F397658

General Info

Members Datasets Scaffolds Average Seq Length
304 159 608 447

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10011322|Ga0316578_100113221
Length 473
Sequence MVRIFRFGGMGGTGFVVGVYRSVASRAMQEILEAIQSGASGDDIANLPIPESYRAAFVKRDEISMFDGVESWDKDPRRSLHVDEVATPELAPDEVYIAVMASSINFNTVWTSIFEPLPTFGFLDRMGRQNDWGKRHALPYHVVGSDAAAVVLRVGSAVRNWKPGDRVTVHCNYVDDQDPSAHNDSMLATNQIIWGFETNFGGLADLAVVKANQLMPKPTHLTWEEAAVNALCSSTSYRMIVSENGAQMKQGDSVLIWGATGGIGGYAVQYVLNGGGTPIGVVSSPERAEQLRRMGCDAVIDRRAENYQFWSDEHTQDESEWRRFGKKIRELNDGEDVDIVFEHPGRSTMGASIFAVKRGGTVVTCAATSGYMVEFDNRHFWMKLKTLIGSHFANYAEAYAANKLLDQGRIQPLLTKTYDLSQVGEAALAVHHNEADGKLGVLCLAPEEGLGVDDPEKRERIGEDKITVFRGLA

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
63 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
70 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
74 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
75 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
76 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
77 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
82 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
154 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
155 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.92
Nodule 0
Rhizoplane 7.24
Rhizosphere 85.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10011322 3300031728 Bacteria 4662
2 JGI25405J52794_10004128 3300003911 Bacteria 2578
3 Ga0070670_100226423 3300005331 Bacteria 1627
4 Ga0068868_100122428 3300005338 Bacteria 2123
5 Ga0070713_100117886 3300005436 Bacteria 2324
6 Ga0070710_10096205 3300005437 Bacteria 1755
7 Ga0070711_100026409 3300005439 Bacteria 3806
8 Ga0070708_100005065 3300005445 Bacteria 10431
9 Ga0070708_100033105 3300005445 Bacteria 4489
10 Ga0070708_100092201 3300005445 Bacteria 2760
11 Ga0070681_10049730 3300005458 Bacteria 4185
12 Ga0070706_100021915 3300005467 Bacteria 5883
13 Ga0070697_100225966 3300005536 Bacteria 1596
14 Ga0068858_100084367 3300005842 Bacteria 2955
15 Ga0068860_100031853 3300005843 Bacteria 5069
16 Ga0068860_100064868 3300005843 Bacteria 3468
17 Ga0081455_10002571 3300005937 Bacteria 21536
18 Ga0081455_10008051 3300005937 Bacteria 11008
19 Ga0081455_10032572 3300005937 Bacteria 4695
20 Ga0081455_10087048 3300005937 Bacteria 2543
21 Ga0081455_10139826 3300005937 Bacteria 1882
22 Ga0081538_10000261 3300005981 Bacteria 59962
23 Ga0081538_10007404 3300005981 Bacteria 9505
24 Ga0081538_10044132 3300005981 Bacteria 2785
25 Ga0075365_10022512 3300006038 Bacteria 3949
26 Ga0075365_10045632 3300006038 Bacteria 2875
27 Ga0075363_100014809 3300006048 Bacteria 3821
28 Ga0075364_10001216 3300006051 Bacteria 13842
29 Ga0070712_100143728 3300006175 Bacteria 1823
30 Ga0075362_10063265 3300006177 Bacteria 1678
31 Ga0075428_100007938 3300006844 Bacteria 11771
32 Ga0075428_100013209 3300006844 Bacteria 9187
33 Ga0075428_100085617 3300006844 Bacteria 3437
34 Ga0075428_100272325 3300006844 Bacteria 1821
35 Ga0075430_100001082 3300006846 Bacteria 21605
36 Ga0075430_100040740 3300006846 Bacteria 3931
37 Ga0075430_100041451 3300006846 Bacteria 3895
38 Ga0075431_100000382 3300006847 Bacteria 35471
39 Ga0075431_100013451 3300006847 Bacteria 8265
40 Ga0075431_100026972 3300006847 Bacteria 5893
41 Ga0075431_100299599 3300006847 Bacteria 1624
42 Ga0075433_10002799 3300006852 Bacteria 13361
43 Ga0075434_100052413 3300006871 Bacteria 4054
44 Ga0075429_100001061 3300006880 Bacteria 21985
45 Ga0075429_100015746 3300006880 Bacteria 6550
46 Ga0075435_100000649 3300007076 Bacteria 21419
47 Ga0111539_10001739 3300009094 Bacteria 28948
48 Ga0111539_10057036 3300009094 Bacteria 4640
49 Ga0105245_10019231 3300009098 Bacteria 5981
50 Ga0114129_10000014 3300009147 Bacteria 130267
51 Ga0114129_10014765 3300009147 Bacteria 11128
52 Ga0114129_10026730 3300009147 Bacteria 8174
53 Ga0114129_10154188 3300009147 Bacteria 3143
54 Ga0105242_10047190 3300009176 Bacteria 3497
55 Ga0157369_10396078 3300013105 Bacteria 1433
56 Ga0157378_10244938 3300013297 Bacteria 1714
57 Ga0157379_10229250 3300014968 Bacteria 1683
58 Ga0163161_10134969 3300017792 Bacteria 1865
59 Ga0224712_10040435 3300022467 Bacteria 1754
60 Ga0224572_1004886 3300024225 Bacteria 2363
61 Ga0207684_10031705 3300025910 Bacteria 4496
62 Ga0207707_10075827 3300025912 Bacteria 2935
63 Ga0207707_10114481 3300025912 Bacteria 2357
64 Ga0207693_10085288 3300025915 Bacteria 2474
65 Ga0207652_10100234 3300025921 Bacteria 2557
66 Ga0207646_10057553 3300025922 Bacteria 3473
67 Ga0207700_10060058 3300025928 Bacteria 2878
68 Ga0207644_10001563 3300025931 Bacteria 14786
69 Ga0207703_10023258 3300026035 Bacteria 4868
70 Ga0207683_10110863 3300026121 Bacteria 2457
71 Ga0268264_10049574 3300028381 Bacteria 3494
72 Ga0268264_10096314 3300028381 Bacteria 2563
73 Ga0265336_10011405 3300028666 Bacteria 3023
74 Ga0265338_10001198 3300028800 Bacteria 42863
75 Ga0265325_10002246 3300031241 Bacteria 13093
76 Ga0265339_10000844 3300031249 Bacteria 23632
77 Ga0265327_10000119 3300031251 Bacteria 171254
78 Ga0265327_10001494 3300031251 Bacteria 29041
79 Ga0265327_10028715 3300031251 Bacteria 3174
80 Ga0265313_10001476 3300031595 Bacteria 21905
81 Ga0316579_10039194 3300031691 Bacteria 2194
82 Ga0316576_10003010 3300031727 Bacteria 9785
83 Ga0316576_10006021 3300031727 Bacteria 7495
84 Ga0316576_10006783 3300031727 Bacteria 7155
85 Ga0316576_10093723 3300031727 Bacteria 2239
86 Ga0316578_10008321 3300031728 Bacteria 5272
87 Ga0316577_10044941 3300031733 Bacteria 2470
88 Ga0307410_10096527 3300031852 Bacteria 2110
89 Ga0307409_100028249 3300031995 Bacteria 3992
90 Ga0307409_100028796 3300031995 Bacteria 3964
91 Ga0307416_100028308 3300032002 Bacteria 4165
92 Ga0307415_100010280 3300032126 Bacteria 5292
93 Ga0307415_100238304 3300032126 Bacteria 1470
94 Ga0316580_10021425 3300032139 Bacteria 1992
95 Ga0373928_0008710 3300035084 Bacteria 1974
96 Ga0373929_0000165 3300035085 Bacteria 11579
97 Ga0373932_0000361 3300035112 Bacteria 14003
98 Ga0373955_0122297 3300035172 Bacteria 1514
99 Ga0316574_0007280 3300035398 Bacteria 6056
100 Ga0316574_0008199 3300035398 Bacteria 5787
101 Ga0316574_0011560 3300035398 Bacteria 5021
102 Ga0316574_0011832 3300035398 Bacteria 4972
103 Ga0316574_0014607 3300035398 Bacteria 4540
104 Ga0373931_0000003 3300035691 Bacteria 560286
105 Ga0373931_0000056 3300035691 Bacteria 56750
106 Ga0316584_0008322 3300036712 Bacteria 7141
107 Ga0316584_0018648 3300036712 Bacteria 5008
108 Ga0400485_13299 3300038735 Bacteria 4496
109 Ga0400483_137939 3300039062 Bacteria 37909
110 Ga0436365_0289701 3300039437 Bacteria 14682
111 Ga0451837_0552158 3300041494 Bacteria 1664
112 Ga0439450_000328 3300042008 Bacteria 5940
113 Ga0439452_015874 3300042010 Bacteria 2056
114 Ga0439463_009209 3300042016 Bacteria 2430
115 Ga0439434_0005173 3300042435 Bacteria 3815
116 Ga0439464_0007352 3300042439 Bacteria 2880
117 Ga0495629_0090062 3300046459 Bacteria 2140
118 Ga0495653_0185831 3300046463 Bacteria 1422
119 Ga0495582_0052905 3300046473 Bacteria 2239
120 Ga0495582_0082709 3300046473 Bacteria 1784
121 Ga0495583_0020011 3300046506 Bacteria 3480
122 Ga0495608_0031634 3300046511 Bacteria 3577
123 Ga0495618_0073842 3300046514 Bacteria 2172
124 Ga0495630_0014655 3300046517 Bacteria 5715
125 Ga0495630_0057503 3300046517 Bacteria 2915
126 Ga0495666_0042734 3300046526 Bacteria 2191
127 Ga0495640_0017102 3300046533 Bacteria 5412
128 Ga0495640_0055930 3300046533 Bacteria 2698
129 Ga0495609_0080625 3300046538 Bacteria 1423
130 Ga0495634_0061739 3300046642 Bacteria 2490
131 Ga0495657_0129260 3300046675 Bacteria 1584
132 Ga0495613_0002438 3300046689 Bacteria 14034
133 Ga0495613_0106155 3300046689 Bacteria 2027
134 Ga0495670_0032125 3300046691 Bacteria 2610
135 Ga0495600_0027412 3300046809 Bacteria 3681
136 Ga0495672_0009022 3300047320 Bacteria 7273
137 Ga0495676_0048748 3300047321 Bacteria 3412
138 Ga0495680_0061815 3300047322 Bacteria 2880
139 Ga0495684_0078728 3300047471 Bacteria 2502
140 Ga0495602_0107279 3300048088 Bacteria 2277
141 Ga0495602_0219350 3300048088 Bacteria 1437
142 Ga0496100_0033778 3300048903 Bacteria 3203
143 Ga0496101_0002909 3300048904 Bacteria 10543
144 Ga0496102_0043792 3300048905 Bacteria 4060
145 Ga0496102_0053516 3300048905 Bacteria 3679
146 Ga0496104_0025374 3300048907 Bacteria 5463
147 Ga0496105_0002801 3300048908 Bacteria 12753
148 Ga0496108_0009401 3300048911 Bacteria 7916
149 Ga0496108_0081012 3300048911 Bacteria 2751
150 Ga0496109_0005841 3300048912 Bacteria 10321
151 Ga0496109_0035190 3300048912 Bacteria 4516
152 Ga0496109_0078134 3300048912 Bacteria 3047
153 Ga0496109_0099309 3300048912 Bacteria 2700
154 Ga0496110_0036938 3300048913 Bacteria 4244
155 Ga0496110_0076912 3300048913 Bacteria 2968
156 Ga0496111_0022229 3300048914 Bacteria 4437
157 Ga0496111_0163127 3300048914 Bacteria 1655
158 Ga0496112_0028758 3300048915 Bacteria 5369
159 Ga0496114_0015846 3300048917 Bacteria 6066
160 Ga0496114_0168969 3300048917 Bacteria 1905
161 Ga0496114_0195004 3300048917 Bacteria 1773
162 Ga0496115_0001905 3300048918 Bacteria 14897
163 Ga0496115_0249872 3300048918 Bacteria 1460
164 Ga0501033_0002643 3300049570 Bacteria 15076
165 Ga0501033_0083559 3300049570 Bacteria 2340
166 Ga0501034_0005170 3300049571 Bacteria 14311
167 Ga0501034_0005438 3300049571 Bacteria 13920
168 Ga0501034_0021673 3300049571 Bacteria 6546
169 Ga0501034_0058873 3300049571 Bacteria 3859
170 Ga0501034_0120329 3300049571 Bacteria 2612
171 Ga0501036_0029299 3300049572 Bacteria 4653
172 Ga0501037_0001727 3300049573 Bacteria 15861
173 Ga0501037_0080407 3300049573 Bacteria 2365
174 Ga0501037_0098839 3300049573 Bacteria 2108
175 Ga0501037_0131061 3300049573 Bacteria 1798
176 Ga0501038_0042551 3300049574 Bacteria 3956
177 Ga0501039_0004773 3300049575 Bacteria 10269
178 Ga0501039_0023245 3300049575 Bacteria 4757
179 Ga0501039_0059616 3300049575 Bacteria 2956
180 Ga0501039_0091329 3300049575 Bacteria 2373
181 Ga0501040_0001213 3300049576 Bacteria 16419
182 Ga0501040_0004093 3300049576 Bacteria 9479
183 Ga0501040_0102241 3300049576 Bacteria 2000
184 Ga0501041_0005510 3300049577 Bacteria 7402
185 Ga0501041_0016971 3300049577 Bacteria 4332
186 Ga0501042_0030441 3300049578 Bacteria 3811
187 Ga0501042_0041293 3300049578 Bacteria 3280
188 Ga0501042_0044953 3300049578 Bacteria 3147
189 Ga0501042_0054649 3300049578 Bacteria 2848
190 Ga0501043_0103348 3300049579 Bacteria 2239
191 Ga0501046_0005993 3300049580 Bacteria 10813
192 Ga0501046_0036542 3300049580 Bacteria 3952
193 Ga0501047_0018348 3300049581 Bacteria 6705
194 Ga0501047_0044887 3300049581 Bacteria 4272
195 Ga0501047_0119394 3300049581 Bacteria 2519
196 Ga0501048_0028970 3300049582 Bacteria 4019
197 Ga0501048_0097417 3300049582 Bacteria 2075
198 Ga0501048_0192219 3300049582 Bacteria 1446
199 Ga0501067_0048024 3300049583 Bacteria 2367
200 Ga0501068_0004618 3300049584 Bacteria 7494
201 Ga0501068_0013067 3300049584 Bacteria 4720
202 Ga0501068_0016461 3300049584 Bacteria 4262
203 Ga0501068_0066473 3300049584 Bacteria 2196
204 Ga0501069_0010392 3300049585 Bacteria 4925
205 Ga0501070_0000059 3300049586 Bacteria 94646
206 Ga0501070_0004518 3300049586 Bacteria 11939
207 Ga0501070_0009314 3300049586 Bacteria 8306
208 Ga0501070_0039181 3300049586 Bacteria 3953
209 Ga0501071_0018814 3300049587 Bacteria 4788
210 Ga0501071_0020442 3300049587 Bacteria 4601
211 Ga0501071_0056829 3300049587 Bacteria 2827
212 Ga0501071_0127685 3300049587 Bacteria 1888
213 Ga0501071_0228842 3300049587 Bacteria 1400
214 Ga0501072_0014577 3300049588 Bacteria 6023
215 Ga0501072_0046634 3300049588 Bacteria 3411
216 Ga0501072_0049365 3300049588 Bacteria 3312
217 Ga0501072_0330295 3300049588 Bacteria 1211
218 Ga0501073_0002077 3300049589 Bacteria 14979
219 Ga0501073_0042386 3300049589 Bacteria 3212
220 Ga0501073_0112770 3300049589 Bacteria 1886
221 Ga0501073_0188767 3300049589 Bacteria 1426
222 Ga0501074_0039035 3300049590 Bacteria 3439
223 Ga0501074_0062320 3300049590 Bacteria 2686
224 Ga0501074_0095236 3300049590 Bacteria 2132
225 Ga0501075_0019085 3300049591 Bacteria 4972
226 Ga0501075_0102488 3300049591 Bacteria 2174
227 Ga0501075_0123805 3300049591 Bacteria 1968
228 Ga0501076_0005748 3300049592 Bacteria 8939
229 Ga0501076_0010613 3300049592 Bacteria 6841
230 Ga0501076_0014047 3300049592 Bacteria 6019
231 Ga0501076_0019997 3300049592 Bacteria 5122
232 Ga0501076_0034209 3300049592 Bacteria 3971
233 Ga0501077_0035613 3300049593 Bacteria 3169
234 Ga0501079_0013953 3300049741 Bacteria 6128
235 Ga0501079_0035653 3300049741 Bacteria 3830
236 Ga0501079_0071978 3300049741 Bacteria 2671
237 Ga0501080_0000061 3300049742 Bacteria 70965
238 Ga0501080_0005461 3300049742 Bacteria 11342
239 Ga0501080_0010100 3300049742 Bacteria 8633
240 Ga0501080_0033953 3300049742 Bacteria 4763
241 Ga0501080_0082692 3300049742 Bacteria 2982
242 Ga0501080_0205237 3300049742 Bacteria 1808
243 Ga0501081_0033866 3300049743 Bacteria 3473
244 Ga0501081_0045717 3300049743 Bacteria 3007
245 Ga0501081_0063097 3300049743 Bacteria 2571
246 Ga0501081_0218837 3300049743 Bacteria 1385
247 Ga0501083_0007529 3300049744 Bacteria 7716
248 Ga0501083_0014032 3300049744 Bacteria 5600
249 Ga0501083_0100431 3300049744 Bacteria 1908
250 Ga0501035_0047528 3300049822 Bacteria 3852
251 Ga0501035_0153298 3300049822 Bacteria 1999
252 Ga0501035_0285465 3300049822 Bacteria 1394
253 Ga0501044_0001005 3300049823 Bacteria 33948
254 Ga0501044_0002909 3300049823 Bacteria 19488
255 Ga0501044_0016227 3300049823 Bacteria 8005
256 Ga0501045_0016619 3300049824 Bacteria 5227
257 Ga0501045_0025983 3300049824 Bacteria 4210
258 Ga0501045_0071445 3300049824 Bacteria 2554
259 Ga0501045_0151598 3300049824 Bacteria 1725
260 nmdc:mga03n38_66841_c1 3300050490 Bacteria 1652
261 nmdc:mga03n38_8040_c1 3300050490 Bacteria 3763
262 nmdc:mga00v17_1488_c1 3300050491 Bacteria 12249
263 nmdc:mga00v17_23246_c1 3300050491 Bacteria 3585
264 nmdc:mga0yw44_13006_c1 3300050492 Bacteria 4363
265 nmdc:mga0yw44_13331_c1 3300050492 Bacteria 4324
266 nmdc:mga0yw44_174138_c1 3300050492 Bacteria 1414
267 nmdc:mga0yw44_39796_c1 3300050492 Bacteria 2790
268 nmdc:mga05p37_104836_c1 3300050507 Bacteria 3479
269 nmdc:mga05p37_257_c1 3300050507 Bacteria 54851
270 nmdc:mga09592_27298_c1 3300050508 Bacteria 4737
271 nmdc:mga09592_961_c1 3300050508 Bacteria 22726
272 nmdc:mga0qj67_123692_c1 3300050509 Bacteria 2093
273 nmdc:mga0qj67_2497_c1 3300050509 Bacteria 13123
274 nmdc:mga0qj67_289_c1 3300050509 Bacteria 35087
275 nmdc:mga06r32_138500_c1 3300050510 Bacteria 2408
276 nmdc:mga06r32_1799_c1 3300050510 Bacteria 19201
277 nmdc:mga06r32_30121_c1 3300050510 Bacteria 5092
278 nmdc:mga06r32_47107_c1 3300050510 Bacteria 4117
279 nmdc:mga08y16_223814_c1 3300050511 Bacteria 1947
280 nmdc:mga08y16_30381_c1 3300050511 Bacteria 5687
281 nmdc:mga0rr50_90248_c1 3300050513 Bacteria 2384
282 nmdc:mga08x19_64199_c1 3300050514 Bacteria 2383
283 Ga0495595_0007830 3300053084 Bacteria 4375
284 Ga0495619_0017444 3300053085 Bacteria 4544
285 Ga0495619_0019186 3300053085 Bacteria 4346
286 Ga0495619_0056125 3300053085 Bacteria 2610
287 Ga0500583_0073058 3300053092 Bacteria 1644
288 Ga0500566_0000411 3300053094 Bacteria 23837
289 Ga0500568_0000192 3300053139 Bacteria 53173
290 Ga0500616_0001306 3300053153 Bacteria 24694
291 Ga0500616_0004812 3300053153 Bacteria 9448
292 Ga0501084_0000063 3300054114 Bacteria 81573
293 Ga0501084_0000101 3300054114 Bacteria 63579
294 Ga0501084_0018264 3300054114 Bacteria 5840
295 Ga0501084_0047361 3300054114 Bacteria 3601
296 Ga0501084_0054428 3300054114 Bacteria 3348
297 Ga0501082_0017718 3300060353 Bacteria 6134
298 Ga0501082_0046114 3300060353 Bacteria 3758
299 Ga0501082_0067760 3300060353 Bacteria 3074
300 Ga0530510_0002968 3300061734 Bacteria 11636
301 Ga0530510_0023924 3300061734 Bacteria 4356
302 Ga0530510_0056349 3300061734 Bacteria 2839
303 Ga0530510_0104613 3300061734 Bacteria 2071
304 Ga0530510_0125538 3300061734 Bacteria 1886
305 Ga0316578_10011322
306 JGI25405J52794_10004128
307 Ga0070670_100226423
308 Ga0068868_100122428
309 Ga0070713_100117886
310 Ga0070710_10096205
311 Ga0070711_100026409
312 Ga0070708_100005065
313 Ga0070708_100033105
314 Ga0070708_100092201
315 Ga0070681_10049730
316 Ga0070706_100021915
317 Ga0070697_100225966
318 Ga0068858_100084367
319 Ga0068860_100031853
320 Ga0068860_100064868
321 Ga0081455_10002571
322 Ga0081455_10008051
323 Ga0081455_10032572
324 Ga0081455_10087048
325 Ga0081455_10139826
326 Ga0081538_10000261
327 Ga0081538_10007404
328 Ga0081538_10044132
329 Ga0075365_10022512
330 Ga0075365_10045632
331 Ga0075363_100014809
332 Ga0075364_10001216
333 Ga0070712_100143728
334 Ga0075362_10063265
335 Ga0075428_100007938
336 Ga0075428_100013209
337 Ga0075428_100085617
338 Ga0075428_100272325
339 Ga0075430_100001082
340 Ga0075430_100040740
341 Ga0075430_100041451
342 Ga0075431_100000382
343 Ga0075431_100013451
344 Ga0075431_100026972
345 Ga0075431_100299599
346 Ga0075433_10002799
347 Ga0075434_100052413
348 Ga0075429_100001061
349 Ga0075429_100015746
350 Ga0075435_100000649
351 Ga0111539_10001739
352 Ga0111539_10057036
353 Ga0105245_10019231
354 Ga0114129_10000014
355 Ga0114129_10014765
356 Ga0114129_10026730
357 Ga0114129_10154188
358 Ga0105242_10047190
359 Ga0157369_10396078
360 Ga0157378_10244938
361 Ga0157379_10229250
362 Ga0163161_10134969
363 Ga0224712_10040435
364 Ga0224572_1004886
365 Ga0207684_10031705
366 Ga0207707_10075827
367 Ga0207707_10114481
368 Ga0207693_10085288
369 Ga0207652_10100234
370 Ga0207646_10057553
371 Ga0207700_10060058
372 Ga0207644_10001563
373 Ga0207703_10023258
374 Ga0207683_10110863
375 Ga0268264_10049574
376 Ga0268264_10096314
377 Ga0265336_10011405
378 Ga0265338_10001198
379 Ga0265325_10002246
380 Ga0265339_10000844
381 Ga0265327_10000119
382 Ga0265327_10001494
383 Ga0265327_10028715
384 Ga0265313_10001476
385 Ga0316579_10039194
386 Ga0316576_10003010
387 Ga0316576_10006021
388 Ga0316576_10006783
389 Ga0316576_10093723
390 Ga0316578_10008321
391 Ga0316577_10044941
392 Ga0307410_10096527
393 Ga0307409_100028249
394 Ga0307409_100028796
395 Ga0307416_100028308
396 Ga0307415_100010280
397 Ga0307415_100238304
398 Ga0316580_10021425
399 Ga0373928_0008710
400 Ga0373929_0000165
401 Ga0373932_0000361
402 Ga0373955_0122297
403 Ga0316574_0007280
404 Ga0316574_0008199
405 Ga0316574_0011560
406 Ga0316574_0011832
407 Ga0316574_0014607
408 Ga0373931_0000003
409 Ga0373931_0000056
410 Ga0316584_0008322
411 Ga0316584_0018648
412 Ga0400485_13299
413 Ga0400483_137939
414 Ga0436365_0289701
415 Ga0451837_0552158
416 Ga0439450_000328
417 Ga0439452_015874
418 Ga0439463_009209
419 Ga0439434_0005173
420 Ga0439464_0007352
421 Ga0495629_0090062
422 Ga0495653_0185831
423 Ga0495582_0052905
424 Ga0495582_0082709
425 Ga0495583_0020011
426 Ga0495608_0031634
427 Ga0495618_0073842
428 Ga0495630_0014655
429 Ga0495630_0057503
430 Ga0495666_0042734
431 Ga0495640_0017102
432 Ga0495640_0055930
433 Ga0495609_0080625
434 Ga0495634_0061739
435 Ga0495657_0129260
436 Ga0495613_0002438
437 Ga0495613_0106155
438 Ga0495670_0032125
439 Ga0495600_0027412
440 Ga0495672_0009022
441 Ga0495676_0048748
442 Ga0495680_0061815
443 Ga0495684_0078728
444 Ga0495602_0107279
445 Ga0495602_0219350
446 Ga0496100_0033778
447 Ga0496101_0002909
448 Ga0496102_0043792
449 Ga0496102_0053516
450 Ga0496104_0025374
451 Ga0496105_0002801
452 Ga0496108_0009401
453 Ga0496108_0081012
454 Ga0496109_0005841
455 Ga0496109_0035190
456 Ga0496109_0078134
457 Ga0496109_0099309
458 Ga0496110_0036938
459 Ga0496110_0076912
460 Ga0496111_0022229
461 Ga0496111_0163127
462 Ga0496112_0028758
463 Ga0496114_0015846
464 Ga0496114_0168969
465 Ga0496114_0195004
466 Ga0496115_0001905
467 Ga0496115_0249872
468 Ga0501033_0002643
469 Ga0501033_0083559
470 Ga0501034_0005170
471 Ga0501034_0005438
472 Ga0501034_0021673
473 Ga0501034_0058873
474 Ga0501034_0120329
475 Ga0501036_0029299
476 Ga0501037_0001727
477 Ga0501037_0080407
478 Ga0501037_0098839
479 Ga0501037_0131061
480 Ga0501038_0042551
481 Ga0501039_0004773
482 Ga0501039_0023245
483 Ga0501039_0059616
484 Ga0501039_0091329
485 Ga0501040_0001213
486 Ga0501040_0004093
487 Ga0501040_0102241
488 Ga0501041_0005510
489 Ga0501041_0016971
490 Ga0501042_0030441
491 Ga0501042_0041293
492 Ga0501042_0044953
493 Ga0501042_0054649
494 Ga0501043_0103348
495 Ga0501046_0005993
496 Ga0501046_0036542
497 Ga0501047_0018348
498 Ga0501047_0044887
499 Ga0501047_0119394
500 Ga0501048_0028970
501 Ga0501048_0097417
502 Ga0501048_0192219
503 Ga0501067_0048024
504 Ga0501068_0004618
505 Ga0501068_0013067
506 Ga0501068_0016461
507 Ga0501068_0066473
508 Ga0501069_0010392
509 Ga0501070_0000059
510 Ga0501070_0004518
511 Ga0501070_0009314
512 Ga0501070_0039181
513 Ga0501071_0018814
514 Ga0501071_0020442
515 Ga0501071_0056829
516 Ga0501071_0127685
517 Ga0501071_0228842
518 Ga0501072_0014577
519 Ga0501072_0046634
520 Ga0501072_0049365
521 Ga0501072_0330295
522 Ga0501073_0002077
523 Ga0501073_0042386
524 Ga0501073_0112770
525 Ga0501073_0188767
526 Ga0501074_0039035
527 Ga0501074_0062320
528 Ga0501074_0095236
529 Ga0501075_0019085
530 Ga0501075_0102488
531 Ga0501075_0123805
532 Ga0501076_0005748
533 Ga0501076_0010613
534 Ga0501076_0014047
535 Ga0501076_0019997
536 Ga0501076_0034209
537 Ga0501077_0035613
538 Ga0501079_0013953
539 Ga0501079_0035653
540 Ga0501079_0071978
541 Ga0501080_0000061
542 Ga0501080_0005461
543 Ga0501080_0010100
544 Ga0501080_0033953
545 Ga0501080_0082692
546 Ga0501080_0205237
547 Ga0501081_0033866
548 Ga0501081_0045717
549 Ga0501081_0063097
550 Ga0501081_0218837
551 Ga0501083_0007529
552 Ga0501083_0014032
553 Ga0501083_0100431
554 Ga0501035_0047528
555 Ga0501035_0153298
556 Ga0501035_0285465
557 Ga0501044_0001005
558 Ga0501044_0002909
559 Ga0501044_0016227
560 Ga0501045_0016619
561 Ga0501045_0025983
562 Ga0501045_0071445
563 Ga0501045_0151598
564 nmdc:mga03n38_66841_c1
565 nmdc:mga03n38_8040_c1
566 nmdc:mga00v17_1488_c1
567 nmdc:mga00v17_23246_c1
568 nmdc:mga0yw44_13006_c1
569 nmdc:mga0yw44_13331_c1
570 nmdc:mga0yw44_174138_c1
571 nmdc:mga0yw44_39796_c1
572 nmdc:mga05p37_104836_c1
573 nmdc:mga05p37_257_c1
574 nmdc:mga09592_27298_c1
575 nmdc:mga09592_961_c1
576 nmdc:mga0qj67_123692_c1
577 nmdc:mga0qj67_2497_c1
578 nmdc:mga0qj67_289_c1
579 nmdc:mga06r32_138500_c1
580 nmdc:mga06r32_1799_c1
581 nmdc:mga06r32_30121_c1
582 nmdc:mga06r32_47107_c1
583 nmdc:mga08y16_223814_c1
584 nmdc:mga08y16_30381_c1
585 nmdc:mga0rr50_90248_c1
586 nmdc:mga08x19_64199_c1
587 Ga0495595_0007830
588 Ga0495619_0017444
589 Ga0495619_0019186
590 Ga0495619_0056125
591 Ga0500583_0073058
592 Ga0500566_0000411
593 Ga0500568_0000192
594 Ga0500616_0001306
595 Ga0500616_0004812
596 Ga0501084_0000063
597 Ga0501084_0000101
598 Ga0501084_0018264
599 Ga0501084_0047361
600 Ga0501084_0054428
601 Ga0501082_0017718
602 Ga0501082_0046114
603 Ga0501082_0067760
604 Ga0530510_0002968
605 Ga0530510_0023924
606 Ga0530510_0056349
607 Ga0530510_0104613
608 Ga0530510_0125538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

262

407

0.86

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

91

219

0.85

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

294

441

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6na4-assembly1.cif.gz_B co crystal structure of ecr with butryl-coa 0.978 2 440
4a10-assembly1.cif.gz_A apo-structure of 2-octenoyl-coa carboxylase reductase cinf from streptomyces sp. 0.9758 4 440
3krt-assembly1.cif.gz_D crystal structure of putative crotonyl coa reductase from streptomyces coelicolor a3(2) 0.9735 2 440
3hzz-assembly1.cif.gz_C 2.4 angstrom crystal structure of streptomyces collinus crotonyl coa carboxylase/reductase 0.9689 2 440
4a10-assembly1.cif.gz_C apo-structure of 2-octenoyl-coa carboxylase reductase cinf from streptomyces sp. 0.968 4 440
ID Description Score Start End Superfamily
3krtC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9716 2 440 3.90.180.10
3krtC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9587 2 440 3.90.180.10
4a10D01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9547 4 437 3.90.180.10
3krtB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 218 363 3.40.50.720
3krtB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.94 218 363 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q4D0X9-F1-model_v4 Crotonyl-CoA carboxylase/reductase 0.9919 1 118
AF-A0A7K1CZK0-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.986 1 178
AF-A0A0R2QLS4-F1-model_v4 Crotonyl-CoA reductase 0.9856 1 302 GO:0016491
AF-A0A1V5F8B9-F1-model_v4 deleted 0.9838 1 247
AF-A0A4D4MY77-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9838 4 139

Map