0496107_0125145 3300048910 Unclassified 1895
241 Ga0496108_0004587 3300048911 Bacteria 11131
242 Ga0496109_0001606 3300048912 Bacteria 18869
243 Ga0496110_0124481 3300048913 Bacteria 2325
244 Ga0496110_0127109 3300048913 Bacteria 2300
245 Ga0496110_0229515 3300048913 Bacteria 1688
246 Ga0496110_0466719 3300048913 Unclassified 1150
247 Ga0496111_0003849 3300048914 Bacteria 9377
248 Ga0496113_0000122 3300048916 Bacteria 33708
249 Ga0496114_0160443 3300048917 Bacteria 1954
250 Ga0496114_0382984 3300048917 Bacteria 1245
251 Ga0496115_0021512 3300048918 Bacteria 4985
252 Ga0496115_0251411 3300048918 Bacteria 1455
253 Ga0501034_0015256 3300049571 Bacteria 7896
254 Ga0501034_0018661 3300049571 Bacteria 7109
255 Ga0501034_0529794 3300049571 Bacteria 1089
256 Ga0501036_0001733 3300049572 Bacteria 16942
257 Ga0501036_0317499 3300049572 Bacteria 1302
258 Ga0501037_0038753 3300049573 Bacteria 3510
259 Ga0501040_0256378 3300049576 Unclassified 1248
260 Ga0501043_0000800 3300049579 Bacteria 27945
261 Ga0501046_0019387 3300049580 Bacteria 5643
262 Ga0501047_0000136 3300049581 Bacteria 89236
263 Ga0501047_0020823 3300049581 Bacteria 6300
264 Ga0501048_0000039 3300049582 Bacteria 63521
265 Ga0501070_0019941 3300049586 Bacteria 5622
266 Ga0501072_0076485 3300049588 Bacteria 2649
267 Ga0501073_0018270 3300049589 Bacteria 5066
268 Ga0501073_0078246 3300049589 Bacteria 2301
269 Ga0501074_0005036 3300049590 Bacteria 9481
270 Ga0501074_0238835 3300049590 Bacteria 1293
271 Ga0501080_0000022 3300049742 Bacteria 90630
272 Ga0501083_0017951 3300049744 Bacteria 4934
273 Ga0501044_0009844 3300049823 Bacteria 10390
274 Ga0501044_0133703 3300049823 Bacteria 2473
275 nmdc:mga06z11_206351_c1 3300050494 Bacteria 1143
276 nmdc:mga07m45_55105_c2 3300050496 Bacteria 1903
277 nmdc:mga05p37_965690_c1 3300050507 Bacteria 910
278 nmdc:mga09592_172062_c1 3300050508 Bacteria 1873
279 nmdc:mga0qj67_7972_c1 3300050509 Bacteria 7831
280 nmdc:mga06r32_13372_c1 3300050510 Bacteria 7433
281 nmdc:mga06r32_9960_c1 3300050510 Bacteria 8577
282 nmdc:mga08y16_144820_c1 3300050511 Bacteria 2470
283 nmdc:mga08y16_156759_c1 3300050511 Bacteria 2366
284 nmdc:mga08y16_235356_c1 3300050511 Unclassified 1894
285 nmdc:mga0n895_48867_c1 3300050512 Bacteria 4143
286 Ga0495601_0001326 3300053077 Bacteria 13593
287 Ga0495601_0031702 3300053077 Bacteria 3286
288 Ga0495601_0031899 3300053077 Bacteria 3276
289 Ga0495612_0070569 3300053078 Bacteria 1456
290 Ga0500635_0004901 3300053080 Bacteria 3475
291 Ga0495595_0001054 3300053084 Bacteria 10648
292 Ga0495595_0014314 3300053084 Bacteria 3363
293 Ga0495595_0015875 3300053084 Bacteria 3215
294 Ga0495619_0006059 3300053085 Bacteria 7659
295 Ga0495619_0055713 3300053085 Bacteria 2619
296 Ga0500646_0085016 3300053090 Viruses 971
297 Ga0500641_0010825 3300053096 Bacteria 3304
298 Ga0500554_001201 3300053102 Bacteria 5027
299 Ga0500603_000963 3300053150 Bacteria 6805
300 Ga0500637_0008015 3300053178 Bacteria 5307
301 Ga0500657_137285 3300053728 Unclassified 936
302 Ga0501084_0369649 3300054114 Bacteria 1212
303 Ga0501082_0048067 3300060353 Bacteria 3677
304 Ga0501082_0161091 3300060353 Bacteria 1950
305 Ga0373947_0046323
306 JGI25404J52841_10006864
307 JGI25405J52794_10008474
308 Ga0065712_10070433
309 Ga0070658_10007874
310 Ga0070658_10248064
311 Ga0070683_100314548
312 Ga0070670_100167255
313 Ga0070680_100081901
314 Ga0070680_100260682
315 Ga0070680_100574272
316 Ga0070660_100099252
317 Ga0070660_100314710
318 Ga0070675_100066641
319 Ga0070671_100143111
320 Ga0070709_10188809
321 Ga0070714_100019188
322 Ga0070714_100058295
323 Ga0070713_100106946
324 Ga0070713_100682376
325 Ga0070711_100014051
326 Ga0070700_100001479
327 Ga0070681_10058843
328 Ga0070681_10114022
329 Ga0070685_10079726
330 Ga0070707_100071696
331 Ga0070698_100003731
332 Ga0070699_100054242
333 Ga0070679_100110111
334 Ga0070679_100353151
335 Ga0070679_100368501
336 Ga0070697_100030866
337 Ga0070697_100205215
338 Ga0068853_100510117
339 Ga0070693_100460563
340 Ga0068855_100041664
341 Ga0068855_100164426
342 Ga0068855_100526113
343 Ga0070664_100172884
344 Ga0070664_100194310
345 Ga0068856_100379931
346 Ga0068852_100061975
347 Ga0068852_100142231
348 Ga0068859_100008041
349 Ga0068859_100075510
350 Ga0081455_10000031
351 Ga0081455_10005956
352 Ga0081455_10014661
353 Ga0081455_10054090
354 Ga0081455_10067410
355 Ga0081538_10007058
356 Ga0081538_10008070
357 Ga0081538_10019479
358 Ga0081540_1001200
359 Ga0081540_1065179
360 Ga0070712_100042462
361 Ga0075367_10214089
362 Ga0075370_10067599
363 Ga0068871_100466773
364 Ga0075428_100297351
365 Ga0075434_100039278
366 Ga0075434_100463852
367 Ga0097620_100008041
368 Ga0097620_100075509
369 Ga0099794_10010561
370 Ga0111539_10068290
371 Ga0105247_10090667
372 Ga0114129_10025670
373 Ga0114129_10461860
374 Ga0114129_10614974
375 Ga0105248_10066779
376 Ga0105238_10090475
377 Ga0099796_10010685
378 Ga0157369_10269878
379 Ga0157378_10328020
380 Ga0163163_10078637
381 Ga0163163_10258168
382 Ga0157379_10127072
383 Ga0157376_10452885
384 Ga0206354_10798211
385 Ga0206353_10980335
386 Ga0213876_10131612
387 Ga0207647_10005455
388 Ga0207705_10178857
389 Ga0207705_10214861
390 Ga0207707_10048511
391 Ga0207707_10282688
392 Ga0207695_10002359
393 Ga0207695_10309515
394 Ga0207695_10453642
395 Ga0207693_10330999
396 Ga0207660_10395763
397 Ga0207662_10054658
398 Ga0207657_10009131
399 Ga0207657_10249699
400 Ga0207652_10032169
401 Ga0207652_10100921
402 Ga0207652_10228983
403 Ga0207681_10009572
404 Ga0207694_10038909
405 Ga0207694_10391505
406 Ga0207650_10136398
407 Ga0207700_10267643
408 Ga0207700_10529708
409 Ga0207664_10015866
410 Ga0207664_10153980
411 Ga0207664_10258403
412 Ga0207664_10589562
413 Ga0207670_10023023
414 Ga0207691_10038807
415 Ga0207711_10097898
416 Ga0207661_10169432
417 Ga0207679_10046232
418 Ga0207679_10132489
419 Ga0207667_10047725
420 Ga0207667_10414291
421 Ga0207667_10702035
422 Ga0207658_10051260
423 Ga0207708_10001296
424 Ga0207675_100058184
425 Ga0207698_10022747
426 Ga0207428_10313819
427 Ga0207428_10323861
428 Ga0265337_1003979
429 Ga0265325_10054981
430 Ga0265340_10012862
431 Ga0265313_10000577
432 Ga0265313_10065654
433 Ga0265314_10053185
434 Ga0265342_10000464
435 Ga0316583_10009929
436 Ga0307510_10045012
437 Ga0373944_0017604
438 Ga0373945_0003525
439 Ga0373953_0009710
440 Ga0373954_0014363
441 Ga0373956_0021026
442 Ga0373960_0007112
443 Ga0373943_0002092
444 Ga0373946_0006291
445 Ga0373955_0063781
446 Ga0373924_0044418
447 Ga0373931_0068097
448 Ga0373935_0008707
449 Ga0373935_0092923
450 Ga0373935_0242101
451 Ga0373927_0002617
452 Ga0373927_0034422
453 Ga0373927_0166533
454 Ga0373927_0220971
455 Ga0373933_0032376
456 Ga0373933_0140234
457 Ga0373947_0000303
458 Ga0373947_0066110
459 Ga0373947_0154914
460 Ga0373937_0032614
461 Ga0373937_0092165
462 Ga0373937_0101502
463 Ga0373937_0284543
464 Ga0373925_0049081
465 Ga0373925_0163540
466 Ga0436364_0931038
467 Ga0242420_009565
468 Ga0436365_1473399
469 Ga0436365_1703167
470 Ga0436360_0165678
471 Ga0436361_0829307
472 Ga0436363_1285858
473 Ga0466971_0171022
474 Ga0466960_0050236
475 Ga0466959_0235829
476 Ga0495592_0011187
477 Ga0495592_0322310
478 Ga0495603_0040354
479 Ga0495603_0312928
480 Ga0495629_0021736
481 Ga0495629_0150537
482 Ga0495651_0025932
483 Ga0495651_0051642
484 Ga0495651_0197468
485 Ga0495653_0049504
486 Ga0495580_0071122
487 Ga0495582_0061242
488 Ga0495639_0089919
489 Ga0495662_0007226
490 Ga0495664_0000202
491 Ga0495664_0311679
492 Ga0495584_0117346
493 Ga0495608_0243620
494 Ga0495616_0081891
495 Ga0495618_0004996
496 Ga0495618_0015879
497 Ga0495648_0001044
498 Ga0495648_0006355
499 Ga0495666_0077509
500 Ga0495652_0019081
501 Ga0495652_0085601
502 Ga0495665_0033806
503 Ga0495665_0059616
504 Ga0495640_0001275
505 Ga0495640_0022955
506 Ga0495640_0111073
507 Ga0495586_0027053
508 Ga0495587_0014525
509 Ga0495587_0093623
510 Ga0495587_0130267
511 Ga0495645_0008678
512 Ga0495667_0010201
513 Ga0495656_0017589
514 Ga0495634_0003024
515 Ga0495634_0036286
516 Ga0495634_0050976
517 Ga0495635_0001332
518 Ga0495659_0041121
519 Ga0495657_0287555
520 Ga0495599_0219071
521 Ga0495623_0138795
522 Ga0495623_0158977
523 Ga0495646_0017785
524 Ga0495658_0168716
525 Ga0495613_0066317
526 Ga0495613_0282783
527 Ga0495624_0010397
528 Ga0495624_0030534
529 Ga0495604_0057733
530 Ga0495604_0061971
531 Ga0495674_0065344
532 Ga0495680_0111769
533 Ga0495680_0173771
534 Ga0495675_0016456
535 Ga0495684_0010372
536 Ga0495684_0026865
537 Ga0495684_0140408
538 Ga0495684_0243515
539 Ga0495593_0042456
540 Ga0495602_0371668
541 Ga0496104_0083732
542 Ga0496104_0254980
543 Ga0496107_0069702
544 Ga0496107_0125145
545 Ga0496108_0004587
546 Ga0496109_0001606
547 Ga0496110_0124481
548 Ga0496110_0127109
549 Ga0496110_0229515
550 Ga0496110_0466719
551 Ga0496111_0003849
552 Ga0496113_0000122
553 Ga0496114_0160443
554 Ga0496114_0382984
555 Ga0496115_0021512
556 Ga0496115_0251411
557 Ga0501034_0015256
558 Ga0501034_0018661
559 Ga0501034_0529794
560 Ga0501036_0001733
561 Ga0501036_0317499
562 Ga0501037_0038753
563 Ga0501040_0256378
564 Ga0501043_0000800
565 Ga0501046_0019387
566 Ga0501047_0000136
567 Ga0501047_0020823
568 Ga0501048_0000039
569 Ga0501070_0019941
570 Ga0501072_0076485
571 Ga0501073_0018270
572 Ga0501073_0078246
573 Ga0501074_0005036
574 Ga0501074_0238835
575 Ga0501080_0000022
576 Ga0501083_0017951
577 Ga0501044_0009844
578 Ga0501044_0133703
579 nmdc:mga06z11_206351_c1
580 nmdc:mga07m45_55105_c2
581 nmdc:mga05p37_965690_c1
582 nmdc:mga09592_172062_c1
583 nmdc:mga0qj67_7972_c1
584 nmdc:mga06r32_13372_c1
585 nmdc:mga06r32_9960_c1
586 nmdc:mga08y16_144820_c1
587 nmdc:mga08y16_156759_c1
588 nmdc:mga08y16_235356_c1
589 nmdc:mga0n895_48867_c1
590 Ga0495601_0001326
591 Ga0495601_0031702
592 Ga0495601_0031899
593 Ga0495612_0070569
594 Ga0500635_0004901
595 Ga0495595_0001054
596 Ga0495595_0014314
597 Ga0495595_0015875
598 Ga0495619_0006059
599 Ga0495619_0055713
600 Ga0500646_0085016
601 Ga0500641_0010825
602 Ga0500554_001201
603 Ga0500603_000963
604 Ga0500637_0008015
605 Ga0500657_137285
606 Ga0501084_0369649
607 Ga0501082_0048067
608 Ga0501082_0161091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.7738 54 263
2p97-assembly1.cif.gz_A crystal structure of a putative metal-dependent hydrolase (ava_3068) from anabaena variabilis atcc 29413 at 1.65 a resolution 0.7634 54 263
6lfd-assembly3.cif.gz_C crystal structure of vmb-1 at ph5.5(bis-tris) 0.7585 53 270
5mmd-assembly2.cif.gz_F tmb-1. structural insights into tmb-1 and the role of residue 119 and 228 in substrate and inhibitor binding 0.7439 53 270
6lfd-assembly3.cif.gz_C crystal structure of vmb-1 at ph5.5(bis-tris) 0.7432 53 270
ID Description Score Start End Superfamily
af_Q2FV07_32_193_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7648 77 242 3.60.15.10
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7549 60 265 3.60.15.10
af_A0A1D6QA38_128_270_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7515 73 210 3.60.15.10
af_Q8RWE1_144_338_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7443 60 265 3.60.15.10
2p97B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7318 50 264 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7C3QIA7-F1-model_v4 MBL fold metallo-hydrolase 0.9957 3 268 GO:0016787
AF-A0A7W1AX02-F1-model_v4 MBL fold metallo-hydrolase 0.9956 136 269 GO:0016787
AF-A0A140K036-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9944 123 270
AF-A0A6H2BUP6-F1-model_v4 deleted 0.9935 3 268
AF-A0A1T4REB5-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9923 3 268

Map