F397648

General Info

Members Datasets Scaffolds Average Seq Length
304 219 608 118

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10004615|Ga0265328_100046155
Length 138
Sequence MTGGAAEFGDNPPHRRMGGELMAYMLLIVEPAGQRTTRTESEGRALYERMLRFSAELQSRGVLKLAQSLKTDTVGARVRRDGDKSSVVDGPFAEAKEMIGGFFLLECDTRSEAIAIARECPAAEWATVEVRELGPCFE

Samples

Sample ID Description Type Environment
1 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
134 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
181 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 2643221569 Achromobacter sp. Root565 Isolate Unclassified
216 2643221594 Achromobacter sp. Root170 Isolate Unclassified
217 2643221621 Achromobacter sp. Root83 Isolate Unclassified
218 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
219 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 0.99
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0
Rhizoplane 2.96
Rhizosphere 81.25
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265328_10004615 3300031239 Bacteria 5965
2 JGI24744J21845_10058199 3300002077 Bacteria 708
3 rootH1_10388109 3300003323 Unclassified 1753
4 Ga0058863_11299941 3300004799 Unclassified 545
5 Ga0058861_11859955 3300004800 Bacteria 1590
6 Ga0058862_12767649 3300004803 Bacteria 1967
7 Ga0065714_10416524 3300005288 Bacteria 578
8 Ga0070683_100023239 3300005329 Bacteria 5544
9 Ga0070683_100617153 3300005329 Unclassified 1038
10 Ga0070690_100538262 3300005330 Bacteria 879
11 Ga0070670_102027595 3300005331 Bacteria 530
12 Ga0068869_100088832 3300005334 Bacteria 2320
13 Ga0068869_100484561 3300005334 Bacteria 1030
14 Ga0068869_100569986 3300005334 Bacteria 953
15 Ga0070666_10112657 3300005335 Bacteria 1882
16 Ga0070680_100036515 3300005336 Bacteria 3970
17 Ga0070682_100719586 3300005337 Unclassified 802
18 Ga0068868_100187753 3300005338 Bacteria 1718
19 Ga0070668_100148910 3300005347 Bacteria 1891
20 Ga0070669_100603931 3300005353 Bacteria 919
21 Ga0070675_100359660 3300005354 Bacteria 1292
22 Ga0070671_100062432 3300005355 Bacteria 3102
23 Ga0070671_101272368 3300005355 Bacteria 648
24 Ga0070659_100654269 3300005366 Unclassified 906
25 Ga0070667_100000068 3300005367 Bacteria 127663
26 Ga0070667_100440210 3300005367 Bacteria 1190
27 Ga0070667_100727985 3300005367 Bacteria 919
28 Ga0070714_100846320 3300005435 Bacteria 887
29 Ga0070713_100053256 3300005436 Bacteria 3353
30 Ga0070710_10281604 3300005437 Bacteria 1079
31 Ga0070711_100206262 3300005439 Bacteria 1519
32 Ga0070663_100769164 3300005455 Bacteria 824
33 Ga0070678_100809537 3300005456 Bacteria 851
34 Ga0070678_101187289 3300005456 Bacteria 707
35 Ga0070681_10105250 3300005458 Bacteria 2764
36 Ga0070679_100258360 3300005530 Unclassified 1697
37 Ga0070684_100051456 3300005535 Bacteria 3578
38 Ga0070672_100593827 3300005543 Bacteria 964
39 Ga0070672_100648235 3300005543 Bacteria 922
40 Ga0070665_100034144 3300005548 Bacteria 5115
41 Ga0070665_100114583 3300005548 Unclassified 2698
42 Ga0070665_101466181 3300005548 Bacteria 691
43 Ga0068855_100012669 3300005563 Bacteria 10177
44 Ga0068855_100084571 3300005563 Bacteria 3673
45 Ga0068857_100239438 3300005577 Bacteria 1661
46 Ga0068857_100346572 3300005577 Bacteria 1375
47 Ga0068856_100171489 3300005614 Bacteria 2182
48 Ga0068856_101342889 3300005614 Bacteria 730
49 Ga0068859_100090494 3300005617 Bacteria 3111
50 Ga0068859_100166092 3300005617 Bacteria 2287
51 Ga0068864_100020426 3300005618 Bacteria 5541
52 Ga0068864_100041325 3300005618 Bacteria 3944
53 Ga0068870_10221096 3300005840 Bacteria 1159
54 Ga0068863_100064087 3300005841 Bacteria 3476
55 Ga0068863_100167329 3300005841 Bacteria 2108
56 Ga0068858_101575846 3300005842 Bacteria 648
57 Ga0068860_100003481 3300005843 Bacteria 16207
58 Ga0068860_100052159 3300005843 Bacteria 3891
59 Ga0068862_100351825 3300005844 Bacteria 1367
60 Ga0081539_10018647 3300005985 Bacteria 4802
61 Ga0097621_100083864 3300006237 Bacteria 2656
62 Ga0068871_100089221 3300006358 Bacteria 2566
63 Ga0068871_101104769 3300006358 Bacteria 741
64 Ga0068865_100003486 3300006881 Bacteria 9431
65 Ga0097620_100090493 3300006931 Bacteria 3111
66 Ga0097620_100166095 3300006931 Bacteria 2287
67 Ga0105240_10036132 3300009093 Bacteria 6358
68 Ga0105240_10078755 3300009093 Unclassified 4057
69 Ga0105240_10339582 3300009093 Unclassified 1707
70 Ga0105245_10046747 3300009098 Bacteria 3867
71 Ga0105247_10206182 3300009101 Bacteria 1324
72 Ga0105242_10004834 3300009176 Bacteria 10430
73 Ga0105248_10034472 3300009177 Bacteria 5660
74 Ga0105237_10012083 3300009545 Bacteria 9120
75 Ga0105237_10314005 3300009545 Bacteria 1570
76 Ga0105237_12181809 3300009545 Bacteria 563
77 Ga0105249_10050152 3300009553 Bacteria 3806
78 Ga0105249_10383510 3300009553 Bacteria 1432
79 Ga0099796_10474240 3300010159 Unclassified 559
80 Ga0105239_12601393 3300010375 Unclassified 590
81 Ga0157369_10420950 3300013105 Bacteria 1385
82 Ga0157378_10000158 3300013297 Bacteria 64291
83 Ga0163162_10010739 3300013306 Bacteria 8908
84 Ga0163162_11748635 3300013306 Bacteria 710
85 Ga0157372_11131642 3300013307 Bacteria 905
86 Ga0157372_11388572 3300013307 Bacteria 810
87 Ga0157375_10002359 3300013308 Bacteria 16317
88 Ga0163163_10034983 3300014325 Bacteria 4870
89 Ga0163163_10111543 3300014325 Unclassified 2764
90 Ga0182008_10069501 3300014497 Bacteria 1732
91 Ga0182008_10376425 3300014497 Bacteria 758
92 Ga0157379_10131206 3300014968 Bacteria 2256
93 Ga0157379_10511228 3300014968 Bacteria 1114
94 Ga0157379_11433164 3300014968 Unclassified 670
95 Ga0157376_10065300 3300014969 Bacteria 3072
96 Ga0157376_10723878 3300014969 Bacteria 1002
97 Ga0209676_1009369 3300025292 Bacteria 4231
98 Ga0209050_1001219 3300025298 Bacteria 30024
99 Ga0207680_10012177 3300025903 Bacteria 4374
100 Ga0207680_10073118 3300025903 Bacteria 2131
101 Ga0207654_10091833 3300025911 Bacteria 1852
102 Ga0207707_10096946 3300025912 Bacteria 2577
103 Ga0207695_10039732 3300025913 Bacteria 5054
104 Ga0207695_10280146 3300025913 Unclassified 1561
105 Ga0207695_10523080 3300025913 Bacteria 1068
106 Ga0207671_10235241 3300025914 Bacteria 1438
107 Ga0207663_10067866 3300025916 Bacteria 2289
108 Ga0207660_10056666 3300025917 Bacteria 2804
109 Ga0207652_10340550 3300025921 Unclassified 1354
110 Ga0207694_10604312 3300025924 Unclassified 922
111 Ga0207650_10199548 3300025925 Bacteria 1602
112 Ga0207659_10561326 3300025926 Bacteria 971
113 Ga0207687_10026703 3300025927 Bacteria 3868
114 Ga0207700_10096579 3300025928 Unclassified 2346
115 Ga0207690_10895144 3300025932 Bacteria 736
116 Ga0207686_10671682 3300025934 Bacteria 821
117 Ga0207711_10011142 3300025941 Bacteria 7473
118 Ga0207711_10114973 3300025941 Bacteria 2397
119 Ga0207689_10101940 3300025942 Bacteria 2358
120 Ga0207689_11274136 3300025942 Bacteria 618
121 Ga0207661_10042645 3300025944 Bacteria 3578
122 Ga0207661_10440125 3300025944 Unclassified 1186
123 Ga0207667_10030225 3300025949 Bacteria 5863
124 Ga0207667_10298894 3300025949 Bacteria 1645
125 Ga0207712_10519744 3300025961 Bacteria 1020
126 Ga0207668_10417860 3300025972 Bacteria 1138
127 Ga0207658_10000325 3300025986 Bacteria 48105
128 Ga0207658_10323287 3300025986 Bacteria 1336
129 Ga0207703_10958866 3300026035 Bacteria 820
130 Ga0207703_11496469 3300026035 Bacteria 649
131 Ga0207678_11074607 3300026067 Bacteria 712
132 Ga0207702_10795822 3300026078 Bacteria 934
133 Ga0207641_10021106 3300026088 Bacteria 5353
134 Ga0207641_10046125 3300026088 Bacteria 3673
135 Ga0207648_10373614 3300026089 Bacteria 1288
136 Ga0207676_10022023 3300026095 Bacteria 4683
137 Ga0207676_10103892 3300026095 Bacteria 2362
138 Ga0207674_10250681 3300026116 Bacteria 1717
139 Ga0207674_10715192 3300026116 Bacteria 967
140 Ga0207674_10840282 3300026116 Bacteria 886
141 Ga0207683_11512566 3300026121 Bacteria 620
142 Ga0209371_1047778 3300027312 Bacteria 835
143 Ga0268266_10000783 3300028379 Bacteria 42459
144 Ga0268266_10051033 3300028379 Bacteria 3550
145 Ga0268265_10066645 3300028380 Bacteria 2784
146 Ga0268264_10006166 3300028381 Bacteria 10123
147 Ga0268264_10075170 3300028381 Bacteria 2872
148 Ga0265334_10035677 3300028573 Bacteria 1967
149 Ga0307515_10006590 3300028794 Bacteria 23179
150 Ga0265338_10592613 3300028800 Bacteria 773
151 Ga0268256_1053829 3300030500 Bacteria 835
152 Ga0307511_10000037 3300030521 Bacteria 103008
153 Ga0307512_10178373 3300030522 Bacteria 1200
154 Ga0265340_10061704 3300031247 Bacteria 1792
155 Ga0265316_10343558 3300031344 Bacteria 1081
156 Ga0307513_10023092 3300031456 Bacteria 7278
157 Ga0307509_10000001 3300031507 Bacteria 629324
158 Ga0307408_100030687 3300031548 Bacteria 3735
159 Ga0307408_100433167 3300031548 Bacteria 1137
160 Ga0307408_100436342 3300031548 Bacteria 1133
161 Ga0307408_101269661 3300031548 Bacteria 689
162 Ga0307514_10005618 3300031649 Bacteria 11112
163 Ga0307516_10000056 3300031730 Bacteria 122840
164 Ga0307405_10398635 3300031731 Bacteria 1076
165 Ga0307413_10001880 3300031824 Bacteria 8293
166 Ga0307410_10138083 3300031852 Unclassified 1799
167 Ga0307406_10060495 3300031901 Unclassified 2442
168 Ga0307407_10038893 3300031903 Bacteria 2640
169 Ga0307412_10001185 3300031911 Bacteria 14849
170 Ga0307412_10020652 3300031911 Bacteria 4011
171 Ga0307412_10116479 3300031911 Bacteria 1917
172 Ga0307412_10152063 3300031911 Bacteria 1709
173 Ga0307412_10589225 3300031911 Bacteria 940
174 Ga0307409_100022216 3300031995 Bacteria 4368
175 Ga0307416_101452505 3300032002 Unclassified 791
176 Ga0307416_102502763 3300032002 Bacteria 615
177 Ga0307411_10058268 3300032005 Bacteria 2555
178 Ga0307415_100002241 3300032126 Bacteria 9568
179 Ga0307510_10265574 3300033180 Bacteria 1195
180 Ga0373934_0084641 3300035086 Bacteria 1276
181 Ga0373932_0147313 3300035112 Bacteria 805
182 Ga0373956_0056744 3300035119 Bacteria 1769
183 Ga0373931_0443345 3300035691 Bacteria 829
184 Ga0395900_0953752 3300037418 Bacteria 779
185 Ga0395905_0092096 3300037471 Bacteria 2842
186 Ga0395905_0673790 3300037471 Bacteria 936
187 Ga0439436_0015745 3300041404 Bacteria 2272
188 Ga0439461_0161297 3300041410 Bacteria 584
189 Ga0439466_0031675 3300041411 Bacteria 1807
190 Ga0439465_0299882 3300041413 Bacteria 601
191 Ga0439432_159495 3300042006 Bacteria 660
192 Ga0439449_0000612 3300042007 Bacteria 13391
193 Ga0450912_015755 3300042116 Bacteria 696
194 Ga0439446_0052719 3300042156 Bacteria 1218
195 Ga0439435_0207487 3300042436 Bacteria 648
196 Ga0439464_0316057 3300042439 Bacteria 512
197 Ga0451577_0005919 3300042876 Bacteria 12338
198 Ga0466969_0000744 3300044656 Bacteria 17623
199 Ga0466969_0009950 3300044656 Bacteria 5042
200 Ga0466972_0207775 3300044658 Bacteria 916
201 Ga0466965_0105661 3300044683 Bacteria 1443
202 Ga0466966_0006478 3300044684 Bacteria 7749
203 Ga0466966_0171141 3300044684 Bacteria 1320
204 Ga0466961_0010479 3300044693 Bacteria 5913
205 Ga0466961_0251167 3300044693 Bacteria 1086
206 Ga0453684_0852182 3300044712 Bacteria 979
207 Ga0466968_0060260 3300044735 Bacteria 1636
208 Ga0466968_0578166 3300044735 Bacteria 565
209 Ga0466970_0009001 3300044765 Bacteria 5036
210 Ga0466970_0130119 3300044765 Bacteria 1382
211 Ga0466970_0371869 3300044765 Bacteria 813
212 Ga0466970_0518637 3300044765 Bacteria 687
213 Ga0466957_0627447 3300044842 Bacteria 754
214 Ga0466960_0156826 3300044901 Bacteria 1219
215 Ga0466959_0005030 3300045049 Bacteria 8979
216 Ga0466959_0017468 3300045049 Bacteria 5260
217 Ga0466959_0035096 3300045049 Bacteria 3710
218 Ga0466959_0139428 3300045049 Bacteria 1715
219 Ga0451576_0009874 3300045051 Bacteria 11026
220 Ga0466967_1599168 3300045976 Bacteria 649
221 Ga0495629_0548034 3300046459 Bacteria 776
222 Ga0495629_1023486 3300046459 Bacteria 537
223 Ga0495580_0040589 3300046472 Bacteria 3323
224 Ga0495582_0021867 3300046473 Bacteria 3499
225 Ga0495582_0832814 3300046473 Unclassified 534
226 Ga0495639_0129430 3300046475 Bacteria 1208
227 Ga0495630_0818800 3300046517 Bacteria 711
228 Ga0495648_0381934 3300046524 Unclassified 635
229 Ga0495663_0059160 3300046525 Bacteria 1202
230 Ga0495642_0042283 3300046528 Bacteria 1856
231 Ga0495654_0104882 3300046530 Bacteria 1296
232 Ga0495665_0049695 3300046531 Bacteria 2223
233 Ga0495586_0108281 3300046535 Bacteria 1546
234 Ga0495645_0529180 3300046543 Bacteria 733
235 Ga0495656_0019050 3300046615 Bacteria 2644
236 Ga0495661_0323375 3300046665 Bacteria 766
237 Ga0495657_0368134 3300046675 Bacteria 849
238 Ga0495647_0018339 3300046681 Bacteria 2490
239 Ga0495658_0064556 3300046683 Bacteria 2109
240 Ga0495613_0083638 3300046689 Bacteria 2318
241 Ga0495670_0700277 3300046691 Bacteria 552
242 Ga0495600_0505471 3300046809 Bacteria 742
243 Ga0495636_0462575 3300047318 Bacteria 610
244 Ga0495674_0205422 3300047319 Bacteria 1633
245 Ga0495674_1125028 3300047319 Unclassified 597
246 Ga0495676_1068982 3300047321 Archaea 514
247 Ga0495680_0330922 3300047322 Bacteria 1064
248 Ga0495677_0023025 3300047445 Bacteria 2261
249 Ga0495685_040599 3300047447 Bacteria 1591
250 Ga0495684_0113703 3300047471 Bacteria 2041
251 Ga0495626_0092634 3300048091 Bacteria 1327
252 Ga0496100_0708601 3300048903 Bacteria 786
253 Ga0496101_0289720 3300048904 Bacteria 1281
254 Ga0496102_0130390 3300048905 Bacteria 2353
255 Ga0496104_0000058 3300048907 Bacteria 118768
256 Ga0496104_0431272 3300048907 Bacteria 1230
257 Ga0496104_1457991 3300048907 Unclassified 587
258 Ga0496105_0000021 3300048908 Bacteria 164255
259 Ga0496108_0453678 3300048911 Bacteria 1120
260 Ga0496111_0854582 3300048914 Bacteria 657
261 Ga0496116_0001634 3300048919 Bacteria 24666
262 Ga0496116_0080879 3300048919 Bacteria 2016
263 Ga0496117_0613104 3300048920 Bacteria 507
264 Ga0496118_0013298 3300048921 Bacteria 7798
265 Ga0496118_0067495 3300048921 Bacteria 2603
266 Ga0496119_0103390 3300048922 Bacteria 1595
267 Ga0496120_0004000 3300048923 Bacteria 12812
268 Ga0496120_0327298 3300048923 Bacteria 694
269 Ga0496121_0000211 3300048924 Bacteria 127602
270 Ga0496121_0126473 3300048924 Bacteria 1920
271 Ga0496122_0000021 3300048925 Bacteria 391363
272 Ga0496122_0057909 3300048925 Bacteria 2873
273 Ga0496122_0082057 3300048925 Bacteria 2241
274 Ga0496122_0326957 3300048925 Bacteria 812
275 Ga0496123_0000174 3300048926 Bacteria 130310
276 Ga0496123_0014822 3300048926 Bacteria 6434
277 Ga0496123_0425741 3300048926 Bacteria 597
278 Ga0496124_0077032 3300048927 Bacteria 2751
279 Ga0496124_0262659 3300048927 Bacteria 1269
280 Ga0496125_0000005 3300048928 Bacteria 827598
281 Ga0496125_0022549 3300048928 Bacteria 5841
282 Ga0496125_0120861 3300048928 Bacteria 1869
283 Ga0496125_0731836 3300048928 Bacteria 521
284 Ga0496126_0111788 3300048929 Bacteria 2379
285 Ga0496126_0298433 3300048929 Bacteria 1330
286 Ga0501033_0387108 3300049570 Bacteria 976
287 Ga0501038_1208436 3300049574 Unclassified 549
288 Ga0501071_0981598 3300049587 Bacteria 652
289 Ga0501072_1512363 3300049588 Unclassified 518
290 Ga0501035_0303633 3300049822 Bacteria 1344
291 Ga0501044_0089475 3300049823 Bacteria 3107
292 Ga0495619_1103030 3300053085 Unclassified 528
293 Ga0500572_139873 3300053111 Bacteria 788
294 Ga0500614_138558 3300053123 Unclassified 727
295 Ga0500642_0446421 3300053130 Unclassified 556
296 Ga0500590_002156 3300053148 Bacteria 8560
297 Ga0500636_0237695 3300053177 Bacteria 938
298 Ga0500637_0030139 3300053178 Bacteria 3016
299 Ga0500637_0085162 3300053178 Unclassified 1827
300 2643863370 2643221569 Bacteria 6064337
301 2643978759 2643221594 Bacteria 5811388
302 2644120197 2643221621 Bacteria 6212786
303 2809036482 2808606395 Bacteria 6020352
304 2941483387
305 Ga0265328_10004615
306 JGI24744J21845_10058199
307 rootH1_10388109
308 Ga0058863_11299941
309 Ga0058861_11859955
310 Ga0058862_12767649
311 Ga0065714_10416524
312 Ga0070683_100023239
313 Ga0070683_100617153
314 Ga0070690_100538262
315 Ga0070670_102027595
316 Ga0068869_100088832
317 Ga0068869_100484561
318 Ga0068869_100569986
319 Ga0070666_10112657
320 Ga0070680_100036515
321 Ga0070682_100719586
322 Ga0068868_100187753
323 Ga0070668_100148910
324 Ga0070669_100603931
325 Ga0070675_100359660
326 Ga0070671_100062432
327 Ga0070671_101272368
328 Ga0070659_100654269
329 Ga0070667_100000068
330 Ga0070667_100440210
331 Ga0070667_100727985
332 Ga0070714_100846320
333 Ga0070713_100053256
334 Ga0070710_10281604
335 Ga0070711_100206262
336 Ga0070663_100769164
337 Ga0070678_100809537
338 Ga0070678_101187289
339 Ga0070681_10105250
340 Ga0070679_100258360
341 Ga0070684_100051456
342 Ga0070672_100593827
343 Ga0070672_100648235
344 Ga0070665_100034144
345 Ga0070665_100114583
346 Ga0070665_101466181
347 Ga0068855_100012669
348 Ga0068855_100084571
349 Ga0068857_100239438
350 Ga0068857_100346572
351 Ga0068856_100171489
352 Ga0068856_101342889
353 Ga0068859_100090494
354 Ga0068859_100166092
355 Ga0068864_100020426
356 Ga0068864_100041325
357 Ga0068870_10221096
358 Ga0068863_100064087
359 Ga0068863_100167329
360 Ga0068858_101575846
361 Ga0068860_100003481
362 Ga0068860_100052159
363 Ga0068862_100351825
364 Ga0081539_10018647
365 Ga0097621_100083864
366 Ga0068871_100089221
367 Ga0068871_101104769
368 Ga0068865_100003486
369 Ga0097620_100090493
370 Ga0097620_100166095
371 Ga0105240_10036132
372 Ga0105240_10078755
373 Ga0105240_10339582
374 Ga0105245_10046747
375 Ga0105247_10206182
376 Ga0105242_10004834
377 Ga0105248_10034472
378 Ga0105237_10012083
379 Ga0105237_10314005
380 Ga0105237_12181809
381 Ga0105249_10050152
382 Ga0105249_10383510
383 Ga0099796_10474240
384 Ga0105239_12601393
385 Ga0157369_10420950
386 Ga0157378_10000158
387 Ga0163162_10010739
388 Ga0163162_11748635
389 Ga0157372_11131642
390 Ga0157372_11388572
391 Ga0157375_10002359
392 Ga0163163_10034983
393 Ga0163163_10111543
394 Ga0182008_10069501
395 Ga0182008_10376425
396 Ga0157379_10131206
397 Ga0157379_10511228
398 Ga0157379_11433164
399 Ga0157376_10065300
400 Ga0157376_10723878
401 Ga0209676_1009369
402 Ga0209050_1001219
403 Ga0207680_10012177
404 Ga0207680_10073118
405 Ga0207654_10091833
406 Ga0207707_10096946
407 Ga0207695_10039732
408 Ga0207695_10280146
409 Ga0207695_10523080
410 Ga0207671_10235241
411 Ga0207663_10067866
412 Ga0207660_10056666
413 Ga0207652_10340550
414 Ga0207694_10604312
415 Ga0207650_10199548
416 Ga0207659_10561326
417 Ga0207687_10026703
418 Ga0207700_10096579
419 Ga0207690_10895144
420 Ga0207686_10671682
421 Ga0207711_10011142
422 Ga0207711_10114973
423 Ga0207689_10101940
424 Ga0207689_11274136
425 Ga0207661_10042645
426 Ga0207661_10440125
427 Ga0207667_10030225
428 Ga0207667_10298894
429 Ga0207712_10519744
430 Ga0207668_10417860
431 Ga0207658_10000325
432 Ga0207658_10323287
433 Ga0207703_10958866
434 Ga0207703_11496469
435 Ga0207678_11074607
436 Ga0207702_10795822
437 Ga0207641_10021106
438 Ga0207641_10046125
439 Ga0207648_10373614
440 Ga0207676_10022023
441 Ga0207676_10103892
442 Ga0207674_10250681
443 Ga0207674_10715192
444 Ga0207674_10840282
445 Ga0207683_11512566
446 Ga0209371_1047778
447 Ga0268266_10000783
448 Ga0268266_10051033
449 Ga0268265_10066645
450 Ga0268264_10006166
451 Ga0268264_10075170
452 Ga0265334_10035677
453 Ga0307515_10006590
454 Ga0265338_10592613
455 Ga0268256_1053829
456 Ga0307511_10000037
457 Ga0307512_10178373
458 Ga0265340_10061704
459 Ga0265316_10343558
460 Ga0307513_10023092
461 Ga0307509_10000001
462 Ga0307408_100030687
463 Ga0307408_100433167
464 Ga0307408_100436342
465 Ga0307408_101269661
466 Ga0307514_10005618
467 Ga0307516_10000056
468 Ga0307405_10398635
469 Ga0307413_10001880
470 Ga0307410_10138083
471 Ga0307406_10060495
472 Ga0307407_10038893
473 Ga0307412_10001185
474 Ga0307412_10020652
475 Ga0307412_10116479
476 Ga0307412_10152063
477 Ga0307412_10589225
478 Ga0307409_100022216
479 Ga0307416_101452505
480 Ga0307416_102502763
481 Ga0307411_10058268
482 Ga0307415_100002241
483 Ga0307510_10265574
484 Ga0373934_0084641
485 Ga0373932_0147313
486 Ga0373956_0056744
487 Ga0373931_0443345
488 Ga0395900_0953752
489 Ga0395905_0092096
490 Ga0395905_0673790
491 Ga0439436_0015745
492 Ga0439461_0161297
493 Ga0439466_0031675
494 Ga0439465_0299882
495 Ga0439432_159495
496 Ga0439449_0000612
497 Ga0450912_015755
498 Ga0439446_0052719
499 Ga0439435_0207487
500 Ga0439464_0316057
501 Ga0451577_0005919
502 Ga0466969_0000744
503 Ga0466969_0009950
504 Ga0466972_0207775
505 Ga0466965_0105661
506 Ga0466966_0006478
507 Ga0466966_0171141
508 Ga0466961_0010479
509 Ga0466961_0251167
510 Ga0453684_0852182
511 Ga0466968_0060260
512 Ga0466968_0578166
513 Ga0466970_0009001
514 Ga0466970_0130119
515 Ga0466970_0371869
516 Ga0466970_0518637
517 Ga0466957_0627447
518 Ga0466960_0156826
519 Ga0466959_0005030
520 Ga0466959_0017468
521 Ga0466959_0035096
522 Ga0466959_0139428
523 Ga0451576_0009874
524 Ga0466967_1599168
525 Ga0495629_0548034
526 Ga0495629_1023486
527 Ga0495580_0040589
528 Ga0495582_0021867
529 Ga0495582_0832814
530 Ga0495639_0129430
531 Ga0495630_0818800
532 Ga0495648_0381934
533 Ga0495663_0059160
534 Ga0495642_0042283
535 Ga0495654_0104882
536 Ga0495665_0049695
537 Ga0495586_0108281
538 Ga0495645_0529180
539 Ga0495656_0019050
540 Ga0495661_0323375
541 Ga0495657_0368134
542 Ga0495647_0018339
543 Ga0495658_0064556
544 Ga0495613_0083638
545 Ga0495670_0700277
546 Ga0495600_0505471
547 Ga0495636_0462575
548 Ga0495674_0205422
549 Ga0495674_1125028
550 Ga0495676_1068982
551 Ga0495680_0330922
552 Ga0495677_0023025
553 Ga0495685_040599
554 Ga0495684_0113703
555 Ga0495626_0092634
556 Ga0496100_0708601
557 Ga0496101_0289720
558 Ga0496102_0130390
559 Ga0496104_0000058
560 Ga0496104_0431272
561 Ga0496104_1457991
562 Ga0496105_0000021
563 Ga0496108_0453678
564 Ga0496111_0854582
565 Ga0496116_0001634
566 Ga0496116_0080879
567 Ga0496117_0613104
568 Ga0496118_0013298
569 Ga0496118_0067495
570 Ga0496119_0103390
571 Ga0496120_0004000
572 Ga0496120_0327298
573 Ga0496121_0000211
574 Ga0496121_0126473
575 Ga0496122_0000021
576 Ga0496122_0057909
577 Ga0496122_0082057
578 Ga0496122_0326957
579 Ga0496123_0000174
580 Ga0496123_0014822
581 Ga0496123_0425741
582 Ga0496124_0077032
583 Ga0496124_0262659
584 Ga0496125_0000005
585 Ga0496125_0022549
586 Ga0496125_0120861
587 Ga0496125_0731836
588 Ga0496126_0111788
589 Ga0496126_0298433
590 Ga0501033_0387108
591 Ga0501038_1208436
592 Ga0501071_0981598
593 Ga0501072_1512363
594 Ga0501035_0303633
595 Ga0501044_0089475
596 Ga0495619_1103030
597 Ga0500572_139873
598 Ga0500614_138558
599 Ga0500642_0446421
600 Ga0500590_002156
601 Ga0500636_0237695
602 Ga0500637_0030139
603 Ga0500637_0085162
604 2643863370
605 2643978759
606 2644120197
607 2809036482
608 2941483387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

22

136

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9123 1 114
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8833 1 114
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6946 1 113
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6826 1 115
2nzc-assembly1.cif.gz_C the structure of uncharacterized protein tm1266 from thermotoga maritima. 0.6736 2 110
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9123 1 114 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8833 1 114 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7533 1 114 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7005 1 115 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7002 1 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A6N8SSE1-F1-model_v4 deleted 0.984 1 117
AF-A0A6I2GU57-F1-model_v4 Dehydrogenase 0.9798 1 117
AF-A0A2N8KZH9-F1-model_v4 Dehydrogenase 0.9767 2 117
AF-A0A6N8SSE1-F1-model_v4 deleted 0.9758 1 117
AF-B1Y0D2-F1-model_v4 DGPFAETKE family protein 0.9738 1 117 GO:0005829
GO:0006541

Map